| Contig-U15121-1 |
| Contig ID |
Contig-U15121-1 |
| Contig update |
2004. 6.11 |
| Contig sequence |
 |
| Gap |
no gap |
| Contig length |
828 |
| Chromosome number (1..6, M) |
1 |
| Chromosome length |
4919822 |
| Start point |
225404 |
| End point |
224577 |
| Strand (PLUS/MINUS) |
MINUS |
| Number of clones |
20 |
| Number of EST |
21 |
| Link to clone list |
U15121 |
| List of clone(s) |
|
| Translated Amino Acid sequence |
|
| Translated Amino Acid sequence (All Frames) |
|
| own update |
2004. 6.23 |
| Homology vs CSM-cDNA |
|
| dna update |
2009. 1.12 |
| Homology vs DNA |
Query= Contig-U15121-1 (Contig-U15121-1Q) /CSM_Contig/Contig-U15121-1Q.Seq.d
(828 letters)
Database: ddbj_A
92,845,959 sequences; 95,242,211,685 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value N
(C22776) Dictyostelium discoideum gamete cDNA, clone FC-AI04. 1205 0.0 2
(C94004) Dictyostelium discoideum slug cDNA, clone SSK688. 1164 0.0 1
(C93998) Dictyostelium discoideum slug cDNA, clone SSK680. 1164 0.0 1
(C89624) Dictyostelium discoideum slug cDNA, clone SSA372. 1160 0.0 1
(AU262054) Dictyostelium discoideum vegetative cDNA clone:VS... 1057 0.0 2
(AU269272) Dictyostelium discoideum vegetative cDNA clone:VS... 864 0.0 3
(C90309) Dictyostelium discoideum slug cDNA, clone SSI786. 892 0.0 2
(AU284421) Dictyostelium discoideum gamete cDNA clone:FC-AU0... 862 0.0 3
(AU261749) Dictyostelium discoideum vegetative cDNA clone:VS... 870 0.0 2
(C90128) Dictyostelium discoideum slug cDNA, clone SSI123. 638 0.0 2
(AU051867) Dictyostelium discoideum slug cDNA, clone SSB350. 630 0.0 2
(AU038500) Dictyostelium discoideum slug cDNA, clone SSH794. 581 e-166 2
(AU262428) Dictyostelium discoideum vegetative cDNA clone:VS... 547 e-156 2
(AU071376) Dictyostelium discoideum slug cDNA, clone SSB350. 476 e-130 1
(AU054014) Dictyostelium discoideum slug cDNA, clone SLK419. 398 e-111 2
(AU073159) Dictyostelium discoideum slug cDNA, clone SSG279. 392 e-105 1
(AU071931) Dictyostelium discoideum slug cDNA, clone SSC764. 392 e-105 1
(AU074529) Dictyostelium discoideum slug cDNA, clone SSL216. 391 e-104 1
(AU071928) Dictyostelium discoideum slug cDNA, clone SSC756. 383 e-102 1
(AU060564) Dictyostelium discoideum slug cDNA, clone SLK419. 335 2e-87 1
(AU038592) Dictyostelium discoideum slug cDNA, clone SSL216. 285 9e-78 2
(AU275046) Dictyostelium discoideum gamete cDNA clone:FC-IC1... 190 6e-44 1
(EY450716) CBAZ442.rev CBAZ Tubifex tubifex Embryos and juve... 32 0.046 3
(AF498242) Anopheles sinensis isolate 6 intergenic spacer re... 36 0.076 3
(AM539396) Paracentrotus lividus EST, clone MPMGp1171B08208Q... 30 1.9 3
(CE261759) tigr-gss-dog-17000346579730 Dog Library Canis lup... 46 2.1 1
(BX324213) Zebrafish DNA sequence from clone DKEY-102C8 in l... 44 8.3 1
(Z79599) Caenorhabditis elegans Cosmid F47C8. 44 8.3 1
(AC096642) Homo sapiens chromosome 1 clone RP11-392O17, comp... 44 8.3 1
(AC008686) Homo sapiens chromosome 19 clone CTB-5E10, comple... 44 8.3 1
(AC109388) Rattus norvegicus clone CH230-90P14, *** SEQUENCI... 44 8.3 1
(AC223670) Bos taurus clone CH240-462H9, WORKING DRAFT SEQUE... 44 8.3 1
(AC205298) Macaca mulatta chromosome UNKNOWN clone CH250-218... 44 8.3 1
(AC017030) Homo sapiens chromosome 19 clone RP11-285H8, WORK... 44 8.3 1
(DH787669) Rattus norvegicus DNA, BAC clone: RNB1-378F16, 3'... 44 8.3 1
(DH566878) Rattus norvegicus DNA, BAC clone: RNB1-080N22, 3'... 44 8.3 1
(DW272116) UI-S-GS1-acm-a-15-0-UI.s1 UI-S-GS1 Euprymna scolo... 44 8.3 1
(DC373184) Homo sapiens cDNA, clone NTONG2002356, 5' end, mR... 44 8.3 1
(DC319995) Homo sapiens cDNA, clone BRAWH2014909, 5' end, mR... 44 8.3 1
(AC226048) Musa acuminata clone BAC MA4-99N22, complete sequ... 32 9.5 4
>(C22776) Dictyostelium discoideum gamete cDNA, clone FC-AI04.
Length = 772
Score = 1205 bits (608), Expect(2) = 0.0
Identities = 611/612 (99%)
Strand = Plus / Plus
Query: 72 caataaaagaaaatgagaagaacattagcaggtccaggttcaagcacttcaaatcacaaa 131
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 35 caataaaagaaaatgagaagaacattagcaggtccaggttcaagcacttcaaatcacaaa 94
Query: 132 ccaaccgttgatattggtaaaactgcaccagcaggtacaaacaatgacggtttcagacgt 191
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 95 ccaaccgttgatattggtaaaactgcaccagcaggtacaaacaatgacggtttcagacgt 154
Query: 192 caaggtgcttcatcaggtccacaatcaagtgtttccacatataccccaaccaccgattca 251
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 155 caaggtgcttcatcaggtccacaatcaagtgtttccacatataccccaaccaccgattca 214
Query: 252 ggtaaacaagcaccagcaggtggtaacaatgacggtttcagacgtcaaggtgcctcatct 311
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 215 ggtaaacaagcaccagcaggtggtaacaatgacggtttcagacgtcaaggtgcctcatct 274
Query: 312 ggtccacaatcaagtgtttccacatataccccaaccaccgattcaggtaaacaagcacca 371
|||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||
Sbjct: 275 ggtccacaatcaagtgtttccacatataccccaaccaccggttcaggtaaacaagcacca 334
Query: 372 gcaggtggtaaccaagacggtttcagacgtactggtgcctcatcaggtccacaatcaagt 431
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 335 gcaggtggtaaccaagacggtttcagacgtactggtgcctcatcaggtccacaatcaagt 394
Query: 432 gtttccacatataccccaacaaatgactctggtaaacaagcaccagccggtggtaaccaa 491
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 395 gtttccacatataccccaacaaatgactctggtaaacaagcaccagccggtggtaaccaa 454
Query: 492 gacggtttcagacgtactggtgcctcatcaggtccacaatcaagtgtttcctcatacacc 551
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 455 gacggtttcagacgtactggtgcctcatcaggtccacaatcaagtgtttcctcatacacc 514
Query: 552 ccaactcaagatccaggtgtatcttcaagtgtttcaggtggtggtggtaacgattatttc 611
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 515 ccaactcaagatccaggtgtatcttcaagtgtttcaggtggtggtggtaacgattatttc 574
Query: 612 agccatcacaacgaagaatcaaactaaatataaatcctaattatttaattggcgtgtaaa 671
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 575 agccatcacaacgaagaatcaaactaaatataaatcctaattatttaattggcgtgtaaa 634
Query: 672 tttaatttgtca 683
||||||||||||
Sbjct: 635 tttaatttgtca 646
Score = 38.2 bits (19), Expect(2) = 0.0
Identities = 19/19 (100%)
Strand = Plus / Plus
Query: 693 gttgtaataatgtaaattc 711
|||||||||||||||||||
Sbjct: 656 gttgtaataatgtaaattc 674
Score = 291 bits (147), Expect(2) = e-117
Identities = 180/191 (94%)
Strand = Plus / Plus
Query: 261 gcaccagcaggtggtaacaatgacggtttcagacgtcaaggtgcctcatctggtccacaa 320
|||||||||||| ||||||||||||||||||||||||||||| ||||| |||||||||
Sbjct: 119 gcaccagcaggtacaaacaatgacggtttcagacgtcaaggtgcttcatcaggtccacaa 178
Query: 321 tcaagtgtttccacatataccccaaccaccgattcaggtaaacaagcaccagcaggtggt 380
