| Homology vs DNA |
 Query= Contig-U15022-1 (Contig-U15022-1Q) /CSM_Contig/Contig-U15022-1Q.Seq.d
(1472 letters)
Database: ddbj_A
92,845,959 sequences; 95,242,211,685 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value N
(BJ434204) Dictyostelium discoideum cDNA clone:ddv16n06, 3' ... 1203 0.0 1
(BJ346101) Dictyostelium discoideum cDNA clone:dda29i04, 3' ... 1193 0.0 2
(BJ432323) Dictyostelium discoideum cDNA clone:ddv18i10, 3' ... 1178 0.0 2
(BJ401667) Dictyostelium discoideum cDNA clone:dds19c05, 3' ... 1066 0.0 1
(BJ402272) Dictyostelium discoideum cDNA clone:dds16f06, 3' ... 1059 0.0 1
(BJ345247) Dictyostelium discoideum cDNA clone:dda23i03, 3' ... 1049 0.0 2
(BJ415778) Dictyostelium discoideum cDNA clone:ddv23o15, 5' ... 987 0.0 3
(BJ328140) Dictyostelium discoideum cDNA clone:dda23i03, 5' ... 985 0.0 2
(BJ328692) Dictyostelium discoideum cDNA clone:dda29i04, 5' ... 983 0.0 2
(BJ413794) Dictyostelium discoideum cDNA clone:ddv17b01, 5' ... 971 0.0 2
(BJ414192) Dictyostelium discoideum cDNA clone:ddv18i10, 5' ... 963 0.0 2
(BJ388740) Dictyostelium discoideum cDNA clone:dds16f06, 5' ... 963 0.0 2
(BJ413554) Dictyostelium discoideum cDNA clone:ddv16n06, 5' ... 936 0.0 3
(BJ434033) Dictyostelium discoideum cDNA clone:ddv23o15, 3' ... 850 0.0 2
(BJ431905) Dictyostelium discoideum cDNA clone:ddv17b01, 3' ... 963 0.0 1
(AU061588) Dictyostelium discoideum slug cDNA, clone SLE739. 906 0.0 1
(BJ402717) Dictyostelium discoideum cDNA clone:dds17e19, 3' ... 880 0.0 1
(BJ389176) Dictyostelium discoideum cDNA clone:dds17e19, 5' ... 833 0.0 2
(AU261822) Dictyostelium discoideum vegetative cDNA clone:VS... 815 0.0 1
(BJ389507) Dictyostelium discoideum cDNA clone:dds19c05, 5' ... 777 0.0 2
(BJ435010) Dictyostelium discoideum cDNA clone:ddv25c21, 3' ... 291 4e-74 1
(C84791) Dictyostelium discoideum slug cDNA, clone SSF829. 212 3e-50 1
(EC387995) E10_E10gm1k19_pDNRf_477214 Myzus persicae, line G... 56 1e-09 3
(ES502028) BIG_AF_9845 Brine Shrimp diapaused embryos (cysts... 64 3e-07 2
(ES496160) BIG_AF_3976 Brine Shrimp Adult (20 days after hat... 64 4e-07 2
(DT970853) CLJ130-H08.x1d-t SHGC-CLJ Gasterosteus aculeatus ... 64 9e-07 2
(ES501542) BIG_AF_9359 Brine Shrimp diapaused embryos (cysts... 62 2e-06 2
(CO820630) LM_GB5_000956 Locusta migratoria gregarious phase... 60 2e-06 2
(CA792088) AGENCOURT_10315655 NICHD_XGC_Emb1 Xenopus laevis ... 48 2e-06 3
(DT990548) CLJ250-C10.x1d-t SHGC-CLJ Gasterosteus aculeatus ... 56 5e-06 3
(ES512299) BIG_AF_20116 Brine Shrimp embryos, 10 hours after... 64 2e-05 1
(BC133187) Xenopus laevis cDNA clone IMAGE:3399353. 48 2e-05 3
(CN757662) ID0AAA20AD11RM1 ApMS Acyrthosiphon pisum cDNA clo... 62 6e-05 1
(CN756480) ID0AAA18DC12RM1 ApMS Acyrthosiphon pisum cDNA clo... 62 6e-05 1
(FF292553) 279282968 Pea aphid whole body normalized full le... 62 6e-05 1
(ES407923) MUT15-G22.x1d-t SHGC-MUT Mytilus californianus cD... 36 9e-05 4
(CO838268) LM_GL5_000478 Locusta migratoria gregarious phase... 60 3e-04 1
(DV608877) EST1211873 Glossina morsitans morsitans Fat body ... 56 0.002 2
(DV619549) EST1222545 Glossina morsitans morsitans Fat body ... 56 0.002 2
(DT990549) CLJ250-C10.y1d-s SHGC-CLJ Gasterosteus aculeatus ... 56 0.002 2
(FF747990) XABT57412.fwd Gateway compatible cien cDNA librar... 46 0.003 2
(FF747989) XABT57412.rev Gateway compatible cien cDNA librar... 46 0.003 2
(BX553178) Glossina morsitans morsitans (Tseatse fly) EST fr... 56 0.004 1
(FL638126) TG_11_G12 Termite gut library Reticulitermes flav... 48 0.005 2
(BC051239) Xenopus laevis hypothetical protein MGC53517, mRN... 40 0.006 3
(CN626468) tae99b08.x1 Hydra EST Darmstadt I Hydra magnipapi... 40 0.013 2
(CN773640) taf07b03.y1 Hydra EST Darmstadt I Hydra magnipapi... 40 0.013 2
(CN626748) tae99b08.y1 Hydra EST Darmstadt I Hydra magnipapi... 40 0.013 2
(CN623951) tae57f07.y1 Hydra EST Darmstadt I Hydra magnipapi... 40 0.013 2
(CN773644) taf07b07.y1 Hydra EST Darmstadt I Hydra magnipapi... 40 0.013 2
(FF327827) 280433992 Pea aphid whole body normalized full le... 54 0.015 1
(BM959455) PLATE_12_H01_15.AB1 GS Lambda-Triplex, 10 day ger... 50 0.021 2
(ES397772) MUT15-G22.y1d-s SHGC-MUT Mytilus californianus cD... 40 0.048 2
(EX487421) HA_MX1_54g01_SP6 Lobster Multiple Tissues, Normal... 38 0.076 2
(FC071282) HA_MX1_98g05_SP6 Lobster Multiple Tissues, Normal... 38 0.077 2
(CJ392506) Molgula tectiformis cDNA, gonad clone:mtgd019l08,... 40 0.26 2
(AL894340) Xenopus tropicalis EST, clone TEgg092i06 5'. 40 0.26 2
(AL896333) Xenopus tropicalis EST, clone TEgg037b10 5'. 40 0.26 2
(AL869169) Xenopus tropicalis EST, clone TEgg131p02 5'. 40 0.26 2
(AL866838) Xenopus tropicalis EST, clone TEgg132g07 5'. 40 0.26 2
(AL871792) Xenopus tropicalis EST, clone TEgg131p03 5'. 40 0.26 2
(CX937453) JGI_CAAO5482.fwd NIH_XGC_tropTe5 Xenopus (Siluran... 40 0.32 2
(DR883991) JGI_CABM505.fwd NIH_XGC_tropTe6 Xenopus (Silurana... 40 0.33 2
(DR850399) JGI_CABE12987.fwd NIH_XGC_tropOva1 Xenopus (Silur... 40 0.33 2
(DR878252) JGI_CABI1616.fwd NIH_XGC_tropOvi1 Xenopus (Silura... 40 0.34 2
(BX736586) Xenopus tropicalis EST, clone TTpA040i07 5'. 40 0.34 2
(DR850781) JGI_CABE13188.fwd NIH_XGC_tropOva1 Xenopus (Silur... 40 0.37 2
(EV945990) rcki31_o2.y1 cki Sus scrofa cDNA 5', mRNA sequence. 38 0.50 2
(EV991544) rcol1017b_g13.y1 col Sus scrofa cDNA 5', mRNA seq... 38 0.53 2
(EW048979) rpigcb_10760.y1 cty Sus scrofa cDNA 5', mRNA sequ... 38 0.63 2
(EW164169) rfat0123_j8.y1 fat Sus scrofa cDNA 5', mRNA seque... 38 0.64 2
(BC084158) Xenopus tropicalis cDNA clone IMAGE:7003273. 40 0.65 2
(EW376471) rmcp35c_p16.y1 mcp Sus scrofa cDNA 5', mRNA seque... 38 0.71 2
(EW306316) rpldo0128_p16.y1 ldo Sus scrofa cDNA 5', mRNA seq... 38 0.74 2
(EW633186) rtes31_m18.y1 tes Sus scrofa cDNA 5', mRNA sequence. 38 0.80 2
(EH006753) PIC-A-0236 Sus Scrofa Adipocyte Zap Express Libra... 38 0.90 2
