| Contig-U15074-1 |
| Contig ID |
Contig-U15074-1 |
| Contig update |
2004. 6.11 |
| Contig sequence |
 |
| Gap |
no gap |
| Contig length |
1785 |
| Chromosome number (1..6, M) |
6 |
| Chromosome length |
3595308 |
| Start point |
40791 |
| End point |
39631 |
| Strand (PLUS/MINUS) |
MINUS |
| Number of clones |
4 |
| Number of EST |
6 |
| Link to clone list |
U15074 |
| List of clone(s) |
|
| Translated Amino Acid sequence |
|
| Translated Amino Acid sequence (All Frames) |
|
| own update |
2004. 6.23 |
| Homology vs CSM-cDNA |
|
| dna update |
2009. 1.11 |
| Homology vs DNA |
Query= Contig-U15074-1 (Contig-U15074-1Q) /CSM_Contig/Contig-U15074-1Q.Seq.d
(1785 letters)
Database: ddbj_A
92,845,959 sequences; 95,242,211,685 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value N
(AU037554) Dictyostelium discoideum slug cDNA, clone SSD780. 1193 0.0 1
(BJ398245) Dictyostelium discoideum cDNA clone:dds11k13, 3' ... 801 0.0 3
(BJ363906) Dictyostelium discoideum cDNA clone:ddc29g03, 5' ... 613 0.0 4
(AU038719) Dictyostelium discoideum slug cDNA, clone SSL391. 476 e-129 1
(BJ386964) Dictyostelium discoideum cDNA clone:dds11k13, 5' ... 168 1e-37 2
(DR396018) USDA-FP_155953 Adult Alate Aphis gossypii (WHAGA)... 50 2e-05 2
(EE571118) D04_D04fv3j8_pDNRf_531155 Myzus persicae, line F0... 46 3e-04 2
(EE570987) C04_C04fv2f7_pDNRf_530674 Myzus persicae, line F0... 46 3e-04 2
(DW013206) w1h19_M13F Myzus persicae, tobacco lineage, whole... 46 3e-04 2
(EX650406) 256739092 Pea aphid whole body normalized full le... 46 3e-04 2
(EX637807) 256615526 Pea aphid whole body normalized full le... 46 3e-04 2
(FF317820) 280394248 Pea aphid whole body normalized full le... 46 3e-04 2
(ES220993) MpGV_ag2_D16 Myzus persicae, line G006, PLRV infe... 46 3e-04 2
(ES217769) MpFVN_ag1_M22 Myzus persicae, line F001, PLRV fre... 46 3e-04 2
(EB749739) 987977 JF06 Tribolium castaneum cDNA clone 500000... 60 3e-04 1
(DN649417) G6706.29 Exelixis Tribolium castaneum cDNA Librar... 60 3e-04 1
(CK810625) Rasgsc5660 Salivary Gland 4th instar 3rd period (... 60 3e-04 1
(CK260982) EST707060 potato abiotic stress cDNA library Sola... 42 9e-04 3
(FF611435) G825P5160RB1.T0 Acorn worm normalized gastrula pE... 58 0.001 1
(FF611434) G825P5160FB1.T0 Acorn worm normalized gastrula pE... 58 0.001 1
(FF604950) G825P5119FC9.T0 Acorn worm normalized gastrula pE... 58 0.001 1
(ES221397) MpGV_ag3_G23 Myzus persicae, line G006, PLRV infe... 46 0.004 2
(CP000942) Ureaplasma parvum serovar 3 str. ATCC 27815, comp... 32 0.005 19
(BW219151) Ciona intestinalis cDNA, clone:cieg095g15, 5' end... 46 0.008 2
(BW213497) Ciona intestinalis cDNA, clone:cieg073m04, 5' end... 46 0.008 2
(BW442032) Ciona intestinalis cDNA, clone:cijv051i14, 5'end,... 46 0.008 2
(EH695346) CCIM7200.b1_O24.ab1 CCI(LMS) chicory Cichorium in... 50 0.008 2
(FF883860) CBWU22711.b1 Yutaka Satou unpublished cDNA librar... 46 0.009 2
(AE009951) Fusobacterium nucleatum subsp. nucleatum ATCC 255... 34 0.014 23
(FC374579) CAYY9317.rev CAYY Physcomitrella patens subsp. pa... 40 0.029 2
(BJ956749) Physcomitrella patens subsp. patens cDNA clone:pp... 40 0.029 2
(AM664348) Entamoeba moshkovskii FIC GSS, clone mosh049d06.p1k. 40 0.029 2
(FC788960) CBGC19410.fwd CBGC Lottia gigantea 15h 18h embryo... 50 0.034 2
(FD457358) EGGBD45TR Haematobia irritans eggs Haematobia irr... 52 0.043 2
(FD455186) EGGAZ95TR Haematobia irritans eggs Haematobia irr... 52 0.043 2
(FD457560) EGGBE75TR Haematobia irritans eggs Haematobia irr... 52 0.044 2
(DW275561) UI-S-GU0-adc-a-12-0-UI.s1 UI-S-GU0 Euprymna scolo... 52 0.074 1
(DW259044) UI-S-GG1-aaz-k-04-0-UI.s1 UI-S-GG1 Euprymna scolo... 52 0.074 1
(CX054278) tai97c11.y2 Hydra EST UCI 5 ALP Hydra magnipapill... 52 0.074 1
(CN553789) tae28f04.y1 Hydra EST Darmstadt I Hydra magnipapi... 52 0.074 1
(FD456344) EGGB717TR Haematobia irritans eggs Haematobia irr... 52 0.074 1
(FD456343) EGGB717TF Haematobia irritans eggs Haematobia irr... 52 0.074 1
(AC068603) Homo sapiens chromosome 15 clone CTD-2529A19 map ... 42 0.080 3
(CW211164) 104_641_11190170_116_37009_001 Sorghum methylatio... 38 0.11 2
(CU426353) Clytia hemisphaerica 5-PRIME EST from clone SA0AA... 44 0.13 2
(AW944719) EST336769 tomato flower buds 3-8 mm, Cornell Univ... 42 0.17 3
(AC187922) Cavia porcellus clone CH234-491M17, WORKING DRAFT... 44 0.20 4
(EY314147) CAWX25344.fwd CAWX Helobdella robusta Primary Ear... 36 0.28 3
(FD442159) Atr02b_135_E03_C011.g1 FGP Female Amborella trich... 42 0.29 3
(FD439442) Atr02b_88_F08_C011.g1 FGP Female Amborella tricho... 42 0.29 3
(EJ960046) 1093018997696 Global-Ocean-Sampling_GS-30-02-01-1... 50 0.29 1
(EJ777961) 1093010957126 Global-Ocean-Sampling_GS-30-02-01-1... 50 0.29 1
(EJ765163) 1092963195696 Global-Ocean-Sampling_GS-30-02-01-1... 50 0.29 1
(EJ720700) 1092959449746 Global-Ocean-Sampling_GS-30-02-01-1... 50 0.29 1
(EL359014) CCEM3849.b1_A03.ab1 CCE(LMS) endive Cichorium end... 50 0.29 1
(EL348717) CCEL4815.b1_M04.ab1 CCE(LMS) endive Cichorium end... 50 0.29 1
(EH699910) CCIS12122.b1_C08.ab1 CCI(LMS) chicory Cichorium i... 50 0.29 1
(BW438378) Ciona intestinalis cDNA, clone:cijv401i14, 5'end,... 46 0.41 2
(FF790278) XABT86266.fwd Gateway compatible cien cDNA librar... 40 0.41 2
(FF803319) XABT94923.fwd Gateway compatible cien cDNA librar... 40 0.43 2
(CP000485) Bacillus thuringiensis str. Al Hakam, complete ge... 40 0.45 23
(FF727672) XABT42923.fwd Gateway compatible cien cDNA librar... 40 0.49 2
(AE002103) Ureaplasma parvum serovar 3 str. ATCC 700970 sect... 34 0.60 5
(CP000001) Bacillus cereus E33L, complete genome. 40 0.69 24
(AC230015) Zea mays chromosome 3 clone CH201-55F7; ZMMBBc005... 38 0.75 7
(EY216525) PRAG-aab37f10.b1 Sand_fly_EST_Normalized Phleboto... 34 0.83 2