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 179 tcaagtgtttccacatataccccaaccaccgattcaggtaaacaagcaccagcaggtggt 238
Query: 381 aaccaagacggtttcagacgtactggtgcctcatcaggtccacaatcaagtgtttccaca 440
||| | ||||||||||||||| ||||||||||| ||||||||||||||||||||||||
Sbjct: 239 aacaatgacggtttcagacgtcaaggtgcctcatctggtccacaatcaagtgtttccaca 298
Query: 441 tataccccaac 451
|||||||||||
Sbjct: 299 tataccccaac 309
Score = 165 bits (83), Expect(2) = e-117
Identities = 92/95 (96%)
Strand = Plus / Plus
Query: 462 ggtaaacaagcaccagccggtggtaaccaagacggtttcagacgtactggtgcctcatca 521
||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||
Sbjct: 320 ggtaaacaagcaccagcaggtggtaaccaagacggtttcagacgtactggtgcctcatca 379
Query: 522 ggtccacaatcaagtgtttcctcatacaccccaac 556
||||||||||||||||||||| |||| ||||||||
Sbjct: 380 ggtccacaatcaagtgtttccacatataccccaac 414
Score = 428 bits (216), Expect = e-115
Identities = 276/296 (93%)
Strand = Plus / Plus
Query: 156 gcaccagcaggtacaaacaatgacggtttcagacgtcaaggtgcttcatcaggtccacaa 215
|||||||||||| ||||||||||||||||||||||||||||| ||||| |||||||||
Sbjct: 224 gcaccagcaggtggtaacaatgacggtttcagacgtcaaggtgcctcatctggtccacaa 283
Query: 216 tcaagtgtttccacatataccccaaccaccgattcaggtaaacaagcaccagcaggtggt 275
||||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||
Sbjct: 284 tcaagtgtttccacatataccccaaccaccggttcaggtaaacaagcaccagcaggtggt 343
Query: 276 aacaatgacggtttcagacgtcaaggtgcctcatctggtccacaatcaagtgtttccaca 335
||| | ||||||||||||||| ||||||||||| ||||||||||||||||||||||||
Sbjct: 344 aaccaagacggtttcagacgtactggtgcctcatcaggtccacaatcaagtgtttccaca 403
Query: 336 tataccccaaccaccgattcaggtaaacaagcaccagcaggtggtaaccaagacggtttc 395
||||||||||| | || || ||||||||||||||||| |||||||||||||||||||||
Sbjct: 404 tataccccaacaaatgactctggtaaacaagcaccagccggtggtaaccaagacggtttc 463
Query: 396 agacgtactggtgcctcatcaggtccacaatcaagtgtttccacatataccccaac 451
|||||||||||||||||||||||||||||||||||||||||| |||| ||||||||
Sbjct: 464 agacgtactggtgcctcatcaggtccacaatcaagtgtttcctcatacaccccaac 519
Score = 196 bits (99), Expect = 9e-46
Identities = 168/191 (87%)
Strand = Plus / Plus
Query: 366 gcaccagcaggtggtaaccaagacggtttcagacgtactggtgcctcatcaggtccacaa 425
|||||||||||| ||| | ||||||||||||||| ||||| |||||||||||||||
Sbjct: 119 gcaccagcaggtacaaacaatgacggtttcagacgtcaaggtgcttcatcaggtccacaa 178
Query: 426 tcaagtgtttccacatataccccaacaaatgactctggtaaacaagcaccagccggtggt 485
|||||||||||||||||||||||||| | || || ||||||||||||||||| ||||||
Sbjct: 179 tcaagtgtttccacatataccccaaccaccgattcaggtaaacaagcaccagcaggtggt 238
Query: 486 aaccaagacggtttcagacgtactggtgcctcatcaggtccacaatcaagtgtttcctca 545
||| | ||||||||||||||| ||||||||||| ||||||||||||||||||||| ||
Sbjct: 239 aacaatgacggtttcagacgtcaaggtgcctcatctggtccacaatcaagtgtttccaca 298
Query: 546 tacaccccaac 556
|| ||||||||
Sbjct: 299 tataccccaac 309
Score = 196 bits (99), Expect = 9e-46
Identities = 168/191 (87%)
Strand = Plus / Plus
Query: 156 gcaccagcaggtacaaacaatgacggtttcagacgtcaaggtgcttcatcaggtccacaa 215
|||||||||||| ||| | ||||||||||||||| ||||| |||||||||||||||
Sbjct: 329 gcaccagcaggtggtaaccaagacggtttcagacgtactggtgcctcatcaggtccacaa 388
Query: 216 tcaagtgtttccacatataccccaaccaccgattcaggtaaacaagcaccagcaggtggt 275
|||||||||||||||||||||||||| | || || ||||||||||||||||| ||||||
Sbjct: 389 tcaagtgtttccacatataccccaacaaatgactctggtaaacaagcaccagccggtggt 448
Query: 276 aacaatgacggtttcagacgtcaaggtgcctcatctggtccacaatcaagtgtttccaca 335
||| | ||||||||||||||| ||||||||||| ||||||||||||||||||||| ||
Sbjct: 449 aaccaagacggtttcagacgtactggtgcctcatcaggtccacaatcaagtgtttcctca 508
Query: 336 tataccccaac 346
|| ||||||||
Sbjct: 509 tacaccccaac 519
Score = 81.8 bits (41), Expect = 4e-11
Identities = 59/65 (90%)
Strand = Plus / Plus
Query: 492 gacggtttcagacgtactggtgcctcatcaggtccacaatcaagtgtttcctcatacacc 551
||||||||||||||| ||||| ||||||||||||||||||||||||||| |||| |||
Sbjct: 140 gacggtttcagacgtcaaggtgcttcatcaggtccacaatcaagtgtttccacatatacc 199
Query: 552 ccaac 556
|||||
Sbjct: 200 ccaac 204
Score = 81.8 bits (41), Expect = 4e-11
Identities = 59/65 (90%)
Strand = Plus / Plus
Query: 177 gacggtttcagacgtcaaggtgcttcatcaggtccacaatcaagtgtttccacatatacc 236
||||||||||||||| ||||| ||||||||||||||||||||||||||| |||| |||
Sbjct: 455 gacggtttcagacgtactggtgcctcatcaggtccacaatcaagtgtttcctcatacacc 514
Query: 237 ccaac 241
|||||
Sbjct: 515 ccaac 519
Lambda K H
1.37 0.711 1.31
Matrix: blastn matrix:1 -3
Number of Sequences: 92845959
Number of Hits to DB: 626,872,570
Number of extensions: 36790111
Number of successful extensions: 2827619
Number of sequences better than 10.0: 40
Length of query: 828
Length of database: 95,242,211,685
Length adjustment: 24
Effective length of query: 804
Effective length of database: 97,308,875,965
Effective search space: 78236336275860
Effective search space used: 78236336275860
X1: 11 (21.8 bits)
S2: 22 (44.1 bits)
|
| protein update |
2009. 7.14 |
| Homology vs Protein |
Query= Contig-U15121-1 (Contig-U15121-1Q) /CSM_Contig/Contig-U15121-1Q.Seq.d
(828 letters)
Database: nrp_B
3,236,559 sequences; 1,051,180,864 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
L10411_1(L10411|pid:none) Entamoeba histolytica 20 kDa repeat pr... 97 8e-19
CR382129_153(CR382129|pid:none) Yarrowia lipolytica strain CLIB1... 61 5e-08
(P08672) RecName: Full=Circumsporozoite protein; Short=... 56 1e-06
CU928178_107(CU928178|pid:none) Zygosaccharomyces rouxii strain ... 53 1e-05
AC116032_6(AC116032|pid:none) Dictyostelium discoideum chromosom... 52 3e-05
FM204884_498(FM204884|pid:none) Streptococcus equi subsp. zooepi... 52 3e-05
(P54681) RecName: Full=Protein rtoA; AltName: Full=Ratio-A; Flag... 51 4e-05
S52714(S52714) sericin1B - silkworm &Z48802_1(Z48802|pid:none) 51 4e-05
AB281482_1(AB281482|pid:none) Bacillus anthracis bclA gene for B... 50 9e-05
AB281480_1(AB281480|pid:none) Bacillus anthracis bclA gene for B... 50 9e-05
AB281478_1(AB281478|pid:none) Bacillus anthracis bclA gene for B... 50 9e-05
CP000764_2251(CP000764|pid:none) Bacillus cereus subsp. cytotoxi... 50 9e-05
AB281483_1(AB281483|pid:none) Bacillus anthracis bclA gene for B... 50 9e-05
CP001176_1140(CP001176|pid:none) Bacillus cereus B4264, complete... 50 1e-04
AB281481_1(AB281481|pid:none) Bacillus anthracis bclA gene for B... 50 1e-04
CR382133_38(CR382133|pid:none) Debaryomyces hansenii strain CBS7... 49 2e-04
FM204883_1525(FM204883|pid:none) Streptococcus equi subsp. equi ... 49 2e-04
AY326316_1(AY326316|pid:none) Streptococcus equi collagen-like p... 49 2e-04
EF678405_1(EF678405|pid:none) Picea sitchensis clone WS0291_A13 ... 49 2e-04