(EH007337) PIC-A-0763 Sus Scrofa Adipocyte Zap Express Libra... 38 0.91 2
(M30942) Tetrahymena thermophila isoleucyl-tRNA synthetase (... 48 0.95 1
(EU350953) Homo sapiens catenin (cadherin-associated protein... 48 0.95 1
(AC010433) Homo sapiens chromosome 5 clone CTD-2202L20, comp... 48 0.95 1
(AC162577) Bos taurus clone CH240-119O8, WORKING DRAFT SEQUE... 48 0.95 1
(EK215079) 1095460116034 Global-Ocean-Sampling_GS-31-01-01-1... 48 0.95 1
(DV608665) EST1211661 Glossina morsitans morsitans Fat body ... 48 0.95 1
(CB833187) USDA-FP_100737 Adult Alate Brown Citrus Aphid Tox... 48 0.95 1
(EK273135) 1095462266066 Global-Ocean-Sampling_GS-31-01-01-1... 36 1.1 3
(BC135439) Xenopus tropicalis hypothetical protein LOC100124... 40 1.1 2
(BM832273) K-EST0106519 S20T665307 Homo sapiens cDNA clone S... 36 1.3 2
(CU420755) Pleurobrachia pileus 5-PRIME EST from clone SQ0AA... 38 1.3 2
(BD217115) Human transferases. 36 1.4 2
(AR241602) Sequence 7 from patent US 6471959. 36 1.4 2
(BM839741) K-EST0116692 S20T665307 Homo sapiens cDNA clone S... 36 1.8 2
(AK230511) Sus scrofa mRNA, clone:AMP010004F07, expressed in... 38 2.7 2
(AK230903) Sus scrofa mRNA, clone:AMP010061H10, expressed in... 38 2.9 2
(BD217118) Human transferases. 36 3.4 2
(AR241605) Sequence 10 from patent US 6471959. 36 3.4 2
(BM713939) UI-E-EJ0-ahq-m-03-0-UI.r1 UI-E-EJ0 Homo sapiens c... 36 3.5 2
(DY363049) ZO__Ed0009N11.r ZO__Ed Zingiber officinale cDNA c... 42 3.6 2
(AC027036) Arabidopsis thaliana chromosome 1 BAC T4M14 genom... 46 3.8 1
(AC009317) Genomic sequence for Arabidopsis thaliana BAC T30... 46 3.8 1
(AB076984) Arabidopsis thaliana DNA, chromosome 1, clone:P1-... 46 3.8 1
>(BJ434204) Dictyostelium discoideum cDNA clone:ddv16n06, 3' end,
single read.
Length = 733
Score = 1203 bits (607), Expect = 0.0
Identities = 610/611 (99%)
Strand = Plus / Minus
Query: 722 ccaaatacaaactgtcatcagtgatgaagtatatgaatggatgacattcgatggtgaaga 781
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 733 ccaaatacaaactgtcatcagtgatgaagtatatgaatggatgacattcgatggtgaaga 674
Query: 782 acatcatagattcgcaacattacctggtatgtgggaaagaacaatcacaattggttcagc 841
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 673 acatcatagattcgcaacattacctggtatgtgggaaagaacaatcacaattggttcagc 614
Query: 842 tggtaaaacattttcaatcactggttggaaagtaggttggtgtatcggtccttccaatat 901
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 613 tggtaaaacattttcaatcactggttggaaagtaggttggtgtatcggtccttccaatat 554
Query: 902 cattggagcaattgcaaacactcatcaatatgtgccattcagtgtaccaacaccaactca 961
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 553 cattggagcaattgcaaacactcatcaatatgtgccattcagtgtaccaacaccaactca 494
Query: 962 agaagctgtagccatagctttggagcaaccaaatataaaagactactttaaagaattggc 1021
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 493 agaagctgtagccatagctttggagcaaccaaatataaaagactactttaaagaattggc 434
Query: 1022 aacaatgtatcaaaataaaagagatactctcttaaattcactcacccaagcaggtttaga 1081
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 433 aacaatgtatcaaaataaaagagatactctcttaaattcactcacccaagcaggtttaga 374
Query: 1082 tcctgtcatcccacaaggtacttactttatcatgggtgatacttcaagtatacacttaca 1141
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 373 tcctgtcatcccacaaggtacttactttatcatgggtgatacttcaagtatacacttaca 314
Query: 1142 aggtgatcaaggtaaagatacctcaatcactggtatgggtttacatttacgtgattggaa 1201
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 313 aggtgatcaaggtaaagatacctcaatcactggtatgggtttacatttacgtgattggaa 254
Query: 1202 tatagctcgttatttaacaactgaatatggtgtaactacaattccaccttctgctttcta 1261
|||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||
Sbjct: 253 tatagctcgttatttaacaactgaatatggtgtaactacaattccaccttctgccttcta 194
Query: 1262 ttgtgatgatcatcaaaaaatacccgaaaatttcgtacgtttcactttttgtaaagatga 1321
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 193 ttgtgatgatcatcaaaaaatacccgaaaatttcgtacgtttcactttttgtaaagatga 134
Query: 1322 tttaactttgc 1332
|||||||||||
Sbjct: 133 tttaactttgc 123
Lambda K H
1.37 0.711 1.31
Matrix: blastn matrix:1 -3
Number of Sequences: 92845959
Number of Hits to DB: 1,513,751,673
Number of extensions: 86657339
Number of successful extensions: 6558847
Number of sequences better than 10.0: 128
Length of query: 1472
Length of database: 95,242,211,685
Length adjustment: 24
Effective length of query: 1448
Effective length of database: 97,308,875,965
Effective search space: 140903252397320
Effective search space used: 140903252397320
X1: 11 (21.8 bits)
S2: 22 (44.1 bits)
|
| Homology vs Protein |
Query= Contig-U15022-1 (Contig-U15022-1Q) /CSM_Contig/Contig-U15022-1Q.Seq.d
(1472 letters)
Database: nrp_B
3,236,559 sequences; 1,051,180,864 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
(Q54KM6) RecName: Full=Kynurenine--oxoglutarate transaminase; ... 445 0.0
CR382323_8(CR382323|pid:none) Zebrafish DNA sequence from clone ... 189 3e-91
Y17462_1(Y17462|pid:none) Fugu rubripes CCBL1 gene, exons 1 to 12. 182 4e-91
(Q0P5G4) RecName: Full=Kynurenine--oxoglutarate transaminase 3; ... 191 1e-86
BC051239_1(BC051239|pid:none) Xenopus laevis hypothetical protei... 183 7e-86
AK049569_1(AK049569|pid:none) Mus musculus 7 days embryo whole b... 184 1e-85
(Q6YP21) RecName: Full=Kynurenine--oxoglutarate transaminase 3; ... 184 2e-85
AK057176_1(AK057176|pid:none) Homo sapiens cDNA FLJ32614 fis, cl... 184 2e-85
(Q7T3E5) RecName: Full=Kynurenine--oxoglutarate transaminase 3; ... 181 3e-84
BC053152_1(BC053152|pid:none) Danio rerio cysteine conjugate-bet... 181 3e-84
BC087997_1(BC087997|pid:none) Xenopus tropicalis hypothetical LO... 172 5e-84
AK297995_1(AK297995|pid:none) Homo sapiens cDNA FLJ56468 complet... 169 9e-83
(Q58FK9) RecName: Full=Kynurenine--oxoglutarate transaminase 3; ... 181 1e-82
AB220414_1(AB220414|pid:none) Macaca fascicularis mRNA, clone Qc... 166 7e-82
AK042391_1(AK042391|pid:none) Mus musculus 3 days neonate thymus... 164 9e-80