(EY204979) PRAG-aaa45c07.b1 Sand_fly_EST_Normalized Phleboto... 34 0.83 2
(EY209292) PRAG-aaa60f03.b1 Sand_fly_EST_Normalized Phleboto... 34 0.84 2
(CU329670) Schizosaccharomyces pombe chromosome I. 48 1.2 1
(CU856230) Pig DNA sequence *** SEQUENCING IN PROGRESS *** f... 48 1.2 1
(CA860319) EST634813 GVSP Glomus versiforme cDNA clone pGVSP... 48 1.2 1
(FK669328) 482 cowpea buchid larval midgut cDNA library Call... 48 1.2 1
(CP001080) Sulfurihydrogenibium sp. YO3AOP1, complete genome. 48 1.2 1
(EC822300) SME00009010 esmbsro2 Sawyeria marylandensis cDNA,... 36 1.4 2
(EC822653) SME00008922 esmbsro2 Sawyeria marylandensis cDNA,... 36 1.4 2
(EC823926) SME00007649 esmbsro2 Sawyeria marylandensis cDNA,... 36 1.4 2
(FD433041) Atr01b_140_F06_C010.g1 FGP Male Amborella trichop... 40 1.6 2
(EX638837) 256621598 Pea aphid whole body normalized full le... 46 1.6 2
(EX633568) 256589464 Pea aphid whole body normalized full le... 46 1.7 2
(FC691191) CAXX2430.rev CAXX Lottia gigantea from male gonad... 46 1.8 2
(EC388646) D09_D09gm4f18_pDNRf_491655 Myzus persicae, line G... 46 1.8 2
(AC203795) Zea mays chromosome 8 clone ZMMBBb-90O18; ZMMBBb0... 42 1.9 3
(EX281486) 1568458_5_H16_058 PY06 Carica papaya cDNA, mRNA s... 38 2.0 2
(AC091371) Rattus norvegicus clone CH230-1C23, *** SEQUENCIN... 32 2.1 2
(AC120619) Rattus norvegicus clone CH230-40H14, *** SEQUENCI... 32 2.2 2
(AC091336) Rattus norvegicus BAC CH230-1C6 (Children's Hosp... 32 2.3 2
(AC106459) Rattus norvegicus clone CH230-207G10, WORKING DRA... 32 2.3 2
(CP000903) Bacillus weihenstephanensis KBAB4, complete genome. 42 2.6 23
(AC115683) Dictyostelium discoideum chromosome 2 map complem... 34 2.7 7
(AC147141) Mus musculus BAC clone RP24-244J6 from chromosome... 40 2.8 3
(DT803828) 107627245 TL1 Tribolium castaneum cDNA clone 1C5 ... 36 2.8 2
(AE017308) Mycoplasma mobile 163K complete genome. 32 2.9 24
(AE014847) Plasmodium falciparum 3D7 chromosome 12, section ... 34 3.2 10
(CU746701) A BAC library has been constructed from PN40024 g... 34 3.3 3
(AC198938) Zea mays chromosome unknown clone CH201-95M16; ZM... 38 3.5 5
(CR382370) Zebrafish DNA sequence from clone DKEY-22O12 in l... 46 4.6 1
(CR382335) Zebrafish DNA sequence from clone DKEY-56I16 in l... 46 4.6 1
(BC119115) Mus musculus olfactory receptor 1270, mRNA (cDNA ... 46 4.6 1
(BC119113) Mus musculus olfactory receptor 1270, mRNA (cDNA ... 46 4.6 1
(AY318474) Mus musculus olfactory receptor Olfr1270 (Olfr127... 46 4.6 1
>(AU037554) Dictyostelium discoideum slug cDNA, clone SSD780.
Length = 653
Score = 1193 bits (602), Expect = 0.0
Identities = 602/602 (100%)
Strand = Plus / Plus
Query: 1128 tgaacaagcaattgaacatattcattcaaatgaaaccatcatgactttaggttgttcaag 1187
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 3 tgaacaagcaattgaacatattcattcaaatgaaaccatcatgactttaggttgttcaag 62
Query: 1188 aaccgttgaagaattcttaaaagaagctgctagaaaaagaagttttaaagttattgttgt 1247
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 63 aaccgttgaagaattcttaaaagaagctgctagaaaaagaagttttaaagttattgttgt 122
Query: 1248 tgaaactgctccatcacttgaaggtcaaaaaacagcaatttcattatcaaaagcatcaat 1307
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 123 tgaaactgctccatcacttgaaggtcaaaaaacagcaatttcattatcaaaagcatcaat 182
Query: 1308 cgatacaacattaattacagattcagcagtatttgcaatgatgtcacgtgttaataaagt 1367
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 183 cgatacaacattaattacagattcagcagtatttgcaatgatgtcacgtgttaataaagt 242
Query: 1368 tattattggtacacatgcagtaatggccaatggtggtttaattgctacctctggtacaca 1427
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 243 tattattggtacacatgcagtaatggccaatggtggtttaattgctacctctggtacaca 302
Query: 1428 tacattggctgtagctgctaaatatcactctgtaccaatagtggtttgtactggtcttta 1487
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 303 tacattggctgtagctgctaaatatcactctgtaccaatagtggtttgtactggtcttta 362
Query: 1488 taaactctgtccattatatgcatatgatcaagatacattcaataattttggttcaccagg 1547
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 363 taaactctgtccattatatgcatatgatcaagatacattcaataattttggttcaccagg 422
Query: 1548 tgaatatttaaaatttgaagaagcagaatttttagaaaatgttcacagttataatccaac 1607
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 423 tgaatatttaaaatttgaagaagcagaatttttagaaaatgttcacagttataatccaac 482
Query: 1608 ctttgattatgttgcaccagatctcgttagtttattcataacaaatataggtggtcataa 1667
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 483 ctttgattatgttgcaccagatctcgttagtttattcataacaaatataggtggtcataa 542
Query: 1668 tccatcctatatctatcgtttacttcaagaatattatgatgctagagatattttagaaga 1727
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 543 tccatcctatatctatcgtttacttcaagaatattatgatgctagagatattttagaaga 602
Query: 1728 tg 1729
||
Sbjct: 603 tg 604
Score = 172 bits (87), Expect = 3e-38
Identities = 87/87 (100%)
Strand = Plus / Plus
Query: 628 tgaacaagcaattgaacatattcattcaaatgaaaccatcatgactttaggttgttcaag 687
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 3 tgaacaagcaattgaacatattcattcaaatgaaaccatcatgactttaggttgttcaag 62
Query: 688 aaccgttgaagaattcttaaaagaagc 714
|||||||||||||||||||||||||||
Sbjct: 63 aaccgttgaagaattcttaaaagaagc 89
Lambda K H
1.37 0.711 1.31
Matrix: blastn matrix:1 -3
Number of Sequences: 92845959
Number of Hits to DB: 1,957,404,249
Number of extensions: 121117185
Number of successful extensions: 10273764
Number of sequences better than 10.0: 187
Length of query: 1785
Length of database: 95,242,211,685
Length adjustment: 24
Effective length of query: 1761
Effective length of database: 97,308,875,965
Effective search space: 171360930574365
Effective search space used: 171360930574365
X1: 11 (21.8 bits)
S2: 22 (44.1 bits)
|
| protein update |
2009. 7.14 |
| Homology vs Protein |