EU678331_1(EU678331|pid:none) Haemophilus parasuis strain HP-216... 49 2e-04
AJ516938_1(AJ516938|pid:none) Bacillus anthracis bclA gene, stra... 49 3e-04
AE014297_2413(AE014297|pid:none) Drosophila melanogaster chromos... 49 3e-04
AB281486_1(AB281486|pid:none) Bacillus anthracis bclA gene for B... 49 3e-04
AB281485_1(AB281485|pid:none) Bacillus anthracis bclA gene for B... 49 3e-04
AB281484_1(AB281484|pid:none) Bacillus anthracis bclA gene for B... 48 3e-04
EU687468_1(EU687468|pid:none) Plasmodium knowlesi isolate MPHG38... 48 3e-04
(Q8T2I5) RecName: Full=Probable GH family 25 lysozyme 3; ... 48 3e-04
AM746676_5467(AM746676|pid:none) Sorangium cellulosum 'So ce 56'... 48 3e-04
FM204884_1506(FM204884|pid:none) Streptococcus equi subsp. zooep... 48 4e-04
CU633872_111(CU633872|pid:none) Podospora anserina genomic DNA c... 48 4e-04
AJ301807_1(AJ301807|pid:none) Streptococcus pyogenes sclB gene f... 47 6e-04
CP000260_893(CP000260|pid:none) Streptococcus pyogenes MGAS10270... 47 6e-04
BX571965_1647(BX571965|pid:none) Burkholderia pseudomallei strai... 47 6e-04
AY129332_4(AY129332|pid:none) Mycobacteriophage Bxz2, complete g... 47 6e-04
CU928178_106(CU928178|pid:none) Zygosaccharomyces rouxii strain ... 47 8e-04
DQ399325_1(DQ399325|pid:none) Deinopis spinosa clone DM103 Flag ... 47 8e-04
CP001408_2128(CP001408|pid:none) Burkholderia pseudomallei MSHR3... 47 8e-04
CP000570_2007(CP000570|pid:none) Burkholderia pseudomallei 668 c... 47 0.001
(P29229) RecName: Full=Variant surface antigen B; AltName: Full=... 47 0.001
AB252418_1(AB252418|pid:none) Flammulina velutipes psh mRNA for ... 47 0.001
CP000485_3156(CP000485|pid:none) Bacillus thuringiensis str. Al ... 46 0.002
CP000010_873(CP000010|pid:none) Burkholderia mallei ATCC 23344 c... 46 0.002
CP001129_1404(CP001129|pid:none) Streptococcus equi subsp. zooep... 46 0.002
AY995122_1(AY995122|pid:none) Bacillus anthracis strain 40048 Bc... 45 0.002
CP000560_711(CP000560|pid:none) Bacillus amyloliquefaciens FZB42... 45 0.002
CP000721_2554(CP000721|pid:none) Clostridium beijerinckii NCIMB ... 45 0.002
AY995120_1(AY995120|pid:none) Bacillus anthracis strain A16R Bcl... 45 0.002
(Q54GV8) RecName: Full=Uncharacterized transmembrane protein DDB... 45 0.002
AJ514404_1(AJ514404|pid:none) Mycoplasma conjunctivae lppS gene ... 45 0.002
EU678325_1(EU678325|pid:none) Haemophilus parasuis strain HP-130... 45 0.003
AF218621_1(AF218621|pid:none) Nephila clavipes flagelliform silk... 45 0.003
EU678337_1(EU678337|pid:none) Haemophilus parasuis strain HP-216... 45 0.003
EU678343_1(EU678343|pid:none) Haemophilus parasuis strain Nagasa... 45 0.003
CP000001_361(CP000001|pid:none) Bacillus cereus E33L, complete g... 45 0.003
AP007151_1150(AP007151|pid:none) Aspergillus oryzae RIB40 genomi... 45 0.003
AM182501_1(AM182501|pid:none) Bacillus anthracis partial gene fo... 45 0.003
EU678346_1(EU678346|pid:none) Haemophilus parasuis strain Nagasa... 45 0.004
EU678326_1(EU678326|pid:none) Haemophilus parasuis strain HP-120... 45 0.004
CP000903_1097(CP000903|pid:none) Bacillus weihenstephanensis KBA... 44 0.005
AM420293_6656(AM420293|pid:none) Saccharopolyspora erythraea NRR... 44 0.005
EU678340_1(EU678340|pid:none) Haemophilus parasuis strain HP-131... 44 0.005
AK094681_1(AK094681|pid:none) Homo sapiens cDNA FLJ37362 fis, cl... 44 0.005
(P02466) RecName: Full=Collagen alpha-2(I) chain; AltName: Full=... 44 0.005
CP000227_1548(CP000227|pid:none) Bacillus cereus Q1, complete ge... 44 0.005
AB385009_1(AB385009|pid:none) Synthetic construct DNA, clone: pF... 44 0.005
AK293333_1(AK293333|pid:none) Homo sapiens cDNA FLJ54587 complet... 44 0.005
(Q8N2M8) RecName: Full=Splicing factor, arginine/serine-rich 16;... 44 0.005
(Q54PA8) RecName: Full=Uncharacterized protein DDB_G0284671; Fla... 44 0.005
AF042800_1(AF042800|pid:none) Homo sapiens suppressor of white a... 44 0.005
DQ267495_4(DQ267495|pid:none) Uncultured delta proteobacterium D... 44 0.005
FJ594764_1(FJ594764|pid:none) Equus asinus collagen alpha-2 type... 44 0.005
CP001129_153(CP001129|pid:none) Streptococcus equi subsp. zooepi... 44 0.005
AY358944_1(AY358944|pid:none) Homo sapiens clone DNA38269 SWAP2 ... 44 0.005
AE014185_371(AE014185|pid:none) Plasmodium falciparum 3D7 chromo... 44 0.005
FM204884_1233(FM204884|pid:none) Streptococcus equi subsp. zooep... 44 0.006
AM262974_5(AM262974|pid:none) Ruminococcus flavefaciens ORF2, sc... 44 0.006
AM502253_266(AM502253|pid:none) Leishmania infantum chromosome 35. 44 0.006
(P02465) RecName: Full=Collagen alpha-2(I) chain; AltName: Full=... 44 0.006
AM746676_4608(AM746676|pid:none) Sorangium cellulosum 'So ce 56'... 44 0.008
FM992693_16(FM992693|pid:none) Candida dubliniensis CD36 chromos... 44 0.008
CP000498_318(CP000498|pid:none) Pichia stipitis CBS 6054 chromos... 44 0.008
AB207822_1(AB207822|pid:none) Crassostrea nippona cnf-75 mRNA fo... 43 0.011
EU678344_1(EU678344|pid:none) Haemophilus parasuis strain Nagasa... 43 0.011
(Q54KD5) RecName: Full=P17/29C-like protein DDB_G0287399; Flags:... 43 0.011
AF172608_1(AF172608|pid:none) Plasmodium vinckei brucechwatti fr... 43 0.011
AF448525_1(AF448525|pid:none) Mytilus galloprovincialis precolla... 43 0.011
AE014296_2111(AE014296|pid:none) Drosophila melanogaster chromos... 43 0.011
CP000853_99(CP000853|pid:none) Alkaliphilus oremlandii OhILAs, c... 43 0.014
AY172172_1(AY172172|pid:none) Mus musculus sublingual apomucin (... 43 0.014
AF077819_1(AF077819|pid:none) Cyprinus carpio hyosophorin mRNA, ... 43 0.014
EU678332_1(EU678332|pid:none) Haemophilus parasuis strain HP-226... 43 0.014
(Q6PZE0) RecName: Full=Mucin-19; Short=MUC-19; AltName:... 43 0.014
CU633865_101(CU633865|pid:none) Podospora anserina genomic DNA c... 43 0.014
AP006840_1121(AP006840|pid:none) Symbiobacterium thermophilum IA... 43 0.014
L36204_1(L36204|pid:none) Dictyostelium discoideum cysteine prot... 43 0.014
AF311437_14(AF311437|pid:none) Comamonas testosteroni plasmid pT... 43 0.014
CU928176_295(CU928176|pid:none) Zygosaccharomyces rouxii strain ... 42 0.019
CP000151_2673(CP000151|pid:none) Burkholderia sp. 383 chromosome... 42 0.019
T45025(T45025) mucin MUC5B, tracheobronchial [imported] - human ... 42 0.019
CP000001_3434(CP000001|pid:none) Bacillus cereus E33L, complete ... 42 0.019
CR382122_602(CR382122|pid:none) Kluyveromyces lactis strain NRRL... 42 0.019
AE010301_216(AE010301|pid:none) Leptospira interrogans serovar L... 42 0.019
AB196514_1(AB196514|pid:none) Paralichthys olivaceus COL1A2 mRNA... 42 0.019