(Q8BTY1) RecName: Full=Kynurenine--oxoglutarate transaminase 1; ... 164 1e-79
AM920437_636(AM920437|pid:none) Penicillium chrysogenum Wisconsi... 162 4e-72
Z69793_5(Z69793|pid:none) Caenorhabditis elegans Cosmid R03A10, ... 160 8e-72
Z69793_6(Z69793|pid:none) Caenorhabditis elegans Cosmid R03A10, ... 160 8e-72
FJ411012_1(FJ411012|pid:none) Paecilomyces sp. J18 kynurenine am... 159 2e-71
CR382131_1175(CR382131|pid:none) Yarrowia lipolytica strain CLIB... 164 9e-71
AC010704_25(AC010704|pid:none) Arabidopsis thaliana chromosome 1... 146 3e-69
AM270078_52(AM270078|pid:none) Aspergillus niger contig An04c017... 159 5e-69
AY074320_1(AY074320|pid:none) Arabidopsis thaliana putative amin... 145 5e-69
CP000804_1167(CP000804|pid:none) Roseiflexus castenholzii DSM 13... 153 5e-69
AB206815_1(AB206815|pid:none) Hordeum vulgare IDI4 mRNA for puta... 145 5e-68
CP000774_3224(CP000774|pid:none) Parvibaculum lavamentivorans DS... 145 1e-67
AL031621_6(AL031621|pid:none) Caenorhabditis elegans Cosmid F28H... 158 2e-67
AK120288_1(AK120288|pid:none) Oryza sativa Japonica Group cDNA c... 144 5e-67
AL807372_2(AL807372|pid:none) Neurospora crassa DNA linkage grou... 153 5e-66
T23861(T23861)kynurenine-oxoglutarate transaminase (EC 2.6.1.7) ... 160 6e-66
AM502251_142(AM502251|pid:none) Leishmania infantum chromosome 33. 140 2e-65
AK119212_1(AK119212|pid:none) Oryza sativa Japonica Group cDNA c... 144 3e-65
BC033685_1(BC033685|pid:none) Homo sapiens cysteine conjugate-be... 169 4e-65
AL441992_14(AL441992|pid:none) Human DNA sequence from clone RP1... 169 4e-65
CU638743_437(CU638743|pid:none) Podospora anserina genomic DNA c... 151 1e-64
EU961638_1(EU961638|pid:none) Zea mays clone 237246 asparate ami... 136 2e-64
CP000613_3582(CP000613|pid:none) Rhodospirillum centenum SW, com... 137 2e-64
CP000394_960(CP000394|pid:none) Granulibacter bethesdensis CGDNI... 137 4e-64
CT005270_168(CT005270|pid:none) Leishmania major strain Friedlin... 134 1e-63
AM270026_16(AM270026|pid:none) Aspergillus niger contig An02c031... 142 3e-63
CP001189_1457(CP001189|pid:none) Gluconacetobacter diazotrophicu... 144 3e-63
BA000030_4524(BA000030|pid:none) Streptomyces avermitilis MA-468... 133 6e-63
EF676994_1(EF676994|pid:none) Picea sitchensis clone WS02759_L06... 135 8e-63
CU928180_448(CU928180|pid:none) Kluyveromyces thermotolerans str... 135 1e-62
CR380956_211(CR380956|pid:none) Candida glabrata strain CBS138 c... 134 1e-62
CP000009_1073(CP000009|pid:none) Gluconobacter oxydans 621H, com... 137 2e-62
AE016818_177(AE016818|pid:none) Ashbya gossypii (= Eremothecium ... 134 8e-62
CP001087_1378(CP001087|pid:none) Desulfobacterium autotrophicum ... 132 8e-62
CP000498_677(CP000498|pid:none) Pichia stipitis CBS 6054 chromos... 141 1e-61
AL845258_5(AL845258|pid:none) Mouse DNA sequence from clone RP23... 164 1e-61
CR382126_68(CR382126|pid:none) Kluyveromyces lactis strain NRRL ... 134 2e-61
CR382133_186(CR382133|pid:none) Debaryomyces hansenii strain CBS... 138 4e-61
CP000473_3572(CP000473|pid:none) Solibacter usitatus Ellin6076, ... 129 3e-60
AX063829_1(AX063829|pid:none) Sequence 111 from Patent WO0100843... 129 5e-60
CP000088_566(CP000088|pid:none) Thermobifida fusca YX, complete ... 140 6e-60
BA000035_887(BA000035|pid:none) Corynebacterium efficiens YS-314... 133 1e-59
CP000454_2485(CP000454|pid:none) Arthrobacter sp. FB24, complete... 139 6e-59
CP001096_2182(CP001096|pid:none) Rhodopseudomonas palustris TIE-... 130 4e-58
AC122168_13(AC122168|pid:none) Medicago truncatula clone mth2-4o... 128 5e-58
AM420293_6802(AM420293|pid:none) Saccharopolyspora erythraea NRR... 135 9e-58
CP000115_1234(CP000115|pid:none) Nitrobacter winogradskyi Nb-255... 128 2e-57
CU458896_838(CU458896|pid:none) Mycobacterium abscessus chromoso... 130 2e-57
CP000910_1754(CP000910|pid:none) Renibacterium salmoninarum ATCC... 128 3e-57
AP008957_4674(AP008957|pid:none) Rhodococcus erythropolis PR4 DN... 129 3e-57
CP000494_3303(CP000494|pid:none) Bradyrhizobium sp. BTAi1, compl... 125 3e-57
CU928158_2400(CU928158|pid:none) Escherichia fergusonii ATCC 354... 124 3e-57
CU234118_4439(CU234118|pid:none) Bradyrhizobium sp. ORS278,compl... 125 4e-57
CP000319_1420(CP000319|pid:none) Nitrobacter hamburgensis X14, c... 124 4e-57
CP000970_602(CP000970|pid:none) Escherichia coli SMS-3-5, comple... 124 8e-57
CP001338_1100(CP001338|pid:none) Candidatus Methanosphaerula pal... 123 1e-56
CP000964_3848(CP000964|pid:none) Klebsiella pneumoniae 342, comp... 125 2e-56
CP000800_595(CP000800|pid:none) Escherichia coli E24377A, comple... 124 2e-56
AE005674_515(AE005674|pid:none) Shigella flexneri 2a str. 301, c... 124 2e-56
AM167904_3420(AM167904|pid:none) Bordetella avium 197N complete ... 125 4e-56
CP001618_2792(CP001618|pid:none) Beutenbergia cavernae DSM 12333... 130 5e-56
AM902716_5000(AM902716|pid:none) Bordetella petrii strain DSM 12... 125 5e-56
CP000656_1666(CP000656|pid:none) Mycobacterium gilvum PYR-GCK, c... 131 8e-56
CP000301_2079(CP000301|pid:none) Rhodopseudomonas palustris BisB... 124 8e-56
CP000474_2367(CP000474|pid:none) Arthrobacter aurescens TC1, com... 131 1e-55
AE014075_663(AE014075|pid:none) Escherichia coli CFT073, complet... 124 1e-55
AP009240_668(AP009240|pid:none) Escherichia coli SE11 DNA, compl... 124 1e-55
CP000243_593(CP000243|pid:none) Escherichia coli UTI89, complete... 123 2e-55
AP008971_214(AP008971|pid:none) Finegoldia magna ATCC 29328 DNA,... 126 4e-55
AP009384_1575(AP009384|pid:none) Azorhizobium caulinodans ORS 57... 127 5e-55
CP000468_527(CP000468|pid:none) Escherichia coli APEC O1, comple... 123 5e-55
CP001341_2206(CP001341|pid:none) Arthrobacter chlorophenolicus A... 130 7e-55
CP000868_1048(CP000868|pid:none) Burkholderia multivorans ATCC 1... 125 7e-55
AP009385_2160(AP009385|pid:none) Burkholderia multivorans ATCC 1... 125 7e-55