Query= Contig-U15074-1 (Contig-U15074-1Q) /CSM_Contig/Contig-U15074-1Q.Seq.d
(1785 letters)
Database: nrp_B
3,236,559 sequences; 1,051,180,864 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
(Q54EY2) RecName: Full=Translation initiation factor eIF-2B subu... 563 e-159
BC067147_1(BC067147|pid:none) Danio rerio eukaryotic translation... 271 6e-71
DQ214062_1(DQ214062|pid:none) Taeniopygia guttata clone 0063P000... 271 6e-71
DQ891364_1(DQ891364|pid:none) Synthetic construct clone IMAGE:10... 270 1e-70
BC000494_1(BC000494|pid:none) Homo sapiens eukaryotic translatio... 269 3e-70
(P49770) RecName: Full=Translation initiation factor eIF-2B subu... 269 3e-70
(Q5E9B4) RecName: Full=Translation initiation factor eIF-2B subu... 268 5e-70
AB170077_1(AB170077|pid:none) Macaca fascicularis brain cDNA clo... 265 3e-69
BC088515_1(BC088515|pid:none) Xenopus tropicalis eukaryotic tran... 265 4e-69
BC070506_1(BC070506|pid:none) Rattus norvegicus eukaryotic trans... 265 4e-69
U83914_1(U83914|pid:none) Rattus norvegicus eukaryotic initiatio... 264 7e-69
AC012395_3(AC012395|pid:none) Arabidopsis thaliana chromosome II... 231 5e-59
AK317423_1(AK317423|pid:none) Arabidopsis thaliana AT3G07300 mRN... 231 7e-59
AK318920_1(AK318920|pid:none) Arabidopsis thaliana AT3G07300 mRN... 231 7e-59
AK226859_1(AK226859|pid:none) Arabidopsis thaliana mRNA for puta... 231 7e-59
AF137288_1(AF137288|pid:none) Nicotiana tabacum putative transla... 227 9e-58
AP008216_510(AP008216|pid:none) Oryza sativa (japonica cultivar-... 224 6e-57
EU963177_1(EU963177|pid:none) Zea mays clone 258754 translation ... 221 7e-56
AE014298_462(AE014298|pid:none) Drosophila melanogaster chromoso... 216 3e-54
AM920431_262(AM920431|pid:none) Penicillium chrysogenum Wisconsi... 207 1e-51
AP007161_781(AP007161|pid:none) Aspergillus oryzae RIB40 genomic... 203 1e-50
AE017352_242(AE017352|pid:none) Cryptococcus neoformans var. neo... 201 7e-50
AE017352_243(AE017352|pid:none) Cryptococcus neoformans var. neo... 196 2e-48
L40395_1(L40395|pid:none) Homo sapiens (clone S20iii15) mRNA, 3'... 190 2e-46
BC041556_1(BC041556|pid:none) Xenopus laevis eukaryotic translat... 184 1e-44
CP001327_370(CP001327|pid:none) Micromonas sp. RCC299 chromosome... 176 2e-42
CP000498_641(CP000498|pid:none) Pichia stipitis CBS 6054 chromos... 176 2e-42
AC009853_1(AC009853|pid:none) Arabidopsis thaliana chromosome II... 176 3e-42
AK319053_1(AK319053|pid:none) Arabidopsis thaliana AT3G07300 mRN... 175 4e-42
CR382136_467(CR382136|pid:none) Debaryomyces hansenii strain CBS... 170 1e-40
CR382132_1012(CR382132|pid:none) Yarrowia lipolytica strain CLIB... 167 1e-39
FM992689_365(FM992689|pid:none) Candida dubliniensis CD36 chromo... 165 6e-39
CR382123_218(CR382123|pid:none) Kluyveromyces lactis strain NRRL... 144 8e-33
CR382121_183(CR382121|pid:none) Kluyveromyces lactis strain NRRL... 144 1e-32
(P32502) RecName: Full=Translation initiation factor eIF-2B subu... 143 2e-32
AE016820_661(AE016820|pid:none) Ashbya gossypii (= Eremothecium ... 143 2e-32
CR380953_410(CR380953|pid:none) Candida glabrata strain CBS138 c... 142 4e-32
AC159435_24(AC159435|pid:none) Trypanosoma brucei chromosome 8 c... 139 3e-31
CP000593_90(CP000593|pid:none) Ostreococcus lucimarinus CCE9901 ... 138 6e-31
FN357316_26(FN357316|pid:none) Schistosoma mansoni genome sequen... 138 8e-31
CU928176_629(CU928176|pid:none) Zygosaccharomyces rouxii strain ... 137 1e-30
CT005249_104(CT005249|pid:none) Leishmania major strain Friedlin... 134 1e-29
BX294024_28(BX294024|pid:none) Neurospora crassa DNA linkage gro... 121 1e-25
CU640366_1350(CU640366|pid:none) Podospora anserina genomic DNA ... 120 1e-25
AE014188_481(AE014188|pid:none) Plasmodium falciparum 3D7 chromo... 117 1e-24
BX276101_4(BX276101|pid:none) Zebrafish DNA sequence from clone ... 111 8e-23
BC121465_1(BC121465|pid:none) Xenopus tropicalis eukaryotic tran... 109 4e-22
BC122497_1(BC122497|pid:none) Xenopus laevis hypothetical LOC496... 109 4e-22
BC088810_1(BC088810|pid:none) Xenopus laevis hypothetical LOC496... 109 4e-22
BC106221_1(BC106221|pid:none) Xenopus laevis hypothetical LOC496... 109 4e-22
AL050109_1(AL050109|pid:none) Homo sapiens mRNA; cDNA DKFZp586J0... 105 4e-21
(Q9UI10) RecName: Full=Translation initiation factor eIF-2B subu... 105 4e-21
AJ011306_1(AJ011306|pid:none) Homo sapiens mRNA for guanine nucl... 105 4e-21
AJ011305_1(AJ011305|pid:none) Homo sapiens mRNA for guanine nucl... 105 4e-21
AK158282_1(AK158282|pid:none) Mus musculus adult inner ear cDNA,... 103 2e-20
A55146(A55146;B55146)guanine nucleotide exchange factor eIF-2B d... 103 2e-20
M98035_1(M98035|pid:none) Mus musculus guanine nucleotide exchan... 103 2e-20
AF112207_1(AF112207|pid:none) Homo sapiens translation initiatio... 103 3e-20
X75451_1(X75451|pid:none) O.cuniculus mRNA for translation initi... 102 6e-20
(P41111) RecName: Full=Translation initiation factor eIF-2B subu... 102 6e-20
AY541450_1(AY541450|pid:none) Fundulus heteroclitus translation ... 101 8e-20
AM114193_152(AM114193|pid:none) Uncultured methanogenic archaeon... 99 5e-19
AE013599_3812(AE013599|pid:none) Drosophila melanogaster chromos... 99 7e-19
AJ344149_1(AJ344149|pid:none) Drosophila melanogaster mRNA for e... 99 7e-19
BT078964_1(BT078964|pid:none) Esox lucius clone eluc-evq-518-278... 98 9e-19
CR858952_1(CR858952|pid:none) Pongo abelii mRNA; cDNA DKFZp469L0... 98 9e-19
BT058540_1(BT058540|pid:none) Salmo salar clone Contig1705 Trans... 98 1e-18
BT023760_1(BT023760|pid:none) Drosophila melanogaster RE55357 fu... 97 1e-18
BT067071_1(BT067071|pid:none) Zea mays full-length cDNA clone ZM... 97 2e-18
(Q4R4V8) RecName: Full=Translation initiation factor eIF-2B subu... 97 3e-18
(P14741) RecName: Full=Translation initiation factor eIF-2B subu... 95 1e-17