(Q8VHD8) RecName: Full=Hornerin; &AY027660_1(AY027660|pid:none) 42 0.019
AK072232_1(AK072232|pid:none) Oryza sativa Japonica Group cDNA c... 42 0.019
CP000699_3469(CP000699|pid:none) Sphingomonas wittichii RW1, com... 42 0.019
CP000053_1290(CP000053|pid:none) Rickettsia felis URRWXCal2, com... 42 0.019
(Q7M4S5) RecName: Full=Mucin-5B; Short=MUC-5B; AltName:... 42 0.019
CP001129_705(CP001129|pid:none) Streptococcus equi subsp. zooepi... 42 0.019
AP009152_413(AP009152|pid:none) Kocuria rhizophila DC2201 DNA, c... 42 0.019
AE016877_2418(AE016877|pid:none) Bacillus cereus ATCC 14579, com... 42 0.024
AF218623_1(AF218623|pid:none) Nephila madagascariensis flagellif... 42 0.024
BX571965_902(BX571965|pid:none) Burkholderia pseudomallei strain... 42 0.024
CU928145_1050(CU928145|pid:none) Escherichia coli 55989 chromoso... 42 0.024
BA000030_5110(BA000030|pid:none) Streptomyces avermitilis MA-468... 42 0.024
AJ421469_1(AJ421469|pid:none) Sugarcane mosaic virus genomic RNA... 42 0.024
CP001407_3629(CP001407|pid:none) Bacillus cereus 03BB102, comple... 42 0.024
AE014298_726(AE014298|pid:none) Drosophila melanogaster chromoso... 42 0.032
AJ438190_1(AJ438190|pid:none) Sugarcane mosaic virus partial gen... 42 0.032
S16356(S16356)ovo protein - fruit fly (Drosophila melanogaster) 42 0.032
(Q86YZ3) RecName: Full=Hornerin; &AL589986_4(AL589986|pid:none) 42 0.032
AF252750_1(AF252750|pid:none) Drosophila simulans strain sim8 ov... 42 0.032
AJ430588_1(AJ430588|pid:none) Drosophila melanogaster mRNA for s... 42 0.032
AF252743_1(AF252743|pid:none) Drosophila simulans strain sim1 ov... 42 0.032
CP001215_2063(CP001215|pid:none) Bacillus anthracis str. CDC 684... 42 0.032
AM270325_4(AM270325|pid:none) Aspergillus niger contig An14c0180... 42 0.032
AE016824_168(AE016824|pid:none) Leptospira interrogans serovar C... 42 0.032
AF015539_1(AF015539|pid:none) Mytilus edulis precollagen P (preC... 42 0.032
BC151628_1(BC151628|pid:none) Bos taurus mucin-like protocadheri... 42 0.032
AY396741_1(AY396741|pid:none) Homo sapiens hornerin precursor mR... 42 0.032
AJ430589_1(AJ430589|pid:none) Drosophila melanogaster partial mR... 42 0.032
AM920433_391(AM920433|pid:none) Penicillium chrysogenum Wisconsi... 42 0.032
AE014296_3778(AE014296|pid:none) Drosophila melanogaster chromos... 42 0.032
(Q05164) RecName: Full=Haze protective factor 1; Flags: Precurso... 41 0.042
BC139848_1(BC139848|pid:none) Danio rerio host cell factor C1a, ... 41 0.042
CU928162_1112(CU928162|pid:none) Escherichia coli ED1a chromosom... 41 0.042
AB207821_1(AB207821|pid:none) Crassostrea nippona cnf-75 mRNA fo... 41 0.042
CR382132_40(CR382132|pid:none) Yarrowia lipolytica strain CLIB12... 41 0.042
BC056281_1(BC056281|pid:none) Danio rerio Ewing sarcoma breakpoi... 41 0.042
AC191960_67(AC191960|pid:none) Glyptapanteles indiensis clone 18... 41 0.042
AE017355_1313(AE017355|pid:none) Bacillus thuringiensis serovar ... 41 0.042
CP000485_3841(CP000485|pid:none) Bacillus thuringiensis str. Al ... 41 0.042
AB254382_1(AB254382|pid:none) Crassostrea nippona F46 mRNA for h... 41 0.042
EU678323_4(EU678323|pid:none) Haemophilus parasuis strain Nagasa... 41 0.042
CP000820_1944(CP000820|pid:none) Frankia sp. EAN1pec, complete g... 41 0.054
CP000503_833(CP000503|pid:none) Shewanella sp. W3-18-1, complete... 41 0.054
AK164628_1(AK164628|pid:none) Mus musculus 13 days embryo lung c... 41 0.054
CR382123_839(CR382123|pid:none) Kluyveromyces lactis strain NRRL... 41 0.054
(Q9JIK1) RecName: Full=Mucin and cadherin-like protein; AltName:... 41 0.054
CP000667_483(CP000667|pid:none) Salinispora tropica CNB-440, com... 41 0.054
S07638(S07638;A60942;B60942) spore coat protein SP96 precursor -... 41 0.054
(P14328) RecName: Full=Spore coat protein SP96; &AC117075_49(AC... 41 0.054
CP000500_679(CP000500|pid:none) Pichia stipitis CBS 6054 chromos... 41 0.054
EU127454_1(EU127454|pid:none) Homo sapiens mucin 5AC, oligomeric... 41 0.054
AB275455_1(AB275455|pid:none) Carassius auratus COL1A2 mRNA for ... 41 0.054
CP000854_795(CP000854|pid:none) Mycobacterium marinum M, complet... 41 0.054
CR382128_372(CR382128|pid:none) Yarrowia lipolytica strain CLIB1... 41 0.054
AP002057_8(AP002057|pid:none) Arabidopsis thaliana genomic DNA, ... 41 0.054
AJ439353_8(AJ439353|pid:none) Anopheles gambiae BAC clone 30E5. 40 0.071
A43291(A43291;A54328) collagen alpha 2(I) chain precursor - mous... 40 0.071
EZ000392_1(EZ000392|pid:none) TSA: Culex tarsalis Ctar-212 aggre... 40 0.071
AY350713_8(AY350713|pid:none) Capsella rubella clone BAC Cr33L6,... 40 0.071
CP000010_1958(CP000010|pid:none) Burkholderia mallei ATCC 23344 ... 40 0.071
BX005106_1(BX005106|pid:none) Zebrafish DNA sequence from clone ... 40 0.071
(O46392) RecName: Full=Collagen alpha-2(I) chain; AltName: Full=... 40 0.071
AP009493_1935(AP009493|pid:none) Streptomyces griseus subsp. gri... 40 0.071
CP001129_181(CP001129|pid:none) Streptococcus equi subsp. zooepi... 40 0.071
AE013599_2583(AE013599|pid:none) Drosophila melanogaster chromos... 40 0.071
CP001068_310(CP001068|pid:none) Ralstonia pickettii 12J chromoso... 40 0.071
AY138808_1(AY138808|pid:none) Bacillus thuringiensis strain 4Q2 ... 40 0.071
CR940348_478(CR940348|pid:none) Theileria annulata strain Ankara... 40 0.071
BC090712_1(BC090712|pid:none) Danio rerio Phf3 protein, mRNA (cD... 40 0.071
CP000377_1287(CP000377|pid:none) Silicibacter sp. TM1040, comple... 40 0.093
EU136045_1(EU136045|pid:none) Helicoverpa armigera insect intest... 40 0.093
AF204951_57(AF204951|pid:none) Ectocarpus siliculosus virus, com... 40 0.093
AE017333_744(AE017333|pid:none) Bacillus licheniformis DSM 13, c... 40 0.093
AF193876_1(AF193876|pid:none) Mycoplasma hyorhinis strain SK76 5... 40 0.093
AM411124_1(AM411124|pid:none) Aphrocallistes vastus mRNA for col... 40 0.093
T34434(T34434) hypothetical protein K06A9.1a - Caenorhabditis el... 40 0.093
AP008207_2388(AP008207|pid:none) Oryza sativa (japonica cultivar... 40 0.093
AM236080_1849(AM236080|pid:none) Rhizobium leguminosarum bv. vic... 40 0.093
AB110101_1(AB110101|pid:none) Saccharomyces cerevisiae K701-AWA1... 40 0.12
FJ768957_12(FJ768957|pid:none) Streptomyces achromogenes tomaymy... 40 0.12
CP000387_1885(CP000387|pid:none) Streptococcus sanguinis SK36, c... 40 0.12
CP000359_652(CP000359|pid:none) Deinococcus geothermalis DSM 113... 40 0.12
S18651(S18651)variant surface antigen vlpA precursor - Mycoplasm... 40 0.12
AE016877_4520(AE016877|pid:none) Bacillus cereus ATCC 14579, com... 40 0.12