EF086032_1(EF086032|pid:none) Picea sitchensis clone WS02714_G10... 125 9e-55
CP000880_2242(CP000880|pid:none) Salmonella enterica subsp. ariz... 124 9e-55
AP008216_884(AP008216|pid:none) Oryza sativa (japonica cultivar-... 122 1e-54
CP000653_1955(CP000653|pid:none) Enterobacter sp. 638, complete ... 128 1e-54
CP000086_1081(CP000086|pid:none) Burkholderia thailandensis E264... 124 1e-54
CP000038_522(CP000038|pid:none) Shigella sonnei Ss046, complete ... 121 2e-54
CP000759_1036(CP000759|pid:none) Ochrobactrum anthropi ATCC 4918... 127 2e-54
CP000886_2879(CP000886|pid:none) Salmonella enterica subsp. ente... 122 2e-54
CP000249_3768(CP000249|pid:none) Frankia sp. CcI3, complete geno... 124 3e-54
BX640452_105(BX640452|pid:none) Bordetella bronchiseptica strain... 122 3e-54
BX640436_239(BX640436|pid:none) Bordetella parapertussis strain ... 122 3e-54
CP001052_1335(CP001052|pid:none) Burkholderia phytofirmans PsJN ... 127 3e-54
CU459003_3892(CU459003|pid:none) Magnetospirillum gryphiswaldens... 123 3e-54
AE014613_2122(AE014613|pid:none) Salmonella enterica subsp. ente... 122 3e-54
CP000668_2819(CP000668|pid:none) Yersinia pestis Pestoides F, co... 121 4e-54
CP000526_1142(CP000526|pid:none) Burkholderia mallei SAVP1 chrom... 123 6e-54
AM286415_3084(AM286415|pid:none) Yersinia enterocolitica subsp. ... 119 6e-54
BX640422_257(BX640422|pid:none) Bordetella pertussis strain Toha... 122 8e-54
CP000720_3139(CP000720|pid:none) Yersinia pseudotuberculosis IP ... 120 8e-54
CP000440_107(CP000440|pid:none) Burkholderia ambifaria AMMD chro... 120 8e-54
EU966555_1(EU966555|pid:none) Zea mays clone 295244 kynurenine--... 120 1e-53
CP000440_2255(CP000440|pid:none) Burkholderia ambifaria AMMD chr... 123 1e-53
CP000699_4689(CP000699|pid:none) Sphingomonas wittichii RW1, com... 119 1e-53
FP236842_2735(FP236842|pid:none) Erwinia pyrifoliae strain Ep1/9... 120 1e-53
CP000267_2073(CP000267|pid:none) Rhodoferax ferrireducens T118, ... 117 1e-53
BT061080_1(BT061080|pid:none) Zea mays full-length cDNA clone ZM... 120 2e-53
CP001029_2411(CP001029|pid:none) Methylobacterium populi BJ001, ... 120 2e-53
CP000270_1260(CP000270|pid:none) Burkholderia xenovorans LB400 c... 126 2e-53
CP000480_5535(CP000480|pid:none) Mycobacterium smegmatis str. MC... 124 2e-53
CP000151_2364(CP000151|pid:none) Burkholderia sp. 383 chromosome... 124 2e-53
CP001025_2118(CP001025|pid:none) Burkholderia ambifaria MC40-6 c... 122 2e-53
CP000010_1546(CP000010|pid:none) Burkholderia mallei ATCC 23344 ... 123 2e-53
CP000511_4990(CP000511|pid:none) Mycobacterium vanbaalenii PYR-1... 120 3e-53
CP000378_1602(CP000378|pid:none) Burkholderia cenocepacia AU 105... 124 3e-53
CP001025_118(CP001025|pid:none) Burkholderia ambifaria MC40-6 ch... 120 3e-53
CU914168_977(CU914168|pid:none) Ralstonia solanacearum strain IP... 118 4e-53
CP001408_1333(CP001408|pid:none) Burkholderia pseudomallei MSHR3... 123 4e-53
CP000901_3030(CP000901|pid:none) Yersinia pestis Angola, complet... 118 4e-53
AM747720_2316(AM747720|pid:none) Burkholderia cenocepacia J2315 ... 123 4e-53
CU695239_289(CU695239|pid:none) Ralstonia solanacearum strain Mo... 117 5e-53
AL441992_16(AL441992|pid:none) Human DNA sequence from clone RP1... 162 6e-53
AM075208_43(AM075208|pid:none) Enterobacter sakazakii partial ge... 115 2e-52
AM747720_50(AM747720|pid:none) Burkholderia cenocepacia J2315 ch... 121 2e-52
CP000378_2916(CP000378|pid:none) Burkholderia cenocepacia AU 105... 120 2e-52
CP000885_1222(CP000885|pid:none) Clostridium phytofermentans ISD... 118 7e-52
CP000884_3523(CP000884|pid:none) Delftia acidovorans SPH-1, comp... 118 9e-52
CP000826_937(CP000826|pid:none) Serratia proteamaculans 568, com... 117 9e-52
AP009152_1042(AP009152|pid:none) Kocuria rhizophila DC2201 DNA, ... 124 2e-51
AP006618_632(AP006618|pid:none) Nocardia farcinica IFM 10152 DNA... 115 2e-51
CP000383_687(CP000383|pid:none) Cytophaga hutchinsonii ATCC 3340... 117 3e-51
AM260479_1093(AM260479|pid:none) Ralstonia eutropha H16 chromoso... 119 3e-51
CP001503_79(CP001503|pid:none) Burkholderia glumae BGR1 chromoso... 119 3e-51
CP001472_3233(CP001472|pid:none) Acidobacterium capsulatum ATCC ... 133 7e-51
CP001503_2862(CP001503|pid:none) Burkholderia glumae BGR1 chromo... 129 7e-51
CP001635_2684(CP001635|pid:none) Variovorax paradoxus S110 chrom... 112 2e-50
CP000512_3112(CP000512|pid:none) Acidovorax citrulli AAC00-1, co... 119 3e-50
AP009385_3080(AP009385|pid:none) Burkholderia multivorans ATCC 1... 115 4e-50
CP000352_976(CP000352|pid:none) Ralstonia metallidurans CH34, co... 119 5e-50
CP000854_4611(CP000854|pid:none) Mycobacterium marinum M, comple... 112 8e-50
CP001408_4050(CP001408|pid:none) Burkholderia pseudomallei MSHR3... 114 8e-50
CP000570_3891(CP000570|pid:none) Burkholderia pseudomallei 668 c... 114 1e-49
CP000539_1839(CP000539|pid:none) Acidovorax sp. JS42, complete g... 114 1e-49
BX571965_3412(BX571965|pid:none) Burkholderia pseudomallei strai... 114 1e-49
CP000010_2614(CP000010|pid:none) Burkholderia mallei ATCC 23344 ... 114 1e-49
CP000555_1943(CP000555|pid:none) Methylibium petroleiphilum PM1,... 112 4e-49
CP000090_1009(CP000090|pid:none) Ralstonia eutropha JMP134 chrom... 115 4e-49
AE016853_1405(AE016853|pid:none) Pseudomonas syringae pv. tomato... 116 5e-49
AL139416_3(AL139416|pid:none) Human DNA sequence from clone RP4-... 184 5e-49
CP001392_1688(CP001392|pid:none) Diaphorobacter sp. TPSY, comple... 114 7e-49
AE008923_2283(AE008923|pid:none) Xanthomonas axonopodis pv. citr... 113 7e-49
CP000926_895(CP000926|pid:none) Pseudomonas putida GB-1, complet... 111 7e-49
CU633749_1063(CU633749|pid:none) Cupriavidus taiwanensis str. LM... 114 1e-48
BT001671_1(BT001671|pid:none) Drosophila melanogaster RE50216 fu... 176 1e-48
AE016958_788(AE016958|pid:none) Mycobacterium avium subsp. parat... 114 1e-48
CP000542_4822(CP000542|pid:none) Verminephrobacter eiseniae EF01... 112 1e-48