CP000855_1302(CP000855|pid:none) Thermococcus onnurineus NA1, co... 94 1e-17
BT050278_1(BT050278|pid:none) Salmo salar clone ssal-evf-504-047... 94 2e-17
(O57947) RecName: Full=Putative translation initiation factor eI... 94 2e-17
(O28242) RecName: Full=Putative translation initiation factor eI... 94 2e-17
CP001398_1634(CP001398|pid:none) Thermococcus gammatolerans EJ3,... 92 6e-17
BC068625_1(BC068625|pid:none) Xenopus laevis hypothetical protei... 92 6e-17
(Q54I81) RecName: Full=Translation initiation factor eIF-2B subu... 92 6e-17
CT978957_2(CT978957|pid:none) Zebrafish DNA sequence from clone ... 91 1e-16
AE009950_122(AE009950|pid:none) Pyrococcus furiosus DSM 3638, co... 91 1e-16
DQ645454_1(DQ645454|pid:none) Bombyx mori eIF2B-alpha protein mR... 91 1e-16
GM017008_297(GM017008|pid:none) Sequence 1838 from Patent EP1923... 89 4e-16
CR382131_5(CR382131|pid:none) Yarrowia lipolytica strain CLIB122... 89 4e-16
CP001140_456(CP001140|pid:none) Desulfurococcus kamchatkensis 12... 89 5e-16
AP008218_1378(AP008218|pid:none) Oryza sativa (japonica cultivar... 89 7e-16
AE016819_317(AE016819|pid:none) Ashbya gossypii (= Eremothecium ... 88 9e-16
AB005231_19(AB005231|pid:none) Arabidopsis thaliana genomic DNA,... 88 1e-15
AE014297_4666(AE014297|pid:none) Drosophila melanogaster chromos... 86 4e-15
BT077587_1(BT077587|pid:none) Lepeophtheirus salmonis Pacific fo... 86 4e-15
CR382129_672(CR382129|pid:none) Yarrowia lipolytica strain CLIB1... 86 6e-15
CU928178_68(CU928178|pid:none) Zygosaccharomyces rouxii strain C... 86 6e-15
CU928175_734(CU928175|pid:none) Zygosaccharomyces rouxii strain ... 85 8e-15
CP000505_383(CP000505|pid:none) Thermofilum pendens Hrk 5, compl... 85 8e-15
AC004005_21(AC004005|pid:none) Arabidopsis thaliana chromosome 2... 85 8e-15
AC016041_24(AC016041|pid:none) Genomic sequence for Arabidopsis ... 84 1e-14
(Q9USP0) RecName: Full=Translation initiation factor eIF-2B subu... 84 2e-14
AY062581_1(AY062581|pid:none) Arabidopsis thaliana putative tran... 84 2e-14
(Q57586) RecName: Full=Putative translation initiation factor eI... 83 3e-14
CP000743_664(CP000743|pid:none) Methanococcus aeolicus Nankai-3,... 82 5e-14
AC009324_11(AC009324|pid:none) Arabidopsis thaliana chromosome I... 82 5e-14
AE017347_143(AE017347|pid:none) Cryptococcus neoformans var. neo... 82 6e-14
AE016818_24(AE016818|pid:none) Ashbya gossypii (= Eremothecium g... 82 6e-14
CP000300_1795(CP000300|pid:none) Methanococcoides burtonii DSM 6... 82 8e-14
CP000575_1334(CP000575|pid:none) Staphylothermus marinus F1, com... 81 1e-13
AC183502_19(AC183502|pid:none) Medicago truncatula clone mth2-75... 81 1e-13
AK220696_1(AK220696|pid:none) Arabidopsis thaliana mRNA for puta... 80 2e-13
AE004437_1415(AE004437|pid:none) Halobacterium sp. NRC-1, comple... 80 2e-13
AP008218_898(AP008218|pid:none) Oryza sativa (japonica cultivar-... 80 3e-13
CP001575_528(CP001575|pid:none) Micromonas sp. RCC299 chromosome... 79 5e-13
AE010299_377(AE010299|pid:none) Methanosarcina acetivorans str. ... 79 7e-13
AK340886_1(AK340886|pid:none) Acyrthosiphon pisum ACYPI007014 mR... 79 7e-13
EU965184_1(EU965184|pid:none) Zea mays clone 284346 translation ... 78 9e-13
CP000559_553(CP000559|pid:none) Methanocorpusculum labreanum Z, ... 78 1e-12
CU928170_457(CU928170|pid:none) Kluyveromyces thermotolerans str... 78 1e-12
CP000099_776(CP000099|pid:none) Methanosarcina barkeri str. Fusa... 77 2e-12
AE008384_1606(AE008384|pid:none) Methanosarcina mazei strain Goe... 77 2e-12
CP000505_384(CP000505|pid:none) Thermofilum pendens Hrk 5, compl... 77 2e-12
CR936257_1594(CR936257|pid:none) Natronomonas pharaonis DSM 2160... 77 2e-12
CT978957_3(CT978957|pid:none) Zebrafish DNA sequence from clone ... 76 4e-12
FP312982_45(FP312982|pid:none) uncultured bacterial clone mtbs45... 75 6e-12
CR954205_430(CR954205|pid:none) Ostreococcus tauri strain OTTH05... 75 1e-11
CR380957_39(CR380957|pid:none) Candida glabrata strain CBS138 ch... 74 1e-11
(Q67MP0) RecName: Full=Methylthioribose-1-phosphate isomerase; ... 74 2e-11
CP000227_360(CP000227|pid:none) Bacillus cereus Q1, complete gen... 74 2e-11
CP001177_346(CP001177|pid:none) Bacillus cereus AH187, complete ... 74 2e-11
AE016877_309(AE016877|pid:none) Bacillus cereus ATCC 14579, comp... 73 3e-11
BC071346_1(BC071346|pid:none) Danio rerio eukaryotic translation... 73 3e-11
CP000686_2948(CP000686|pid:none) Roseiflexus sp. RS-1, complete ... 73 3e-11
AE017343_171(AE017343|pid:none) Cryptococcus neoformans var. neo... 73 3e-11
(Q63GN3) RecName: Full=Methylthioribose-1-phosphate isomerase 1;... 73 3e-11
(Q3ABU6) RecName: Full=Methylthioribose-1-phosphate isomerase; ... 73 4e-11
AE017225_321(AE017225|pid:none) Bacillus anthracis str. Sterne, ... 73 4e-11
FN392320_1038(FN392320|pid:none) Pichia pastoris GS115 chromosom... 73 4e-11
CP000903_324(CP000903|pid:none) Bacillus weihenstephanensis KBAB... 72 5e-11
CP001634_1417(CP001634|pid:none) Kosmotoga olearia TBF 19.5.1, c... 72 5e-11
(A9VRK3) RecName: Full=Methylthioribose-1-phosphate isomerase 1;... 72 5e-11
(Q57896) RecName: Full=Putative translation initiation factor eI... 72 5e-11
(Q2RKL8) RecName: Full=Methylthioribose-1-phosphate isomerase; ... 72 5e-11
(B0TH58) RecName: Full=Methylthioribose-1-phosphate isomerase; ... 72 5e-11
(A9WGQ8) RecName: Full=Methylthioribose-1-phosphate isomerase; ... 72 7e-11
EF086198_1(EF086198|pid:none) Picea sitchensis clone WS0287_E06 ... 72 9e-11
CP000804_2093(CP000804|pid:none) Roseiflexus castenholzii DSM 13... 71 1e-10
(O58185) RecName: Full=Putative translation initiation factor eI... 71 1e-10
CP001185_479(CP001185|pid:none) Thermosipho africanus TCF52B, co... 70 2e-10
CP000855_641(CP000855|pid:none) Thermococcus onnurineus NA1, com... 70 2e-10