AP009384_4163(AP009384|pid:none) Azorhizobium caulinodans ORS 57... 40 0.12
CR382128_725(CR382128|pid:none) Yarrowia lipolytica strain CLIB1... 40 0.12
AM238667_1(AM238667|pid:none) Bordetella pertussis tcfA gene for... 40 0.12
AF193875_1(AF193875|pid:none) Mycoplasma hyorhinis strain SK76 4... 40 0.12
EU678348_1(EU678348|pid:none) Haemophilus parasuis strain Nagasa... 40 0.12
AL591688_1912(AL591688|pid:none) Sinorhizobium meliloti 1021 com... 40 0.12
CU633899_630(CU633899|pid:none) Podospora anserina genomic DNA c... 40 0.12
AF193878_1(AF193878|pid:none) Mycoplasma hyorhinis strain SK76 8... 40 0.12
BT054328_1(BT054328|pid:none) Zea mays full-length cDNA clone ZM... 40 0.12
A85719(A85719) probable tail fiber protein of prophage CP-933O Z... 40 0.12
EU016583_11(EU016583|pid:none) Uncultured marine microorganism H... 40 0.12
BC116538_1(BC116538|pid:none) Danio rerio hypothetical protein L... 40 0.12
CP000854_1390(CP000854|pid:none) Mycobacterium marinum M, comple... 40 0.12
EU401926_1(EU401926|pid:none) Plasmodium vivax strain India VII ... 40 0.12
AC116305_50(AC116305|pid:none) Dictyostelium discoideum chromoso... 40 0.12
(P29228) RecName: Full=Variant surface antigen A; AltName: Full=... 40 0.12
AF193874_1(AF193874|pid:none) Mycoplasma hyorhinis strain SK76 3... 40 0.12
AM746676_6945(AM746676|pid:none) Sorangium cellulosum 'So ce 56'... 39 0.16
AY970509_2(AY970509|pid:none) Rickettsia bellii cell surface ant... 39 0.16
AJ601384_1(AJ601384|pid:none) Paracentrotus lividus mRNA for alp... 39 0.16
CP000001_3433(CP000001|pid:none) Bacillus cereus E33L, complete ... 39 0.16
AE000513_758(AE000513|pid:none) Deinococcus radiodurans R1 chrom... 39 0.16
CP000056_1711(CP000056|pid:none) Streptococcus pyogenes MGAS6180... 39 0.16
BA000007_1123(BA000007|pid:none) Escherichia coli O157:H7 str. S... 39 0.16
CT573213_3891(CT573213|pid:none) Frankia alni str. ACN14A chromo... 39 0.16
EF469736_1(EF469736|pid:none) Synthetic construct proline rich p... 39 0.16
CP000302_3660(CP000302|pid:none) Shewanella denitrificans OS217,... 39 0.16
S22373(S22373) proline-rich protein - mouse &X63004_1(X63004|pi... 39 0.16
AY941623_1(AY941623|pid:none) Lycopersicon chilense CT099 (CT099... 39 0.16
CP000479_4649(CP000479|pid:none) Mycobacterium avium 104, comple... 39 0.16
AF138797_1(AF138797|pid:none) Streptococcus pyogenes serum opaci... 39 0.16
EU091075_1(EU091075|pid:none) Sugarcane mosaic virus isolate Mx-... 39 0.16
CP000850_1372(CP000850|pid:none) Salinispora arenicola CNS-205, ... 39 0.16
AP008932_38(AP008932|pid:none) Rhodococcus erythropolis PR4 plas... 39 0.16
CP001164_1941(CP001164|pid:none) Escherichia coli O157:H7 str. E... 39 0.16
CP001164_1088(CP001164|pid:none) Escherichia coli O157:H7 str. E... 39 0.16
AF193877_1(AF193877|pid:none) Mycoplasma hyorhinis strain SK76 5... 39 0.16
AB008372_1(AB008372|pid:none) Oncorhynchus mykiss mRNA for alpha... 39 0.21
AE005174_2759(AE005174|pid:none) Escherichia coli O157:H7 EDL933... 39 0.21
(Q6IMF3) RecName: Full=Keratin, type II cytoskeletal 1; AltName:... 39 0.21
AB285204_20(AB285204|pid:none) Phage cdtI DNA, complete genome. 39 0.21
FM180568_1262(FM180568|pid:none) Escherichia coli 0127:H6 E2348/... 39 0.21
BX294153_199(BX294153|pid:none) Rhodopirellula baltica SH 1 comp... 39 0.21
AB104446_1(AB104446|pid:none) Homo sapiens mRNA for hornerin, pa... 39 0.21
AE014134_274(AE014134|pid:none) Drosophila melanogaster chromoso... 39 0.21
CP000829_1577(CP000829|pid:none) Streptococcus pyogenes NZ131, c... 39 0.21
AF193879_1(AF193879|pid:none) Mycoplasma hyorhinis strain GDL vl... 39 0.21
FM180568_1038(FM180568|pid:none) Escherichia coli 0127:H6 E2348/... 39 0.21
(O93484) RecName: Full=Collagen alpha-2(I) chain; AltName: Full=... 39 0.21
AB426057_11(AB426057|pid:none) Escherichia coli O111:H- DNA, gen... 39 0.21
AB426049_2(AB426049|pid:none) Escherichia coli O111:H- DNA, geno... 39 0.21
FM180578_71(FM180578|pid:none) Enterobacteria phage 2851, comple... 39 0.21
AB426056_11(AB426056|pid:none) Escherichia coli O111:H- DNA, gen... 39 0.21
DQ450118_1(DQ450118|pid:none) Streptococcus pyogenes serum opaci... 39 0.21
CP001164_2804(CP001164|pid:none) Escherichia coli O157:H7 str. E... 39 0.21
BC126701_1(BC126701|pid:none) Bos taurus splicing factor, argini... 39 0.21
CP000001_1086(CP000001|pid:none) Bacillus cereus E33L, complete ... 39 0.21
CR382127_488(CR382127|pid:none) Yarrowia lipolytica strain CLIB1... 39 0.21
S21359(S21359) keratin, type I, cytoskeletal - rat (fragment) &... 39 0.21
CR940347_1(CR940347|pid:none) Theileria annulata strain Ankara i... 39 0.21
(P07856) RecName: Full=Sericin 1; AltName: Full=Silk gum protein... 39 0.21
AL939129_209(AL939129|pid:none) Streptomyces coelicolor A3(2) co... 39 0.21
AP000400_13(AP000400|pid:none) Enterobacteria phage VT1-Sakai ge... 39 0.21
BA000045_4200(BA000045|pid:none) Gloeobacter violaceus PCC 7421 ... 39 0.21
AB426062_2(AB426062|pid:none) Escherichia coli O111:H- DNA, geno... 39 0.21
BA000040_8057(BA000040|pid:none) Bradyrhizobium japonicum USDA 1... 39 0.21
CP001164_2484(CP001164|pid:none) Escherichia coli O157:H7 str. E... 39 0.21
AB112019_1(AB112019|pid:none) Bombyx mori ser1 mRNA for sericin ... 39 0.21
GN101447_1(GN101447|pid:none) Sequence 6228 from Patent WO200903... 39 0.21
BC118691_1(BC118691|pid:none) Xenopus tropicalis ribonucleic aci... 39 0.27
(Q9V7U0) RecName: Full=Pro-resilin; Flags: Precursor; &AE013599... 39 0.27
M63595_1(M63595|pid:none) Xenopus laevis alpha-1 collagen type I... 39 0.27
CU928179_462(CU928179|pid:none) Zygosaccharomyces rouxii strain ... 39 0.27
AL939120_77(AL939120|pid:none) Streptomyces coelicolor A3(2) com... 39 0.27
CP000378_1905(CP000378|pid:none) Burkholderia cenocepacia AU 105... 39 0.27
FM992691_554(FM992691|pid:none) Candida dubliniensis CD36 chromo... 39 0.27
AM408590_3419(AM408590|pid:none) Mycobacterium bovis BCG Pasteur... 39 0.27
B40333(B40333)collagen alpha 1(II) chain precursor - African cla... 39 0.27
S83520_1(S83520|pid:none) ovo alpha =TFIIIA-like zinc finger tra... 39 0.27
AE013599_2479(AE013599|pid:none) Drosophila melanogaster chromos... 39 0.27
FJ188381_72(FJ188381|pid:none) Stx2-converting phage 1717, compl... 39 0.27
CP001176_4669(CP001176|pid:none) Bacillus cereus B4264, complete... 39 0.27
T25404(T25404)hypothetical protein T28C6.1 - Caenorhabditis eleg... 39 0.27
CP000458_2526(CP000458|pid:none) Burkholderia cenocepacia HI2424... 39 0.27
CP000947_77(CP000947|pid:none) Haemophilus somnus 2336, complete... 39 0.27