AP008229_2025(AP008229|pid:none) Xanthomonas oryzae pv. oryzae M... 113 1e-48
CP000967_2397(CP000967|pid:none) Xanthomonas oryzae pv. oryzae P... 113 1e-48
CP000949_4294(CP000949|pid:none) Pseudomonas putida W619, comple... 109 2e-48
CP001620_406(CP001620|pid:none) Corynebacterium kroppenstedtii D... 118 3e-48
AM039952_2521(AM039952|pid:none) Xanthomonas campestris pv. vesi... 112 3e-48
CP000096_1320(CP000096|pid:none) Pelodictyon luteolum DSM 273, c... 128 3e-48
CP000521_3687(CP000521|pid:none) Acinetobacter baumannii ATCC 17... 116 3e-48
CP000270_28(CP000270|pid:none) Burkholderia xenovorans LB400 chr... 108 4e-48
CR543861_3194(CR543861|pid:none) Acinetobacter sp. ADP1 complete... 112 7e-48
AE015451_849(AE015451|pid:none) Pseudomonas putida KT2440 comple... 110 7e-48
CP000058_1271(CP000058|pid:none) Pseudomonas syringae pv. phaseo... 114 1e-47
A83171(A83171) probable aminotransferase PA3798 [imported] - Pse... 112 1e-47
AE009442_1410(AE009442|pid:none) Xylella fastidiosa Temecula1, c... 110 2e-47
CP001052_30(CP001052|pid:none) Burkholderia phytofirmans PsJN ch... 108 2e-47
CP000749_219(CP000749|pid:none) Marinomonas sp. MWYL1, complete ... 121 2e-47
CT573326_932(CT573326|pid:none) Pseudomonas entomophila str. L48... 108 3e-47
AL139416_4(AL139416|pid:none) Human DNA sequence from clone RP4-... 184 3e-47
AE008922_2179(AE008922|pid:none) Xanthomonas campestris pv. camp... 111 5e-47
CP000076_4878(CP000076|pid:none) Pseudomonas fluorescens Pf-5, c... 107 8e-47
CP000492_1669(CP000492|pid:none) Chlorobium phaeobacteroides DSM... 122 1e-46
CP000529_2155(CP000529|pid:none) Polaromonas naphthalenivorans C... 106 1e-46
CP000086_3227(CP000086|pid:none) Burkholderia thailandensis E264... 112 1e-46
AY659335_1(AY659335|pid:none) Synthetic construct Peudomonas aer... 108 2e-46
CP000655_748(CP000655|pid:none) Polynucleobacter necessarius sub... 115 2e-46
CP001108_1456(CP001108|pid:none) Prosthecochloris aestuarii DSM ... 117 2e-46
CP000941_1471(CP000941|pid:none) Xylella fastidiosa M12, complet... 106 5e-46
CP000744_1305(CP000744|pid:none) Pseudomonas aeruginosa PA7, com... 111 5e-46
CP000089_3304(CP000089|pid:none) Dechloromonas aromatica RCB, co... 105 7e-46
CP001157_3887(CP001157|pid:none) Azotobacter vinelandii DJ, comp... 110 7e-46
CP000685_9(CP000685|pid:none) Flavobacterium johnsoniae UW101, c... 108 7e-46
CP000034_499(CP000034|pid:none) Shigella dysenteriae Sd197, comp... 124 3e-45
CP000677_42(CP000677|pid:none) Novosphingobium aromaticivorans D... 103 5e-45
AE006470_1361(AE006470|pid:none) Chlorobium tepidum TLS, complet... 113 7e-45
CP000359_2054(CP000359|pid:none) Deinococcus geothermalis DSM 11... 112 9e-45
CR555306_2207(CR555306|pid:none) Azoarcus sp. EbN1 complete geno... 103 2e-44
CP001281_3119(CP001281|pid:none) Thauera sp. MZ1T, complete geno... 106 3e-44
BT079652_1(BT079652|pid:none) Esox lucius clone eluc-evq-527-375... 177 1e-42
BC055182_1(BC055182|pid:none) Danio rerio cysteine conjugate-bet... 176 1e-42
BC021262_1(BC021262|pid:none) Homo sapiens cysteine conjugate-be... 162 2e-41
CP000254_2392(CP000254|pid:none) Methanospirillum hungatei JF-1,... 100 3e-41
CP000575_99(CP000575|pid:none) Staphylothermus marinus F1, compl... 97 4e-41
AP006878_549(AP006878|pid:none) Thermococcus kodakarensis KOD1 D... 99 8e-41
CP000559_3(CP000559|pid:none) Methanocorpusculum labreanum Z, co... 96 1e-40
CP000939_2315(CP000939|pid:none) Clostridium botulinum B1 str. O... 112 3e-40
AL009126_3246(AL009126|pid:none) Bacillus subtilis subsp. subtil... 107 6e-40
CP000885_148(CP000885|pid:none) Clostridium phytofermentans ISDg... 103 6e-40
EF575997_1(EF575997|pid:none) Oryza sativa (indica cultivar-grou... 144 6e-40
CP001581_2529(CP001581|pid:none) Clostridium botulinum A2 str. K... 114 8e-40
AY809812_1(AY809812|pid:none) Schistosoma japonicum SJCHGC08757 ... 114 1e-39
CP000728_2327(CP000728|pid:none) Clostridium botulinum F str. La... 113 1e-39
BA000004_3350(BA000004|pid:none) Bacillus halodurans C-125 DNA, ... 106 1e-39
AM412317_2391(AM412317|pid:none) Clostridium botulinum A str. AT... 114 2e-39
CP001083_2514(CP001083|pid:none) Clostridium botulinum Ba4 str. ... 115 2e-39
CP000962_2374(CP000962|pid:none) Clostridium botulinum A3 str. L... 112 2e-39
CP000937_1307(CP000937|pid:none) Francisella philomiragia subsp.... 115 3e-39
CP000477_865(CP000477|pid:none) Methanosaeta thermophila PT, com... 106 4e-39
CP001071_1742(CP001071|pid:none) Akkermansia muciniphila ATCC BA... 94 4e-39
CP000924_1937(CP000924|pid:none) Thermoanaerobacter pseudethanol... 101 4e-39
CP000686_3158(CP000686|pid:none) Roseiflexus sp. RS-1, complete ... 95 4e-39
CP001398_1332(CP001398|pid:none) Thermococcus gammatolerans EJ3,... 95 4e-39
(Q9V0L2) RecName: Full=Aspartate aminotransferase; Shor... 94 7e-39
CP000922_2363(CP000922|pid:none) Anoxybacillus flavithermus WK1,... 107 1e-38
CP000688_1140(CP000688|pid:none) Dehalococcoides sp. BAV1, compl... 93 2e-38
CP000084_79(CP000084|pid:none) Candidatus Pelagibacter ubique HT... 102 2e-38
AE016877_4665(AE016877|pid:none) Bacillus cereus ATCC 14579, com... 113 2e-38
AE008691_280(AE008691|pid:none) Thermoanaerobacter tengcongensis... 94 2e-38
AJ965256_1070(AJ965256|pid:none) Dehalococcoides sp. CBDB1 compl... 92 3e-38
CP001176_4838(CP001176|pid:none) Bacillus cereus B4264, complete... 112 3e-38
G70010(G70010) probable aspartate transaminase (EC 2.6.1.1) yugH... 107 3e-38
AY596298_172(AY596298|pid:none) Haloarcula marismortui ATCC 4304... 97 6e-38
CP000227_4595(CP000227|pid:none) Bacillus cereus Q1, complete ge... 110 7e-38
A75490(A75490) probable transaminase (EC 2.6.1.-) DR0671 [simila... 93 7e-38
CP000027_1298(CP000027|pid:none) Dehalococcoides ethenogenes 195... 92 1e-37
CP000557_2839(CP000557|pid:none) Geobacillus thermodenitrificans... 99 1e-37