AM181176_1603(AM181176|pid:none) Pseudomonas fluorescens SBW25 c... 70 3e-10
CT009753_144(CT009753|pid:none) Trypanosoma brucei chromosome 11... 70 3e-10
AY596297_259(AY596297|pid:none) Haloarcula marismortui ATCC 4304... 70 3e-10
(Q3A2J8) RecName: Full=Methylthioribose-1-phosphate isomerase; ... 69 4e-10
(Q7UF90) RecName: Full=Methylthioribose-1-phosphate isomerase; ... 69 4e-10
AE017261_527(AE017261|pid:none) Picrophilus torridus DSM 9790, c... 69 4e-10
FN357653_7(FN357653|pid:none) Schistosoma mansoni genome sequenc... 69 6e-10
(B2SIW1) RecName: Full=Methylthioribose-1-phosphate isomerase; ... 69 6e-10
(Q3BV11) RecName: Full=Methylthioribose-1-phosphate isomerase; ... 69 6e-10
CP001337_3445(CP001337|pid:none) Chloroflexus aggregans DSM 9485... 69 6e-10
(Q8PM04) RecName: Full=Methylthioribose-1-phosphate isomerase; ... 69 7e-10
CP001337_1947(CP001337|pid:none) Chloroflexus aggregans DSM 9485... 68 1e-09
AP010904_3141(AP010904|pid:none) Desulfovibrio magneticus RS-1 D... 68 1e-09
(A8YD90) RecName: Full=Methylthioribose-1-phosphate isomerase; ... 68 1e-09
(A9AYL1) RecName: Full=Methylthioribose-1-phosphate isomerase; ... 68 1e-09
CP000875_2337(CP000875|pid:none) Herpetosiphon aurantiacus ATCC ... 68 1e-09
(A9BJF6) RecName: Full=Methylthioribose-1-phosphate isomerase 1;... 68 1e-09
CP000879_621(CP000879|pid:none) Petrotoga mobilis SJ95, complete... 68 1e-09
(Q317L9) RecName: Full=Methylthioribose-1-phosphate isomerase; ... 67 2e-09
(Q2LXN1) RecName: Full=Methylthioribose-1-phosphate isomerase; ... 67 2e-09
(A1JP09) RecName: Full=Methylthioribose-1-phosphate isomerase; ... 67 2e-09
EU016599_15(EU016599|pid:none) Uncultured Group I marine crenarc... 67 2e-09
CP001365_2249(CP001365|pid:none) Halorubrum lacusprofundi ATCC 4... 67 2e-09
(A4ILL1) RecName: Full=Methylthioribose-1-phosphate isomerase; ... 67 2e-09
(Q21S04) RecName: Full=Methylthioribose-1-phosphate isomerase; ... 67 2e-09
CP001147_1444(CP001147|pid:none) Thermodesulfovibrio yellowstoni... 67 2e-09
CP000909_1354(CP000909|pid:none) Chloroflexus aurantiacus J-10-f... 67 3e-09
(Q9UYB6) RecName: Full=Putative translation initiation factor eI... 67 3e-09
AM502245_80(AM502245|pid:none) Leishmania infantum chromosome 27. 67 3e-09
FN357611_11(FN357611|pid:none) Schistosoma mansoni genome sequen... 66 4e-09
AM494964_131(AM494964|pid:none) Leishmania braziliensis chromoso... 66 4e-09
CP000922_1976(CP000922|pid:none) Anoxybacillus flavithermus WK1,... 66 5e-09
(Q72JR1) RecName: Full=Methylthioribose-1-phosphate isomerase; ... 66 5e-09
CP001357_2443(CP001357|pid:none) Brachyspira hyodysenteriae WA1,... 65 6e-09
CU638743_169(CU638743|pid:none) Podospora anserina genomic DNA c... 65 6e-09
(A8F3A3) RecName: Full=Methylthioribose-1-phosphate isomerase 1;... 65 6e-09
(A9KIE9) RecName: Full=Methylthioribose-1-phosphate isomerase; ... 65 8e-09
CP001348_1257(CP001348|pid:none) Clostridium cellulolyticum H10,... 65 1e-08
AY738148_1(AY738148|pid:none) Zea mays isopentenyl-diphosphate d... 65 1e-08
EU965753_1(EU965753|pid:none) Zea mays clone 288697 methylthiori... 65 1e-08
CP001146_759(CP001146|pid:none) Dictyoglomus thermophilum H-6-12... 65 1e-08
BX950851_3452(BX950851|pid:none) Erwinia carotovora subsp. atros... 64 1e-08
CP001638_784(CP001638|pid:none) Geobacillus sp. WCH70, complete ... 64 1e-08
(Q5SJE2) RecName: Full=Methylthioribose-1-phosphate isomerase; ... 64 1e-08
CP001140_1210(CP001140|pid:none) Desulfurococcus kamchatkensis 1... 64 1e-08
(A4W7Z1) RecName: Full=Methylthioribose-1-phosphate isomerase; ... 64 2e-08
AP006878_1048(AP006878|pid:none) Thermococcus kodakarensis KOD1 ... 64 2e-08
(B2FKI7) RecName: Full=Methylthioribose-1-phosphate isomerase; ... 64 2e-08
AP009153_817(AP009153|pid:none) Gemmatimonas aurantiaca T-27 DNA... 64 2e-08
(Q0VPK6) RecName: Full=Methylthioribose-1-phosphate isomerase; ... 64 2e-08
(B1KZY3) RecName: Full=Methylthioribose-1-phosphate isomerase; ... 64 2e-08
CP000140_2211(CP000140|pid:none) Parabacteroides distasonis ATCC... 64 2e-08
AL445066_279(AL445066|pid:none) Thermoplasma acidophilum complet... 64 2e-08
(P74497) RecName: Full=Methylthioribose-1-phosphate isomerase; ... 64 2e-08
AM920436_616(AM920436|pid:none) Penicillium chrysogenum Wisconsi... 64 2e-08
(A6LE92) RecName: Full=Methylthioribose-1-phosphate isomerase; ... 64 2e-08
AY223354_1(AY223354|pid:none) Schistosoma japonicum clone ZZD935... 63 3e-08
AE006641_2733(AE006641|pid:none) Sulfolobus solfataricus P2, com... 63 3e-08
(A7GCV8) RecName: Full=Methylthioribose-1-phosphate isomerase; ... 63 4e-08
(Q88M09) RecName: Full=Methylthioribose-1-phosphate isomerase; ... 63 4e-08
BX950229_1618(BX950229|pid:none) Methanococcus maripaludis strai... 63 4e-08
CP001251_869(CP001251|pid:none) Dictyoglomus turgidum DSM 6724, ... 63 4e-08
AY087601_1(AY087601|pid:none) Arabidopsis thaliana clone 36965 m... 63 4e-08
CP001083_1234(CP001083|pid:none) Clostridium botulinum Ba4 str. ... 63 4e-08
CP000505_246(CP000505|pid:none) Thermofilum pendens Hrk 5, compl... 63 4e-08
(Q819F2) RecName: Full=Methylthioribose-1-phosphate isomerase 2;... 62 5e-08
(B1IJF0) RecName: Full=Methylthioribose-1-phosphate isomerase; ... 62 5e-08
CP001176_3981(CP001176|pid:none) Bacillus cereus B4264, complete... 62 5e-08
AE017261_261(AE017261|pid:none) Picrophilus torridus DSM 9790, c... 62 5e-08
(Q731R7) RecName: Full=Methylthioribose-1-phosphate isomerase; ... 62 5e-08
BA000011_1275(BA000011|pid:none) Thermoplasma volcanium GSS1 DNA... 62 5e-08
(O29877) RecName: Full=Putative translation initiation factor eI... 62 5e-08
(A5D1G8) RecName: Full=Methylthioribose-1-phosphate isomerase; ... 62 7e-08
(A7Z3X0) RecName: Full=Methylthioribose-1-phosphate isomerase; ... 62 7e-08