(Q91717) RecName: Full=Collagen alpha-1(II) chain; AltName: Full... 39 0.27
AE005174_838(AE005174|pid:none) Escherichia coli O157:H7 EDL933,... 39 0.27
AM420293_1312(AM420293|pid:none) Saccharopolyspora erythraea NRR... 39 0.27
AE016817_600(AE016817|pid:none) Ashbya gossypii (= Eremothecium ... 39 0.27
Z54238_1(Z54238|pid:none) Caenorhabditis elegans Cosmid T28C6, c... 39 0.27
CR382132_60(CR382132|pid:none) Yarrowia lipolytica strain CLIB12... 39 0.27
CP001358_1817(CP001358|pid:none) Desulfovibrio desulfuricans sub... 39 0.27
BX842582_255(BX842582|pid:none) Mycobacterium tuberculosis H37Rv... 39 0.27
AE014297_2661(AE014297|pid:none) Drosophila melanogaster chromos... 39 0.27
BA000034_939(BA000034|pid:none) Streptococcus pyogenes SSI-1 DNA... 39 0.27
AF027973_1(AF027973|pid:none) Nephila clavipes flagelliform silk... 38 0.35
AK096772_1(AK096772|pid:none) Homo sapiens cDNA FLJ39453 fis, cl... 38 0.35
CT573213_5048(CT573213|pid:none) Frankia alni str. ACN14A chromo... 38 0.35
CR382131_248(CR382131|pid:none) Yarrowia lipolytica strain CLIB1... 38 0.35
AF023459_1(AF023459|pid:none) Haliotis rufescens lustrin A mRNA,... 38 0.35
CP000717_3634(CP000717|pid:none) Mycobacterium tuberculosis F11,... 38 0.35
J03464_1(J03464|pid:none) Homo sapiens pre-pro-alpha-2 type I co... 38 0.35
CP001283_3631(CP001283|pid:none) Bacillus cereus AH820, complete... 38 0.35
FM204884_165(FM204884|pid:none) Streptococcus equi subsp. zooepi... 38 0.35
AF172333_1(AF172333|pid:none) Human herpesvirus 4 cell-line SNU-... 38 0.35
CP000721_2569(CP000721|pid:none) Clostridium beijerinckii NCIMB ... 38 0.35
CR382127_364(CR382127|pid:none) Yarrowia lipolytica strain CLIB1... 38 0.35
CP000148_1830(CP000148|pid:none) Geobacter metallireducens GS-15... 38 0.35
CP001164_1631(CP001164|pid:none) Escherichia coli O157:H7 str. E... 38 0.35
AM490177_1(AM490177|pid:none) Euprosthenops australis partial mR... 38 0.35
AE000516_3568(AE000516|pid:none) Mycobacterium tuberculosis CDC1... 38 0.35
CP000350_1308(CP000350|pid:none) Leptospira borgpetersenii serov... 38 0.35
AF004877_1(AF004877|pid:none) Homo sapiens pro-alpha 2(I) collag... 38 0.35
AE017225_372(AE017225|pid:none) Bacillus anthracis str. Sterne, ... 38 0.35
CGHU2S(A28500;S00824;S09176;I55311;A58111;A28472;A42165;)collage... 38 0.35
AJ639924_14(AJ639924|pid:none) Plasmid pB3 complete genome. 38 0.35
BA000030_2269(BA000030|pid:none) Streptomyces avermitilis MA-468... 38 0.46
DQ450104_1(DQ450104|pid:none) Streptococcus pyogenes serum opaci... 38 0.46
AC099734_11(AC099734|pid:none) Oryza sativa (japonica cultivar-g... 38 0.46
CP000510_1861(CP000510|pid:none) Psychromonas ingrahamii 37, com... 38 0.46
CP000820_5865(CP000820|pid:none) Frankia sp. EAN1pec, complete g... 38 0.46
AE014297_2537(AE014297|pid:none) Drosophila melanogaster chromos... 38 0.46
AM490176_1(AM490176|pid:none) Euprosthenops australis partial mR... 38 0.46
U80846_5(U80846|pid:none) Caenorhabditis elegans cosmid K06A9, c... 38 0.46
(P54424) RecName: Full=Endoglucanase 1; EC=3.2.1.4; Alt... 38 0.46
T23754(T23754;T24513)hypothetical protein T05C12.10 - Caenorhabd... 38 0.46
AF082074_1(AF082074|pid:none) Streptococcus pyogenes serum opaci... 38 0.46
AM490174_1(AM490174|pid:none) Euprosthenops australis partial mR... 38 0.46
(Q95RJ9) RecName: Full=F-box-like/WD repeat-containing protein e... 38 0.46
FM992694_292(FM992694|pid:none) Candida dubliniensis CD36 chromo... 38 0.46
CP000414_954(CP000414|pid:none) Leuconostoc mesenteroides subsp.... 38 0.46
DQ238488_1(DQ238488|pid:none) Metarhizium anisopliae collagen-li... 38 0.46
AY061326_1(AY061326|pid:none) Drosophila melanogaster LD24373 fu... 38 0.46
Z49968_1(Z49968|pid:none) Caenorhabditis elegans Cosmid M110, co... 38 0.46
(Q2J728) RecName: Full=Translation initiation factor IF-2; &CP0... 38 0.46
AM490178_1(AM490178|pid:none) Euprosthenops australis partial mR... 38 0.46
T34433(T34433) hypothetical protein K06A9.1a - Caenorhabditis el... 38 0.46
AB252688_1(AB252688|pid:none) Candida albicans TCC1 gene for tra... 38 0.46
S24610(B43417;S24610) major membrane cytoskeletal protein articu... 38 0.46
DQ647926_1(DQ647926|pid:none) Myxine glutinosa type II collagen ... 37 0.60
AK243356_1(AK243356|pid:none) Oryza sativa Japonica Group cDNA, ... 37 0.60
U78550_1(U78550|pid:none) Homo sapiens gallbladder mucin MUC5B m... 37 0.60
(Q5EA53) RecName: Full=General transcription factor IIF subunit ... 37 0.60
EU678333_1(EU678333|pid:none) Haemophilus parasuis strain HP-131... 37 0.60
AE017355_3417(AE017355|pid:none) Bacillus thuringiensis serovar ... 37 0.60
CP001083_246(CP001083|pid:none) Clostridium botulinum Ba4 str. 6... 37 0.60
AB303061_2(AB303061|pid:none) Escherichia coli O111:H- genes for... 37 0.60
AF233061_1(AF233061|pid:none) Yarrowia lipolytica protein kinase... 37 0.60
CP000227_3059(CP000227|pid:none) Bacillus cereus Q1, complete ge... 37 0.60
AJ310103_1(AJ310103|pid:none) Sugarcane mosaic virus genomic RNA... 37 0.60
BT068032_1(BT068032|pid:none) Zea mays full-length cDNA clone ZM... 37 0.60
BX927144_3(BX927144|pid:none) Zebrafish DNA sequence from clone ... 37 0.60
(P46804) RecName: Full=Spidroin-2; AltName: Full=Dragline silk f... 37 0.60
CP000958_2534(CP000958|pid:none) Burkholderia cenocepacia MC0-3 ... 37 0.60
CP001132_547(CP001132|pid:none) Acidithiobacillus ferrooxidans A... 37 0.60
AE016879_3520(AE016879|pid:none) Bacillus anthracis str. Ames, c... 37 0.60
CU928162_2037(CU928162|pid:none) Escherichia coli ED1a chromosom... 37 0.60
(B1VGC2) RecName: Full=Translation initiation factor IF-2; &AM9... 37 0.60
AY195610_1(AY195610|pid:none) Sugarcane mosaic virus isolate Mx ... 37 0.60
AF272027_1(AF272027|pid:none) Candida albicans agglutinin-like p... 37 0.60
AE017225_3520(AE017225|pid:none) Bacillus anthracis str. Sterne,... 37 0.60
(Q9BXM0) RecName: Full=Periaxin; &AF321191_1(AF321191|pid:none)... 37 0.60
AX399898_1(AX399898|pid:none) Sequence 69 from Patent WO0218424. 37 0.60
CP000124_1912(CP000124|pid:none) Burkholderia pseudomallei 1710b... 37 0.78
CP000474_3148(CP000474|pid:none) Arthrobacter aurescens TC1, com... 37 0.78
(A2VE23) RecName: Full=Dermokine; Flags: Precursor; &BC133532_1... 37 0.78
AF350267_1(AF350267|pid:none) Argiope trifasciata major ampullat... 37 0.78
AY941619_1(AY941619|pid:none) Lycopersicon peruvianum CT099 (CT0... 37 0.78
AE014298_1860(AE014298|pid:none) Drosophila melanogaster chromos... 37 0.78
AY119139_1(AY119139|pid:none) Drosophila melanogaster RE41430 fu... 37 0.78