CP000679_1880(CP000679|pid:none) Caldicellulosiruptor saccharoly... 100 2e-37
CP001393_1346(CP001393|pid:none) Anaerocellum thermophilum DSM 6... 99 2e-37
CP000485_4217(CP000485|pid:none) Bacillus thuringiensis str. Al ... 111 2e-37
AP008231_1565(AP008231|pid:none) Synechococcus elongatus PCC 630... 94 2e-37
CP000568_748(CP000568|pid:none) Clostridium thermocellum ATCC 27... 107 5e-37
CP001186_4911(CP001186|pid:none) Bacillus cereus G9842, complete... 111 6e-37
(P23034) RecName: Full=Aspartate aminotransferase; Shor... 108 6e-37
CP000915_479(CP000915|pid:none) Francisella tularensis subsp. me... 110 1e-36
EF678202_1(EF678202|pid:none) Picea sitchensis clone WS0284_A12 ... 91 1e-36
CP000608_373(CP000608|pid:none) Francisella tularensis subsp. tu... 110 4e-36
BA000004_1695(BA000004|pid:none) Bacillus halodurans C-125 DNA, ... 110 5e-36
CP000903_4604(CP000903|pid:none) Bacillus weihenstephanensis KBA... 107 5e-36
CP001615_3000(CP001615|pid:none) Exiguobacterium sp. AT1b, compl... 102 7e-36
CP000855_569(CP000855|pid:none) Thermococcus onnurineus NA1, com... 89 7e-36
CP001337_2480(CP001337|pid:none) Chloroflexus aggregans DSM 9485... 94 7e-36
CP000613_1832(CP000613|pid:none) Rhodospirillum centenum SW, com... 100 9e-36
CP001182_2868(CP001182|pid:none) Acinetobacter baumannii AB0057,... 108 1e-35
AJ749949_1413(AJ749949|pid:none) Francisella tularensis subsp. t... 108 1e-35
CP001196_3125(CP001196|pid:none) Oligotropha carboxidovorans OM5... 100 2e-35
CP001213_1339(CP001213|pid:none) Bifidobacterium animalis subsp.... 101 2e-35
CP001078_2641(CP001078|pid:none) Clostridium botulinum E3 str. A... 96 2e-35
E84610(E84610)probable aspartate aminotransferase [imported] - A... 88 2e-35
AE010299_904(AE010299|pid:none) Methanosarcina acetivorans str. ... 102 2e-35
CP000930_625(CP000930|pid:none) Heliobacterium modesticaldum Ice... 108 2e-35
CP000155_4742(CP000155|pid:none) Hahella chejuensis KCTC 2396, c... 104 2e-35
CP001107_2920(CP001107|pid:none) Eubacterium rectale ATCC 33656,... 100 2e-35
CP001338_3(CP001338|pid:none) Candidatus Methanosphaerula palust... 95 2e-35
CP000246_684(CP000246|pid:none) Clostridium perfringens ATCC 131... 98 3e-35
BX897699_1128(BX897699|pid:none) Bartonella henselae strain Hous... 102 4e-35
AY426768_9(AY426768|pid:none) Streptomyces clavuligerus putative... 89 4e-35
AE008691_2256(AE008691|pid:none) Thermoanaerobacter tengcongensi... 94 4e-35
CP000586_251(CP000586|pid:none) Ostreococcus lucimarinus CCE9901... 107 5e-35
AE014133_1196(AE014133|pid:none) Streptococcus mutans UA159, com... 112 5e-35
CP000923_180(CP000923|pid:none) Thermoanaerobacter sp. X514, com... 94 5e-35
CP000489_932(CP000489|pid:none) Paracoccus denitrificans PD1222 ... 90 9e-35
CP001056_728(CP001056|pid:none) Clostridium botulinum B str. Ekl... 101 9e-35
CP000612_1671(CP000612|pid:none) Desulfotomaculum reducens MI-1,... 98 9e-35
BA000016_711(BA000016|pid:none) Clostridium perfringens str. 13 ... 99 1e-34
CR954206_282(CR954206|pid:none) Ostreococcus tauri strain OTTH05... 109 2e-34
CP000232_1161(CP000232|pid:none) Moorella thermoacetica ATCC 390... 92 2e-34
CP001638_1880(CP001638|pid:none) Geobacillus sp. WCH70, complete... 110 2e-34
CP001078_688(CP001078|pid:none) Clostridium botulinum E3 str. Al... 98 3e-34
AC087182_26(AC087182|pid:none) Oryza sativa chromosome 10 BAC OS... 116 3e-34
CP000817_2004(CP000817|pid:none) Lysinibacillus sphaericus C3-41... 104 3e-34
CP000922_1125(CP000922|pid:none) Anoxybacillus flavithermus WK1,... 105 3e-34
CP000776_867(CP000776|pid:none) Campylobacter hominis ATCC BAA-3... 102 3e-34
AM398681_404(AM398681|pid:none) Flavobacterium psychrophilum JIP... 95 5e-34
CP000557_2072(CP000557|pid:none) Geobacillus thermodenitrificans... 105 5e-34
(Q59228) RecName: Full=Aspartate aminotransferase; Shor... 105 5e-34
AP010904_2794(AP010904|pid:none) Desulfovibrio magneticus RS-1 D... 105 5e-34
CP000612_3142(CP000612|pid:none) Desulfotomaculum reducens MI-1,... 86 6e-34
CP000474_2844(CP000474|pid:none) Arthrobacter aurescens TC1, com... 88 8e-34
CP000471_690(CP000471|pid:none) Magnetococcus sp. MC-1, complete... 97 8e-34
CP001022_2263(CP001022|pid:none) Exiguobacterium sibiricum 255-1... 94 8e-34
AE001437_1797(AE001437|pid:none) Clostridium acetobutylicum ATCC... 102 1e-33
CP000860_2100(CP000860|pid:none) Candidatus Desulforudis audaxvi... 86 1e-33
AE015928_2415(AE015928|pid:none) Bacteroides thetaiotaomicron VP... 100 1e-33
CP000159_913(CP000159|pid:none) Salinibacter ruber DSM 13855, co... 85 2e-33
CP001033_1530(CP001033|pid:none) Streptococcus pneumoniae CGSP14... 111 2e-33
(O67781) RecName: Full=Aspartate aminotransferase; Shor... 96 2e-33
CP000721_4069(CP000721|pid:none) Clostridium beijerinckii NCIMB ... 92 2e-33
CR936257_830(CR936257|pid:none) Natronomonas pharaonis DSM 2160 ... 90 2e-33
CP000936_1515(CP000936|pid:none) Streptococcus pneumoniae Hungar... 111 3e-33
CP000685_1741(CP000685|pid:none) Flavobacterium johnsoniae UW101... 94 3e-33
CP000909_1868(CP000909|pid:none) Chloroflexus aurantiacus J-10-f... 91 3e-33
CP000562_3(CP000562|pid:none) Methanoculleus marisnigri JR1, com... 89 3e-33
CP000560_2733(CP000560|pid:none) Bacillus amyloliquefaciens FZB4... 100 3e-33
(Q02635) RecName: Full=Aspartate aminotransferase A; Sh... 96 4e-33
AE005673_1525(AE005673|pid:none) Caulobacter crescentus CB15, co... 95 4e-33
CP000853_1519(CP000853|pid:none) Alkaliphilus oremlandii OhILAs,... 102 4e-33
CP001615_747(CP001615|pid:none) Exiguobacterium sp. AT1b, comple... 94 4e-33
CP000485_3439(CP000485|pid:none) Bacillus thuringiensis str. Al ... 91 4e-33
AP009049_1346(AP009049|pid:none) Clostridium kluyveri NBRC 12016... 103 5e-33
CP000673_1406(CP000673|pid:none) Clostridium kluyveri DSM 555, c... 103 5e-33
CP000159_1290(CP000159|pid:none) Salinibacter ruber DSM 13855, c... 94 5e-33
BX897700_895(BX897700|pid:none) Bartonella quintana str. Toulous... 101 6e-33