(A5I1A6) RecName: Full=Methylthioribose-1-phosphate isomerase; ... 62 7e-08
CU468135_2606(CU468135|pid:none) Erwinia tasmaniensis strain ET1... 62 7e-08
CP001229_593(CP001229|pid:none) Sulfurihydrogenibium azorense Az... 62 9e-08
CP000227_3721(CP000227|pid:none) Bacillus cereus Q1, complete ge... 62 9e-08
BA000030_5069(BA000030|pid:none) Streptomyces avermitilis MA-468... 62 9e-08
AL939114_233(AL939114|pid:none) Streptomyces coelicolor A3(2) co... 62 9e-08
AL445065_254(AL445065|pid:none) Thermoplasma acidophilum complet... 62 9e-08
(A8ANI3) RecName: Full=Methylthioribose-1-phosphate isomerase; ... 62 9e-08
AJ439060_9(AJ439060|pid:none) Anopheles gambiae DNA from 2R chro... 62 9e-08
(A7GS56) RecName: Full=Methylthioribose-1-phosphate isomerase; ... 61 1e-07
(Q8F2A8) RecName: Full=Methylthioribose-1-phosphate isomerase; ... 61 1e-07
(Q72T46) RecName: Full=Methylthioribose-1-phosphate isomerase; ... 61 1e-07
(B0U5G3) RecName: Full=Methylthioribose-1-phosphate isomerase; ... 61 1e-07
AP008217_520(AP008217|pid:none) Oryza sativa (japonica cultivar-... 61 1e-07
(A4J678) RecName: Full=Methylthioribose-1-phosphate isomerase; ... 61 2e-07
FP236842_2728(FP236842|pid:none) Erwinia pyrifoliae strain Ep1/9... 61 2e-07
H84471(H84471)hypothetical protein At2g05830 [imported] - Arabid... 61 2e-07
AL834276_1(AL834276|pid:none) Homo sapiens mRNA; cDNA DKFZp547E2... 61 2e-07
(O31662) RecName: Full=Methylthioribose-1-phosphate isomerase; ... 60 2e-07
CP000254_598(CP000254|pid:none) Methanospirillum hungatei JF-1, ... 60 2e-07
(A7MKX3) RecName: Full=Methylthioribose-1-phosphate isomerase; ... 60 2e-07
(Q2SE63) RecName: Full=Methylthioribose-1-phosphate isomerase; ... 60 2e-07
CP000587_231(CP000587|pid:none) Ostreococcus lucimarinus CCE9901... 60 2e-07
(Q1IDA4) RecName: Full=Methylthioribose-1-phosphate isomerase; ... 60 3e-07
AP009493_4522(AP009493|pid:none) Streptomyces griseus subsp. gri... 60 3e-07
CP000867_1041(CP000867|pid:none) Methanococcus maripaludis C6, c... 60 3e-07
AE015927_822(AE015927|pid:none) Clostridium tetani E88, complete... 60 3e-07
(Q7U4V1) RecName: Full=Methylthioribose-1-phosphate isomerase; ... 60 3e-07
(Q113K5) RecName: Full=Methylthioribose-1-phosphate isomerase; ... 60 3e-07
CP001283_3963(CP001283|pid:none) Bacillus cereus AH820, complete... 60 3e-07
(Q6HED3) RecName: Full=Methylthioribose-1-phosphate isomerase 2;... 60 3e-07
CP000682_2230(CP000682|pid:none) Metallosphaera sedula DSM 5348,... 60 3e-07
(A8F7V1) RecName: Full=Methylthioribose-1-phosphate isomerase 2;... 60 3e-07
AM180088_1777(AM180088|pid:none) Haloquadratum walsbyi DSM 16790... 59 4e-07
(B1YIY4) RecName: Full=Methylthioribose-1-phosphate isomerase; ... 59 4e-07
(A4TPM9) RecName: Full=Methylthioribose-1-phosphate isomerase; ... 59 4e-07
(B0C8J2) RecName: Full=Methylthioribose-1-phosphate isomerase; ... 59 4e-07
CP000964_3868(CP000964|pid:none) Klebsiella pneumoniae 342, comp... 59 4e-07
CP000806_2331(CP000806|pid:none) Cyanothece sp. ATCC 51142 circu... 59 4e-07
CP001358_2287(CP001358|pid:none) Desulfovibrio desulfuricans sub... 59 6e-07
CP001186_4052(CP001186|pid:none) Bacillus cereus G9842, complete... 59 6e-07
(Q9BV20) RecName: Full=Methylthioribose-1-phosphate isomerase; ... 59 6e-07
CP000075_3647(CP000075|pid:none) Pseudomonas syringae pv. syring... 59 6e-07
(Q3M785) RecName: Full=Methylthioribose-1-phosphate isomerase; ... 59 6e-07
(Q81MJ6) RecName: Full=Methylthioribose-1-phosphate isomerase 2;... 59 6e-07
CP001403_2460(CP001403|pid:none) Sulfolobus islandicus Y.G.57.14... 59 6e-07
(A4VLZ8) RecName: Full=Methylthioribose-1-phosphate isomerase; ... 59 8e-07
CP001400_2210(CP001400|pid:none) Sulfolobus islandicus M.14.25, ... 59 8e-07
(Q3AWF5) RecName: Full=Methylthioribose-1-phosphate isomerase; ... 59 8e-07
CP000968_1533(CP000968|pid:none) Candidatus Korarchaeum cryptofi... 58 1e-06
CP001399_2346(CP001399|pid:none) Sulfolobus islandicus L.S.2.15,... 58 1e-06
CP000951_2267(CP000951|pid:none) Synechococcus sp. PCC 7002, com... 58 1e-06
BX842620_4(BX842620|pid:none) Neurospora crassa DNA linkage grou... 58 1e-06
(B1XJK0) RecName: Full=Methylthioribose-1-phosphate isomerase; ... 58 1e-06
CP000742_916(CP000742|pid:none) Methanococcus vannielii SB, comp... 58 1e-06
CP001287_3257(CP001287|pid:none) Cyanothece sp. PCC 8801, comple... 58 1e-06
(Q3K8T8) RecName: Full=Methylthioribose-1-phosphate isomerase; ... 58 1e-06
CP000780_1831(CP000780|pid:none) Candidatus Methanoregula boonei... 58 1e-06
(A1VHH2) RecName: Full=Methylthioribose-1-phosphate isomerase; ... 58 1e-06
(B2K633) RecName: Full=Methylthioribose-1-phosphate isomerase; ... 58 1e-06
(A9VFD5) RecName: Full=Methylthioribose-1-phosphate isomerase 2;... 58 1e-06
(A7NFR2) RecName: Full=Methylthioribose-1-phosphate isomerase; ... 58 1e-06
(Q606P2) RecName: Full=Methylthioribose-1-phosphate isomerase; ... 58 1e-06
(B0SFD6) RecName: Full=Methylthioribose-1-phosphate isomerase; ... 57 2e-06
CP001472_301(CP001472|pid:none) Acidobacterium capsulatum ATCC 5... 57 2e-06
CP000609_1771(CP000609|pid:none) Methanococcus maripaludis C5, c... 57 2e-06
CP000852_388(CP000852|pid:none) Caldivirga maquilingensis IC-167... 57 2e-06
CP001336_3711(CP001336|pid:none) Desulfitobacterium hafniense DC... 57 2e-06
(Q24UA0) RecName: Full=Methylthioribose-1-phosphate isomerase; ... 57 2e-06
CP001398_1557(CP001398|pid:none) Thermococcus gammatolerans EJ3,... 57 2e-06
CU466930_1692(CU466930|pid:none) Candidatus Cloacamonas acidamin... 57 2e-06
GM017008_244(GM017008|pid:none) Sequence 1838 from Patent EP1923... 57 3e-06
CP001132_995(CP001132|pid:none) Acidithiobacillus ferrooxidans A... 57 3e-06
(A0LIZ1) RecName: Full=Methylthioribose-1-phosphate isomerase; ... 56 4e-06