AB275456_1(AB275456|pid:none) Carassius auratus COL1A3 mRNA for ... 37 0.78
S58135(S58135)hyphally regulated protein - yeast (Candida albica... 37 0.78
CP000227_4438(CP000227|pid:none) Bacillus cereus Q1, complete ge... 37 0.78
CP001177_413(CP001177|pid:none) Bacillus cereus AH187, complete ... 37 0.78
BA000030_4626(BA000030|pid:none) Streptomyces avermitilis MA-468... 37 0.78
CP001186_373(CP001186|pid:none) Bacillus cereus G9842, complete ... 37 0.78
AY941634_1(AY941634|pid:none) Solanum habrochaites CT099 (CT099)... 37 0.78
CP000325_3521(CP000325|pid:none) Mycobacterium ulcerans Agy99, c... 37 0.78
AP009493_5729(AP009493|pid:none) Streptomyces griseus subsp. gri... 37 0.78
BX571965_1918(BX571965|pid:none) Burkholderia pseudomallei strai... 37 0.78
AP008981_1215(AP008981|pid:none) Orientia tsutsugamushi str. Ike... 37 0.78
AF220145_1(AF220145|pid:none) Drosophila melanogaster Scribbler ... 37 0.78
(P46591) RecName: Full=Hyphally-regulated protein; Flags: Precur... 37 0.78
BX294150_92(BX294150|pid:none) Rhodopirellula baltica SH 1 compl... 37 0.78
AF406976_1(AF406976|pid:none) Mycoplasma bovis variable surface ... 37 0.78
(Q5D862) RecName: Full=Filaggrin-2; Short=FLG-2; AltNam... 37 0.78
AY596297_2621(AY596297|pid:none) Haloarcula marismortui ATCC 430... 37 0.78
AF242194_1(AF242194|pid:none) Drosophila melanogaster brakeless-... 37 0.78
AE014298_2663(AE014298|pid:none) Drosophila melanogaster chromos... 37 0.78
AY355363_1(AY355363|pid:none) Rickettsia helvetica strain C9P9 s... 37 0.78
CP000302_1910(CP000302|pid:none) Shewanella denitrificans OS217,... 37 0.78
CP000485_2062(CP000485|pid:none) Bacillus thuringiensis str. Al ... 37 0.78
AF139743_1(AF139743|pid:none) Streptococcus pyogenes serum opaci... 37 0.78
L19046_1(L19046|pid:none) Plasmodium falciparum merozoite surfac... 37 0.78
BC171935_1(BC171935|pid:none) Mus musculus predicted gene, EG667... 37 0.78
CP001114_364(CP001114|pid:none) Deinococcus deserti VCD115, comp... 37 0.78
(P53189) RecName: Full=Probable family 17 glucosidase SCW11; ... 37 0.78
EU016568_14(EU016568|pid:none) Uncultured marine microorganism H... 37 0.78
AE013599_2816(AE013599|pid:none) Drosophila melanogaster chromos... 37 0.78
AL590463_97(AL590463|pid:none) Streptomyces coelicolor plasmid S... 37 0.78
CP000572_1766(CP000572|pid:none) Burkholderia pseudomallei 1106a... 37 0.78
AC116979_20(AC116979|pid:none) Dictyostelium discoideum chromoso... 37 0.78
AK110520_1(AK110520|pid:none) Oryza sativa Japonica Group cDNA c... 37 0.78
CP000227_1426(CP000227|pid:none) Bacillus cereus Q1, complete ge... 37 0.78
AE014298_1861(AE014298|pid:none) Drosophila melanogaster chromos... 37 0.78
(Q54EQ9) RecName: Full=Putative uncharacterized protein DDB_G029... 37 0.79
AE014134_2519(AE014134|pid:none) Drosophila melanogaster chromos... 37 0.79
AK294540_1(AK294540|pid:none) Homo sapiens cDNA FLJ58080 complet... 37 0.79
AF171929_1(AF171929|pid:none) Homo sapiens metallaproteinase-dis... 37 0.79
CR382132_571(CR382132|pid:none) Yarrowia lipolytica strain CLIB1... 37 0.79
CR855060_6(CR855060|pid:none) Oryza sativa genomic DNA, chromoso... 37 1.0
EF638444_1(EF638444|pid:none) Nephilengys cruentata flagelliform... 37 1.0
AC090488_18(AC090488|pid:none) Genomic sequence for Oryza sativa... 37 1.0
CR855106_3(CR855106|pid:none) Oryza sativa genomic DNA, chromoso... 37 1.0
BA000007_844(BA000007|pid:none) Escherichia coli O157:H7 str. Sa... 37 1.0
CP000675_3014(CP000675|pid:none) Legionella pneumophila str. Cor... 37 1.0
CP001601_2431(CP001601|pid:none) Corynebacterium aurimucosum ATC... 37 1.0
CT005268_146(CT005268|pid:none) Leishmania major strain Friedlin... 37 1.0
EU678328_1(EU678328|pid:none) Haemophilus parasuis strain HP-226... 37 1.0
AC093568_17(AC093568|pid:none) Oryza sativa chromosome 10 clone ... 37 1.0
CU928169_246(CU928169|pid:none) Kluyveromyces thermotolerans str... 37 1.0
AF273737_1(AF273737|pid:none) Heterodera glycines hypothetical e... 37 1.0
AE017349_321(AE017349|pid:none) Cryptococcus neoformans var. neo... 37 1.0
AF340008_1(AF340008|pid:none) Encephalitozoon cuniculi isolate C... 37 1.0
(P32583) RecName: Full=Suppressor protein SRP40; &S38170(S38170... 37 1.0
CP001129_588(CP001129|pid:none) Streptococcus equi subsp. zooepi... 37 1.0
AM920427_128(AM920427|pid:none) Penicillium chrysogenum Wisconsi... 37 1.0
AF094508_1(AF094508|pid:none) Homo sapiens dentin phosphoryn mRN... 37 1.0
DQ206903_1(DQ206903|pid:none) Phytophthora ramorum cell 12A endo... 37 1.0
EU886196_7(EU886196|pid:none) Beauveria bassiana strain ATCC 715... 37 1.0
AB170123_1(AB170123|pid:none) Macaca fascicularis brain cDNA clo... 37 1.0
AM114193_441(AM114193|pid:none) Uncultured methanogenic archaeon... 37 1.0
JC4871(JC4871) phospholipase C (EC 3.1.4.3) beta-2 - mouse &X97... 37 1.0
AY590692_1(AY590692|pid:none) Avian pneumovirus strain Mn-1a att... 37 1.0
AF238858_1(AF238858|pid:none) Drosophila melanogaster brakeless ... 37 1.0
CR382131_766(CR382131|pid:none) Yarrowia lipolytica strain CLIB1... 37 1.0
DQ450105_1(DQ450105|pid:none) Streptococcus pyogenes serum opaci... 37 1.0
FM992690_640(FM992690|pid:none) Candida dubliniensis CD36 chromo... 37 1.0
(Q54T37) RecName: Full=Uncharacterized transmembrane protein DDB... 37 1.0
EU401929_1(EU401929|pid:none) Plasmodium vivax strain Palo Alto ... 37 1.0
CP001186_3294(CP001186|pid:none) Bacillus cereus G9842, complete... 37 1.0
CP000472_2997(CP000472|pid:none) Shewanella piezotolerans WP3, c... 37 1.0
BC044518_1(BC044518|pid:none) Danio rerio Ewing sarcoma breakpoi... 36 1.3
BC161337_1(BC161337|pid:none) Xenopus tropicalis hypothetical pr... 36 1.3
AK092533_1(AK092533|pid:none) Homo sapiens cDNA FLJ35214 fis, cl... 36 1.3
CP001298_2889(CP001298|pid:none) Methylobacterium chloromethanic... 36 1.3
AE014298_1213(AE014298|pid:none) Drosophila melanogaster chromos... 36 1.3
CU928175_403(CU928175|pid:none) Zygosaccharomyces rouxii strain ... 36 1.3
CP000580_1366(CP000580|pid:none) Mycobacterium sp. JLS, complete... 36 1.3
CP000717_284(CP000717|pid:none) Mycobacterium tuberculosis F11, ... 36 1.3
FM992689_164(FM992689|pid:none) Candida dubliniensis CD36 chromo... 36 1.3
CP000667_2471(CP000667|pid:none) Salinispora tropica CNB-440, co... 36 1.3
AF503433_3(AF503433|pid:none) Sorghum bicolor BAC 170F8, complet... 36 1.3
BX640465_3(BX640465|pid:none) Zebrafish DNA sequence from clone ... 36 1.3
AL670009_5(AL670009|pid:none) Neurospora crassa DNA linkage grou... 36 1.3
BC058045_1(BC058045|pid:none) Danio rerio collagen, type I, alph... 36 1.3