CP000738_2205(CP000738|pid:none) Sinorhizobium medicae WSM419, c... 96 6e-33
CP001101_1059(CP001101|pid:none) Chlorobium phaeobacteroides BS1... 89 6e-33
AE015927_1145(AE015927|pid:none) Clostridium tetani E88, complet... 96 6e-33
CP000107_325(CP000107|pid:none) Ehrlichia canis str. Jake, compl... 93 6e-33
CP000919_1373(CP000919|pid:none) Streptococcus pneumoniae JJA, c... 110 6e-33
AM180088_1696(AM180088|pid:none) Haloquadratum walsbyi DSM 16790... 88 6e-33
CP000721_4236(CP000721|pid:none) Clostridium beijerinckii NCIMB ... 88 8e-33
AE007317_1398(AE007317|pid:none) Streptococcus pneumoniae R6, co... 110 8e-33
CP001015_1455(CP001015|pid:none) Streptococcus pneumoniae G54, c... 110 8e-33
CP000675_92(CP000675|pid:none) Legionella pneumophila str. Corby... 102 8e-33
AE016877_3819(AE016877|pid:none) Bacillus cereus ATCC 14579, com... 87 8e-33
CP000514_1016(CP000514|pid:none) Marinobacter aquaeolei VT8, com... 96 1e-32
CP000024_790(CP000024|pid:none) Streptococcus thermophilus CNRZ1... 111 1e-32
CP001022_1738(CP001022|pid:none) Exiguobacterium sibiricum 255-1... 89 1e-32
CP000759_1267(CP000759|pid:none) Ochrobactrum anthropi ATCC 4918... 89 1e-32
CP000568_359(CP000568|pid:none) Clostridium thermocellum ATCC 27... 86 1e-32
CP001365_1375(CP001365|pid:none) Halorubrum lacusprofundi ATCC 4... 87 1e-32
CP000578_91(CP000578|pid:none) Rhodobacter sphaeroides ATCC 1702... 87 1e-32
CP000144_453(CP000144|pid:none) Rhodobacter sphaeroides 2.4.1 ch... 86 1e-32
CP000453_1080(CP000453|pid:none) Alkalilimnicola ehrlichii MLHE-... 97 1e-32
BT043133_1(BT043133|pid:none) Zea mays full-length cDNA clone ZM... 84 2e-32
CP001151_504(CP001151|pid:none) Rhodobacter sphaeroides KD131 ch... 86 2e-32
AY596297_3081(AY596297|pid:none) Haloarcula marismortui ATCC 430... 86 2e-32
CP000921_1363(CP000921|pid:none) Streptococcus pneumoniae Taiwan... 108 2e-32
CP000409_84(CP000409|pid:none) Rickettsia canadensis str. McKiel... 94 3e-32
CP000250_1295(CP000250|pid:none) Rhodopseudomonas palustris HaA2... 97 3e-32
AE008692_342(AE008692|pid:none) Zymomonas mobilis subsp. mobilis... 96 3e-32
AM236084_432(AM236084|pid:none) Rhizobium leguminosarum bv. vici... 89 3e-32
AE017196_919(AE017196|pid:none) Wolbachia endosymbiont of Drosop... 90 3e-32
CP000112_513(CP000112|pid:none) Desulfovibrio desulfuricans G20,... 94 3e-32
AE016879_3888(AE016879|pid:none) Bacillus anthracis str. Ames, c... 88 3e-32
CP000661_2037(CP000661|pid:none) Rhodobacter sphaeroides ATCC 17... 84 4e-32
CP000394_715(CP000394|pid:none) Granulibacter bethesdensis CGDNI... 97 4e-32
CR628336_85(CR628336|pid:none) Legionella pneumophila str. Paris... 102 4e-32
EU965394_1(EU965394|pid:none) Zea mays clone 285734 aspartate am... 84 5e-32
CR626927_3756(CR626927|pid:none) Bacteroides fragilis NCTC 9343,... 101 5e-32
AE008384_2368(AE008384|pid:none) Methanosarcina mazei strain Goe... 92 5e-32
AP008937_1051(AP008937|pid:none) Lactobacillus fermentum IFO 395... 94 5e-32
CP001172_907(CP001172|pid:none) Acinetobacter baumannii AB307-02... 108 5e-32
CP000158_2911(CP000158|pid:none) Hyphomonas neptunium ATCC 15444... 91 7e-32
CP001341_2671(CP001341|pid:none) Arthrobacter chlorophenolicus A... 84 7e-32
AP006841_595(AP006841|pid:none) Bacteroides fragilis YCH46 DNA, ... 99 7e-32
CP000284_1316(CP000284|pid:none) Methylobacillus flagellatus KT,... 98 7e-32
CR937008_13(CR937008|pid:none) uncultured archaeon clone fos0128... 90 7e-32
CR628337_73(CR628337|pid:none) Legionella pneumophila str. Lens ... 101 7e-32
CP001217_679(CP001217|pid:none) Helicobacter pylori P12, complet... 104 7e-32
AY150561_1(AY150561|pid:none) Wolbachia endosymbiont of Tunga pe... 87 7e-32
CP000099_3025(CP000099|pid:none) Methanosarcina barkeri str. Fus... 88 7e-32
CP000362_3622(CP000362|pid:none) Roseobacter denitrificans OCh 1... 96 9e-32
CP000140_3398(CP000140|pid:none) Parabacteroides distasonis ATCC... 95 9e-32
(P53001) RecName: Full=Aspartate aminotransferase; Shor... 99 9e-32
CP001176_3957(CP001176|pid:none) Bacillus cereus B4264, complete... 86 9e-32
CP001186_4027(CP001186|pid:none) Bacillus cereus G9842, complete... 83 9e-32
(O33822) RecName: Full=Aspartate aminotransferase; Shor... 81 9e-32
CP001562_490(CP001562|pid:none) Bartonella grahamii as4aup, comp... 93 1e-31
CP001114_1609(CP001114|pid:none) Deinococcus deserti VCD115, com... 81 1e-31
AM711867_2819(AM711867|pid:none) Clavibacter michiganensis subsp... 85 2e-31
CP000698_2461(CP000698|pid:none) Geobacter uraniireducens Rf4, c... 92 2e-31
AM778862_4(AM778862|pid:none) Microcystis aeruginosa PCC 7806 ge... 82 2e-31
CP000477_1283(CP000477|pid:none) Methanosaeta thermophila PT, co... 82 2e-31
CU695240_714(CU695240|pid:none) Ralstonia solanacearum strain Mo... 86 2e-31
CP000136_186(CP000136|pid:none) Rhizobium etli CFN 42 plasmid p4... 88 2e-31
CP001147_335(CP001147|pid:none) Thermodesulfovibrio yellowstonii... 91 2e-31
CP000407_605(CP000407|pid:none) Streptococcus suis 05ZYH33, comp... 109 2e-31
CP000697_731(CP000697|pid:none) Acidiphilium cryptum JF-5, compl... 94 3e-31
CP000267_867(CP000267|pid:none) Rhodoferax ferrireducens T118, c... 86 3e-31
CP000108_1418(CP000108|pid:none) Chlorobium chlorochromatii CaD3... 89 3e-31
AY834753_2(AY834753|pid:none) Cystobacter fuscus cystothiazole A... 92 3e-31
AE001439_611(AE001439|pid:none) Helicobacter pylori J99, complet... 103 3e-31
CP000595_56(CP000595|pid:none) Ostreococcus lucimarinus CCE9901 ... 81 3e-31
CP000733_1402(CP000733|pid:none) Coxiella burnetii Dugway 5J108-... 92 3e-31
CP001096_4736(CP001096|pid:none) Rhodopseudomonas palustris TIE-... 94 3e-31
CP000450_1045(CP000450|pid:none) Nitrosomonas eutropha C91, comp... 103 3e-31
CP000264_4126(CP000264|pid:none) Jannaschia sp. CCS1, complete g... 87 3e-31
CU234118_5656(CU234118|pid:none) Bradyrhizobium sp. ORS278,compl... 96 4e-31