BA000023_993(BA000023|pid:none) Sulfolobus tokodaii str. 7 DNA, ... 56 4e-06
(Q4K8M6) RecName: Full=Methylthioribose-1-phosphate isomerase; ... 56 4e-06
(Q9X013) RecName: Full=Methylthioribose-1-phosphate isomerase; ... 56 4e-06
AY659090_1(AY659090|pid:none) Synthetic construct Peudomonas aer... 56 4e-06
(A1U3J9) RecName: Full=Methylthioribose-1-phosphate isomerase; ... 56 4e-06
CP000743_27(CP000743|pid:none) Methanococcus aeolicus Nankai-3, ... 56 5e-06
(A6V2Q6) RecName: Full=Methylthioribose-1-phosphate isomerase; ... 56 5e-06
CP000493_923(CP000493|pid:none) Hyperthermus butylicus DSM 5456,... 55 6e-06
CP001275_881(CP001275|pid:none) Thermomicrobium roseum DSM 5159,... 55 6e-06
(Q9UZ16) RecName: Full=Putative translation initiation factor eI... 55 6e-06
(A5IIM2) RecName: Full=Methylthioribose-1-phosphate isomerase; ... 55 8e-06
(Q5YQZ6) RecName: Full=Methylthioribose-1-phosphate isomerase; ... 55 8e-06
(A8GAB1) RecName: Full=Methylthioribose-1-phosphate isomerase; ... 55 8e-06
CP000561_2148(CP000561|pid:none) Pyrobaculum calidifontis JCM 11... 55 8e-06
AE014297_4940(AE014297|pid:none) Drosophila melanogaster chromos... 55 1e-05
AP009178_570(AP009178|pid:none) Nitratiruptor sp. SB155-2 genomi... 55 1e-05
CP000559_970(CP000559|pid:none) Methanocorpusculum labreanum Z, ... 54 1e-05
CP000102_987(CP000102|pid:none) Methanosphaera stadtmanae DSM 30... 54 1e-05
CP000477_355(CP000477|pid:none) Methanosaeta thermophila PT, com... 54 1e-05
CP000099_1015(CP000099|pid:none) Methanosarcina barkeri str. Fus... 54 2e-05
CR848601_1(CR848601|pid:none) Xenopus tropicalis finished cDNA, ... 54 2e-05
CP000678_804(CP000678|pid:none) Methanobrevibacter smithii ATCC ... 54 2e-05
(Q0VFN1) RecName: Full=Methylthioribose-1-phosphate isomerase; ... 54 2e-05
CP001344_3541(CP001344|pid:none) Cyanothece sp. PCC 7425, comple... 54 2e-05
(A1ALC1) RecName: Full=Methylthioribose-1-phosphate isomerase; ... 54 2e-05
(B0K2V6) RecName: Full=Methylthioribose-1-phosphate isomerase; ... 54 2e-05
(A4XTE5) RecName: Full=Methylthioribose-1-phosphate isomerase; ... 53 4e-05
(Q2NL31) RecName: Full=Methylthioribose-1-phosphate isomerase; ... 53 4e-05
(B2V8N9) RecName: Full=Methylthioribose-1-phosphate isomerase; ... 53 4e-05
CR382138_117(CR382138|pid:none) Debaryomyces hansenii strain CBS... 53 4e-05
AL844507_275(AL844507|pid:none) Plasmodium falciparum 3D7 chromo... 52 7e-05
CP001359_4295(CP001359|pid:none) Anaeromyxobacter dehalogenans 2... 52 7e-05
(Q7NP62) RecName: Full=Methylthioribose-1-phosphate isomerase; ... 52 9e-05
CP000716_1150(CP000716|pid:none) Thermosipho melanesiensis BI429... 52 9e-05
CT005251_1(CT005251|pid:none) Leishmania major strain Friedlin, ... 52 9e-05
(A9FD66) RecName: Full=Methylthioribose-1-phosphate isomerase; ... 51 1e-04
CU640366_532(CU640366|pid:none) Podospora anserina genomic DNA c... 51 1e-04
AM746676_1576(AM746676|pid:none) Sorangium cellulosum 'So ce 56'... 51 1e-04
CP001145_1046(CP001145|pid:none) Coprothermobacter proteolyticus... 51 2e-04
CT005272_510(CT005272|pid:none) Leishmania major strain Friedlin... 51 2e-04
(Q2IH96) RecName: Full=Methylthioribose-1-phosphate isomerase; ... 51 2e-04
CP001157_1527(CP001157|pid:none) Azotobacter vinelandii DJ, comp... 51 2e-04
(Q39ZK3) RecName: Full=Methylthioribose-1-phosphate isomerase; ... 51 2e-04
BC155626_1(BC155626|pid:none) Danio rerio zgc:172216, mRNA (cDNA... 50 2e-04
CU633871_13(CU633871|pid:none) Podospora anserina genomic DNA ch... 50 4e-04
CP000504_657(CP000504|pid:none) Pyrobaculum islandicum DSM 4184,... 50 4e-04
AM420293_3527(AM420293|pid:none) Saccharopolyspora erythraea NRR... 50 4e-04
AM494972_518(AM494972|pid:none) Leishmania braziliensis chromoso... 49 5e-04
AM494949_2(AM494949|pid:none) Leishmania braziliensis chromosome... 49 5e-04
(Q8R9L7) RecName: Full=Methylthioribose-1-phosphate isomerase; ... 49 6e-04
AM502254_74(AM502254|pid:none) Leishmania infantum chromosome 36. 49 6e-04
AM114193_875(AM114193|pid:none) Uncultured methanogenic archaeon... 49 6e-04
AE009951_1986(AE009951|pid:none) Fusobacterium nucleatum subsp. ... 49 8e-04
AE010299_76(AE010299|pid:none) Methanosarcina acetivorans str. C... 48 0.001
(B2A5S2) RecName: Full=Methylthioribose-1-phosphate isomerase; ... 48 0.001
AM502228_173(AM502228|pid:none) Leishmania infantum chromosome 10. 48 0.001
BT081094_1(BT081094|pid:none) Caligus clemensi clone ccle-evs-50... 48 0.001
(A5G9J7) RecName: Full=Methylthioribose-1-phosphate isomerase; ... 48 0.001
AE008384_1371(AE008384|pid:none) Methanosarcina mazei strain Goe... 48 0.001
(Q47AR7) RecName: Full=Methylthioribose-1-phosphate isomerase; ... 47 0.002
CP001338_2418(CP001338|pid:none) Candidatus Methanosphaerula pal... 46 0.004
CT978603_2012(CT978603|pid:none) Synechococcus sp. RCC307 genomi... 45 0.011
EU974711_1(EU974711|pid:none) Zea mays clone 456598 unknown mRNA. 44 0.015
CR954213_99(CR954213|pid:none) Ostreococcus tauri strain OTTH059... 44 0.015
CP001087_509(CP001087|pid:none) Desulfobacterium autotrophicum H... 44 0.019
(Q8KBH1) RecName: Full=Methylthioribose-1-phosphate isomerase; ... 44 0.025
(Q92TI2) RecName: Full=Methylthioribose-1-phosphate isomerase; ... 43 0.033
AP006840_816(AP006840|pid:none) Symbiobacterium thermophilum IAM... 43 0.043
CP000492_679(CP000492|pid:none) Chlorobium phaeobacteroides DSM ... 42 0.056
AX118853_1(AX118853|pid:none) Sequence 17 from Patent WO0129221. 42 0.073
(A5FUV7) RecName: Full=Methylthioribose-1-phosphate isomerase; ... 42 0.073
CP001322_3734(CP001322|pid:none) Desulfatibacillum alkenivorans ... 42 0.073
CP000096_472(CP000096|pid:none) Pelodictyon luteolum DSM 273, co... 42 0.073
F72745(F72745)hypothetical protein APE0493 - Aeropyrum pernix (s... 42 0.096