EF587433_1(EF587433|pid:none) Floydiella terrestris strain UTEX ... 36 1.3
CP000081_235(CP000081|pid:none) Leishmania major chromosome 35, ... 36 1.3
CP001620_361(CP001620|pid:none) Corynebacterium kroppenstedtii D... 36 1.3
CR382130_212(CR382130|pid:none) Yarrowia lipolytica strain CLIB1... 36 1.3
AL731564_1(AL731564|pid:none) Zebrafish DNA sequence from clone ... 36 1.3
A40333(A40333)collagen alpha 1'(II) chain precursor - African cl... 36 1.3
EF158321_1(EF158321|pid:none) Homo sapiens dermokine gamma-1 mRN... 36 1.3
AJ310105_1(AJ310105|pid:none) Sugarcane mosaic virus genomic RNA... 36 1.3
AP009493_1676(AP009493|pid:none) Streptomyces griseus subsp. gri... 36 1.3
AM502242_56(AM502242|pid:none) Leishmania infantum chromosome 24. 36 1.3
BC160210_1(BC160210|pid:none) Synthetic construct Mus musculus c... 36 1.3
EU278672_1(EU278672|pid:none) Homo sapiens haplotype 33 dentin s... 36 1.3
AL939115_45(AL939115|pid:none) Streptomyces coelicolor A3(2) com... 36 1.3
FM992693_99(FM992693|pid:none) Candida dubliniensis CD36 chromos... 36 1.3
CP000029_702(CP000029|pid:none) Staphylococcus epidermidis RP62A... 36 1.3
BC097019_1(BC097019|pid:none) Danio rerio Ewing sarcoma breakpoi... 36 1.3
AM920437_53(AM920437|pid:none) Penicillium chrysogenum Wisconsin... 36 1.3
AP009152_1603(AP009152|pid:none) Kocuria rhizophila DC2201 DNA, ... 36 1.3
AM746676_2401(AM746676|pid:none) Sorangium cellulosum 'So ce 56'... 36 1.3
S64741(S64741;S72264)cuticle collagen - tube worm (Riftia pachyp... 36 1.3
I40333(S77633;I40333) tracheal colonization factor A precursor -... 36 1.3
(P53301) RecName: Full=Probable glycosidase CRH1; EC=3.... 36 1.3
BX842630_10(BX842630|pid:none) Neurospora crassa DNA linkage gro... 36 1.3
AE014134_882(AE014134|pid:none) Drosophila melanogaster chromoso... 36 1.3
AM920427_1645(AM920427|pid:none) Penicillium chrysogenum Wiscons... 36 1.3
AJ006201_1(AJ006201|pid:none) Sugarcane mosaic virus RNA, 3'-end... 36 1.3
AE016877_3175(AE016877|pid:none) Bacillus cereus ATCC 14579, com... 36 1.3
(Q6W4X9) RecName: Full=Mucin-6; Short=MUC-6; AltName: F... 36 1.3
AK074268_1(AK074268|pid:none) Homo sapiens cDNA FLJ23688 fis, cl... 36 1.3
AE017348_126(AE017348|pid:none) Cryptococcus neoformans var. neo... 36 1.3
CR749626_1(CR749626|pid:none) Homo sapiens mRNA; cDNA DKFZp686F1... 36 1.7
CP000227_428(CP000227|pid:none) Bacillus cereus Q1, complete gen... 36 1.7
CP001164_3164(CP001164|pid:none) Escherichia coli O157:H7 str. E... 36 1.7
EU311208_61(EU311208|pid:none) Enterobacteria phage Min27, compl... 36 1.7
CP000903_4444(CP000903|pid:none) Bacillus weihenstephanensis KBA... 36 1.7
AB295108_1(AB295108|pid:none) Pinctada fucata mpn88 mRNA for mol... 36 1.7
AE017194_510(AE017194|pid:none) Bacillus cereus ATCC 10987, comp... 36 1.7
CP000360_728(CP000360|pid:none) Acidobacteria bacterium Ellin345... 36 1.7
X64002_1(X64002|pid:none) H.sapiens mRNA for RAP74. 36 1.7
U08977_1(U08977|pid:none) Plasmodium vivax isolate CH-3 circumsp... 36 1.7
AK092765_1(AK092765|pid:none) Homo sapiens cDNA FLJ35446 fis, cl... 36 1.7
AY891902_1(AY891902|pid:none) Synthetic construct Homo sapiens c... 36 1.7
S20248(S20248;S25402;S20589;S25403) transcription factor TFIIF l... 36 1.7
AM490171_1(AM490171|pid:none) Euprosthenops australis partial mR... 36 1.7
CP001348_3176(CP001348|pid:none) Clostridium cellulolyticum H10,... 36 1.7
CU928169_48(CU928169|pid:none) Kluyveromyces thermotolerans stra... 36 1.7
AY941631_1(AY941631|pid:none) Solanum habrochaites CT099 (CT099)... 36 1.7
CP001197_1066(CP001197|pid:none) Desulfovibrio vulgaris str. 'Mi... 36 1.7
CP001052_3118(CP001052|pid:none) Burkholderia phytofirmans PsJN ... 36 1.7
CP000580_50(CP000580|pid:none) Mycobacterium sp. JLS, complete g... 36 1.7
AF452716_1(AF452716|pid:none) Homo sapiens clone KU002155 unknow... 36 1.7
CP001285_142(CP001285|pid:none) Bacillus cereus AH820 plasmid pA... 36 1.7
AB295110_1(AB295110|pid:none) Pinctada fucata mpn88-lack2 mRNA f... 36 1.7
CR858116_1(CR858116|pid:none) Pongo abelii mRNA; cDNA DKFZp469B0... 36 1.7
D79993_1(D79993|pid:none) Homo sapiens KIAA0171 mRNA, partial cds. 36 1.7
AK304078_1(AK304078|pid:none) Homo sapiens cDNA FLJ52075 complet... 36 1.7
CP000113_3735(CP000113|pid:none) Myxococcus xanthus DK 1622, com... 36 1.7
>L10411_1(L10411|pid:none) Entamoeba histolytica 20 kDa repeat
protein mRNA, complete cds.
Length = 206
Score = 96.7 bits (239), Expect = 8e-19
Identities = 54/146 (36%), Positives = 85/146 (58%), Gaps = 9/146 (6%)
Frame = +3
Query: 96 LAGPGSSTSNHKPTVDIGK---TAPAGTNNDGFRRQGASSGPQSSVSTYTPTTDSGKQAP 266
+ GPGSS+SN+K T D + P+ + + G+R+ G ++GP +S T+ TTD GK A
Sbjct: 1 MVGPGSSSSNYKSTTDPCRFMGCGPSSSTSSGYRKGGNAAGPMASKGTWAATTDIGKTAA 60
Query: 267 AGGN--NDGFRRQGASSGPQSSVSTYTPTTDSGKQAPAGGN--QDGFRRTGASSGPQSSV 434
G + G+R+ G ++GP +S T+ TTD G A G + + G+R+ G ++GP +S
Sbjct: 61 VGADTYEAGYRKGGNAAGPMASKGTWAATTDIGITAGVGADTYEAGYRKGGNAAGPMASK 120
Query: 435 STYTPTNDSGKQAPAGGN--QDGFRR 506
T+ T D GK A G + + G+RR
Sbjct: 121 GTWEATTDIGKTAAVGADTYEAGYRR 146
Score = 93.6 bits (231), Expect = 7e-18
Identities = 54/137 (39%), Positives = 76/137 (55%), Gaps = 6/137 (4%)
Frame = +3
Query: 99 AGPGSSTSNHKPTVDIGKTAPAG--TNNDGFRRQGASSGPQSSVSTYTPTTDSGKQAPAG 272
AGP +S T DIGKTA G T G+R+ G ++GP +S T+ TTD G A G
Sbjct: 40 AGPMASKGTWAATTDIGKTAAVGADTYEAGYRKGGNAAGPMASKGTWAATTDIGITAGVG 99
Query: 273 GNN--DGFRRQGASSGPQSSVSTYTPTTDSGKQAPAGGN--QDGFRRTGASSGPQSSVST 440
+ G+R+ G ++GP +S T+ TTD GK A G + + G+RR ++GP +S T
Sbjct: 100 ADTYEAGYRKGGNAAGPMASKGTWEATTDIGKTAAVGADTYEAGYRRGADAAGPMASKGT 159
Query: 441 YTPTNDSGKQAPAGGNQ 491
+ T DSG AP G +
Sbjct: 160 WAATTDSGITAPCSGTE 176
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3236559
Number of Hits to DB: 1,276,788,057
Number of extensions: 29773104
Number of successful extensions: 117926
Number of sequences better than 10.0: 951
Number of HSP's gapped: 110449
Number of HSP's successfully gapped: 1796
Length of query: 276
Length of database: 1,051,180,864
Length adjustment: 127
Effective length of query: 149
Effective length of database: 640,137,871
Effective search space: 95380542779
Effective search space used: 95380542779
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 32 (16.9 bits)
|
| PSORT |
|
| VS (DIR, S) |
4 |
| VH (FL, L) |
0 |
| VF (FL, S) |
0 |
| AH (FL, L) |
0 |
| AF (FL, S) |
0 |
| SL (DIR, L) |
1 |
| SS (DIR, S) |
11 |
| SH (FL, L) |
0 |
| SF (FL, S) |
0 |
| CH (FL, L) |
0 |
| CF (FL, S) |
0 |
| FCL (DIR, L) |
0 |
| FC (DIR, S) |
3 |
| FC-IC (SUB) |
1 |