CP001097_1736(CP001097|pid:none) Chlorobium limicola DSM 245, co... 42 0.096
BT066464_1(BT066464|pid:none) Zea mays full-length cDNA clone ZM... 41 0.13
CP000607_525(CP000607|pid:none) Chlorobium phaeovibrioides DSM 2... 41 0.13
CR382124_643(CR382124|pid:none) Kluyveromyces lactis strain NRRL... 41 0.16
CU928161_4672(CU928161|pid:none) Escherichia coli S88 chromosome... 41 0.16
(A6X8E9) RecName: Full=Methylthioribose-1-phosphate isomerase; ... 40 0.21
CP001280_3274(CP001280|pid:none) Methylocella silvestris BL2, co... 40 0.21
BA000030_6665(BA000030|pid:none) Streptomyces avermitilis MA-468... 40 0.21
(A6ULQ4) RecName: Full=Methylthioribose-1-phosphate isomerase; ... 40 0.28
CP000435_2431(CP000435|pid:none) Synechococcus sp. CC9311, compl... 40 0.36
(Q5FQK0) RecName: Full=Methylthioribose-1-phosphate isomerase; ... 40 0.36
AE017349_276(AE017349|pid:none) Cryptococcus neoformans var. neo... 39 0.48
CP001150_702(CP001150|pid:none) Rhodobacter sphaeroides KD131 ch... 39 0.62
(A8ZYA5) RecName: Full=Methylthioribose-1-phosphate isomerase; ... 39 0.62
CP001581_317(CP001581|pid:none) Clostridium botulinum A2 str. Ky... 39 0.62
CP001110_1921(CP001110|pid:none) Pelodictyon phaeoclathratiforme... 39 0.81
CP000250_4668(CP000250|pid:none) Rhodopseudomonas palustris HaA2... 38 1.1
BX572608_174(BX572608|pid:none) Rhodopseudomonas palustris CGA00... 38 1.1
CP001096_5230(CP001096|pid:none) Rhodopseudomonas palustris TIE-... 38 1.1
CP000394_1394(CP000394|pid:none) Granulibacter bethesdensis CGDN... 38 1.4
BA000040_961(BA000040|pid:none) Bradyrhizobium japonicum USDA 11... 38 1.4
CP000774_2238(CP000774|pid:none) Parvibaculum lavamentivorans DS... 37 2.4
CT971583_2144(CT971583|pid:none) Synechococcus WH7803 complete g... 37 2.4
CP000283_4383(CP000283|pid:none) Rhodopseudomonas palustris BisB... 37 2.4
CU234118_6521(CU234118|pid:none) Bradyrhizobium sp. ORS278,compl... 37 3.1
CP001032_4095(CP001032|pid:none) Opitutus terrae PB90-1, complet... 36 4.0
CP000301_4879(CP000301|pid:none) Rhodopseudomonas palustris BisB... 36 4.0
CP000494_611(CP000494|pid:none) Bradyrhizobium sp. BTAi1, comple... 36 4.0
AJ310105_1(AJ310105|pid:none) Sugarcane mosaic virus genomic RNA... 36 5.2
AM889285_2233(AM889285|pid:none) Gluconacetobacter diazotrophicu... 36 5.3
BX548175_2453(BX548175|pid:none) Prochlorococcus marinus MIT9313... 36 5.3
AP007255_4123(AP007255|pid:none) Magnetospirillum magneticum AMB... 36 5.3
CP000230_360(CP000230|pid:none) Rhodospirillum rubrum ATCC 11170... 36 5.3
CP001133_361(CP001133|pid:none) Vibrio fischeri MJ11 chromosome ... 35 9.0
>(Q54EY2) RecName: Full=Translation initiation factor eIF-2B subunit
beta; AltName: Full=eIF-2B GDP-GTP exchange factor
subunit beta;
Length = 388
Score = 563 bits (1451), Expect = e-159
Identities = 294/342 (85%), Positives = 294/342 (85%)
Frame = +1
Query: 706 KRSNAKSLIDQIKIIGKKLMNAXPLEFCIGNIVRRVLFIIREEYLTFFRNKKNGLNNXXX 885
K NAKSLIDQIKIIGKKLMNA PLEFCIGNIVRRVLFIIREEYLTFFRNKKNGLNN
Sbjct: 47 KWGNAKSLIDQIKIIGKKLMNAQPLEFCIGNIVRRVLFIIREEYLTFFRNKKNGLNNDDY 106
Query: 886 XXXXFETTTXXXXXXXXXXXXXXXXXXXXXXXXXXVMLXXXXXXXXXXXXFTETFPRLKA 1065
FETTT VML FTETFPRLKA
Sbjct: 107 DDDDFETTTSNNNNNNNNNNINSSSNINKNNKYSNVMLQDDPIDDQEDIDFTETFPRLKA 166
Query: 1066 AIMDSINELIDELEGLHRNVAEQAIEHIHSNETIMTLGCSRTVEEFLKEAARKRSFKVIV 1245
AIMDSINELIDELEGLHRNVAEQAIEHIHSNETIMTLGCSRTVEEFLKEAARKRSFKVIV
Sbjct: 167 AIMDSINELIDELEGLHRNVAEQAIEHIHSNETIMTLGCSRTVEEFLKEAARKRSFKVIV 226
Query: 1246 VETAPSLEGQKTAISLSKASIDTTLITDSAVFAMMSRVNKVIIGTHAVMANGGLIATSGT 1425
VETAPSLEGQKTAISLSKASIDTTLITDSAVFAMMSRVNKVIIGTHAVMANGGLIATSGT
Sbjct: 227 VETAPSLEGQKTAISLSKASIDTTLITDSAVFAMMSRVNKVIIGTHAVMANGGLIATSGT 286
Query: 1426 HTLAVAAKYHSVPIVVCTGLYKLCPLYAYDQDTFNNFGSPGEYLKFEEAEFLENVHSYNP 1605
HTLAVAAKYHSVPIVVCTGLYKLCPLYAYDQDTFNNFGSPGEYLKFEEAEFLENVHSYNP
Sbjct: 287 HTLAVAAKYHSVPIVVCTGLYKLCPLYAYDQDTFNNFGSPGEYLKFEEAEFLENVHSYNP 346
Query: 1606 TFDYVAPDLVSLFITNIGGHNPSYIYRLLQEYYDARDILEDE 1731
TFDYVAPDLVSLFITNIGGHNPSYIYRLLQEYYDARDILEDE
Sbjct: 347 TFDYVAPDLVSLFITNIGGHNPSYIYRLLQEYYDARDILEDE 388
Score = 321 bits (822), Expect = 6e-86
Identities = 171/216 (79%), Positives = 171/216 (79%)
Frame = +2
Query: 68 MEKQAEKQLEKQLESFILHLKRKTVVGSYQVSRASAELLRQWVHKGKWGNAKSLIDQIKI 247
MEKQAEKQLEKQLESFILHLKRKTVVGSYQVSRASAELLRQWVHKGKWGNAKSLIDQIKI
Sbjct: 1 MEKQAEKQLEKQLESFILHLKRKTVVGSYQVSRASAELLRQWVHKGKWGNAKSLIDQIKI 60
Query: 248 IGKKLMNAQPLEFCIGNIVRRVLFIIREEYLTFFRNKKNGLNNXXXXXXXFETTTXXXXX 427
IGKKLMNAQPLEFCIGNIVRRVLFIIREEYLTFFRNKKNGLNN FETTT
Sbjct: 61 IGKKLMNAQPLEFCIGNIVRRVLFIIREEYLTFFRNKKNGLNNDDYDDDDFETTTSNNNN 120
Query: 428 XXXXXXXXXXXXXXXXXXXXXVMLXXXXXXXXXXXXFTETFPRLKAAIMDSINELIDELE 607
VML FTETFPRLKAAIMDSINELIDELE
Sbjct: 121 NNNNNNINSSSNINKNNKYSNVMLQDDPIDDQEDIDFTETFPRLKAAIMDSINELIDELE 180
Query: 608 GLHRNVAEQAIEHIHSNETIMTLGCSRTVEEFLKEA 715
GLHRNVAEQAIEHIHSNETIMTLGCSRTVEEFLKEA
Sbjct: 181 GLHRNVAEQAIEHIHSNETIMTLGCSRTVEEFLKEA 216
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3236559
Number of Hits to DB: 1,957,861,965
Number of extensions: 33310867
Number of successful extensions: 90669
Number of sequences better than 10.0: 401
Number of HSP's gapped: 90244
Number of HSP's successfully gapped: 516
Length of query: 595
Length of database: 1,051,180,864
Length adjustment: 134
Effective length of query: 461
Effective length of database: 617,481,958
Effective search space: 284659182638
Effective search space used: 284659182638
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 32 (16.9 bits)
|
| PSORT |
|
| VS (DIR, S) |
0 |
| VH (FL, L) |
0 |
| VF (FL, S) |
0 |
| AH (FL, L) |
0 |
| AF (FL, S) |
0 |
| SL (DIR, L) |
0 |
| SS (DIR, S) |
2 |
| SH (FL, L) |
0 |
| SF (FL, S) |
1 |
| CH (FL, L) |
1 |
| CF (FL, S) |
0 |
| FCL (DIR, L) |
0 |
| FC (DIR, S) |
0 |
| FC-IC (SUB) |
0 |