CP001612_99(CP001612|pid:none) Rickettsia africae ESF-5, complet... 94 4e-31
AE000511_664(AE000511|pid:none) Helicobacter pylori 26695, compl... 102 4e-31
AP008230_1302(AP008230|pid:none) Desulfitobacterium hafniense Y5... 88 4e-31
AL646052_1097(AL646052|pid:none) Ralstonia solanacearum GMI1000 ... 81 6e-31
CP000830_758(CP000830|pid:none) Dinoroseobacter shibae DFL 12, c... 94 6e-31
AM849034_2571(AM849034|pid:none) Clavibacter michiganensis subsp... 84 7e-31
(Q1RGV0) RecName: Full=Aspartate aminotransferase; Shor... 97 7e-31
CP001173_615(CP001173|pid:none) Helicobacter pylori G27, complet... 102 7e-31
AE010299_1347(AE010299|pid:none) Methanosarcina acetivorans str.... 88 7e-31
AE016828_445(AE016828|pid:none) Coxiella burnetii RSA 493, compl... 91 1e-30
CP000638_498(CP000638|pid:none) Agrobacterium vitis S4 plasmid p... 84 1e-30
CP000890_548(CP000890|pid:none) Coxiella burnetii RSA 331, compl... 91 1e-30
A69516(A69516) probable aspartate transaminase (EC 2.6.1.1) aspB... 81 1e-30
AL441992_17(AL441992|pid:none) Human DNA sequence from clone RP1... 137 1e-30
CP001227_340(CP001227|pid:none) Rickettsia peacockii str. Rustic... 93 1e-30
CP001275_1249(CP001275|pid:none) Thermomicrobium roseum DSM 5159... 83 1e-30
CP000319_1048(CP000319|pid:none) Nitrobacter hamburgensis X14, c... 92 2e-30
AE008691_1273(AE008691|pid:none) Thermoanaerobacter tengcongensi... 112 2e-30
AE016879_1446(AE016879|pid:none) Bacillus anthracis str. Ames, c... 101 2e-30
AE017333_2261(AE017333|pid:none) Bacillus licheniformis DSM 13, ... 99 2e-30
CR954216_69(CR954216|pid:none) Ostreococcus tauri strain OTTH059... 81 2e-30
CP000683_80(CP000683|pid:none) Rickettsia massiliae MTU5, comple... 93 2e-30
(Q92JE7) RecName: Full=Aspartate aminotransferase; Shor... 92 2e-30
CP000232_1458(CP000232|pid:none) Moorella thermoacetica ATCC 390... 94 2e-30
AF035157_1(AF035157|pid:none) Lactococcus lactis aspartate amino... 101 2e-30
CP000560_1293(CP000560|pid:none) Bacillus amyloliquefaciens FZB4... 82 2e-30
FJ390324_1(FJ390324|pid:none) Wolbachia endosymbiont of Triboliu... 86 2e-30
CP001327_86(CP001327|pid:none) Micromonas sp. RCC299 chromosome ... 81 3e-30
BA000030_4914(BA000030|pid:none) Streptomyces avermitilis MA-468... 89 3e-30
(Q4J8X2) RecName: Full=Aspartate aminotransferase; Shor... 97 3e-30
CP000628_2378(CP000628|pid:none) Agrobacterium radiobacter K84 c... 91 3e-30
AM181176_3104(AM181176|pid:none) Pseudomonas fluorescens SBW25 c... 82 3e-30
CP000825_756(CP000825|pid:none) Prochlorococcus marinus str. MIT... 103 3e-30
CP000968_1192(CP000968|pid:none) Candidatus Korarchaeum cryptofi... 86 3e-30
CP000939_1952(CP000939|pid:none) Clostridium botulinum B1 str. O... 82 3e-30
AF180145_13(AF180145|pid:none) Zymomonas mobilis GTP-binding pro... 97 4e-30
(Q68XV9) RecName: Full=Aspartate aminotransferase; Shor... 88 4e-30
CP000903_3737(CP000903|pid:none) Bacillus weihenstephanensis KBA... 85 4e-30
BA000028_1391(BA000028|pid:none) Oceanobacillus iheyensis HTE831... 87 4e-30
AE008257_2(AE008257|pid:none) Agrobacterium tumefaciens str. C58... 80 5e-30
CP000524_918(CP000524|pid:none) Bartonella bacilliformis KC583, ... 95 5e-30
CP000143_2374(CP000143|pid:none) Rhodobacter sphaeroides 2.4.1 c... 90 5e-30
CP001032_2828(CP001032|pid:none) Opitutus terrae PB90-1, complet... 88 5e-30
AJ248287_53(AJ248287|pid:none) Pyrococcus abyssi complete genome... 87 5e-30
CP001037_178(CP001037|pid:none) Nostoc punctiforme PCC 73102, co... 80 5e-30
CP001291_4668(CP001291|pid:none) Cyanothece sp. PCC 7424, comple... 86 5e-30
CP000096_1159(CP000096|pid:none) Pelodictyon luteolum DSM 273, c... 84 5e-30
CP001367_252(CP001367|pid:none) Halorubrum lacusprofundi ATCC 49... 80 5e-30
BA000040_7416(BA000040|pid:none) Bradyrhizobium japonicum USDA 1... 91 6e-30
CP000449_2145(CP000449|pid:none) Maricaulis maris MCS10, complet... 95 6e-30
CP001150_2126(CP001150|pid:none) Rhodobacter sphaeroides KD131 c... 89 6e-30
CP000908_2037(CP000908|pid:none) Methylobacterium extorquens PA1... 87 6e-30
CP001510_1882(CP001510|pid:none) Methylobacterium extorquens AM1... 87 6e-30
CP000360_568(CP000360|pid:none) Acidobacteria bacterium Ellin345... 87 6e-30
CP000387_1311(CP000387|pid:none) Streptococcus sanguinis SK36, c... 104 6e-30
CP000425_1866(CP000425|pid:none) Lactococcus lactis subsp. cremo... 100 6e-30
CP000076_4952(CP000076|pid:none) Pseudomonas fluorescens Pf-5, c... 84 6e-30
AM412317_2003(AM412317|pid:none) Clostridium botulinum A str. AT... 82 6e-30
CR936257_2002(CR936257|pid:none) Natronomonas pharaonis DSM 2160... 81 6e-30
CP000356_170(CP000356|pid:none) Sphingopyxis alaskensis RB2256, ... 99 8e-30
CP000874_163(CP000874|pid:none) Rhizobium sp. NGR234 plasmid pNG... 79 8e-30
AE016877_1415(AE016877|pid:none) Bacillus cereus ATCC 14579, com... 99 8e-30
CP000233_298(CP000233|pid:none) Lactobacillus salivarius UCC118,... 96 8e-30
CP000359_1614(CP000359|pid:none) Deinococcus geothermalis DSM 11... 82 8e-30
CP000661_406(CP000661|pid:none) Rhodobacter sphaeroides ATCC 170... 90 1e-29
CP001298_2219(CP001298|pid:none) Methylobacterium chloromethanic... 87 1e-29
CP001032_3723(CP001032|pid:none) Opitutus terrae PB90-1, complet... 94 1e-29
DQ489736_653(DQ489736|pid:none) Leuconostoc citreum KM20, comple... 82 1e-29
DQ235294_1(DQ235294|pid:none) Wolbachia pipientis strain wRi asp... 89 1e-29
CP001029_1997(CP001029|pid:none) Methylobacterium populi BJ001, ... 85 1e-29
CP000847_126(CP000847|pid:none) Rickettsia akari str. Hartford, ... 89 1e-29
CP001176_1471(CP001176|pid:none) Bacillus cereus B4264, complete... 99 1e-29
CP001339_1737(CP001339|pid:none) Thioalkalivibrio sp. HL-EbGR7, ... 94 1e-29
DQ235291_1(DQ235291|pid:none) Wolbachia pipientis strain wMel as... 89 1e-29
AL939120_234(AL939120|pid:none) Streptomyces coelicolor A3(2) co... 87 2e-29
AC2846(AC2846) aspartate aminotransferase A [imported] - Agrobac... 95 2e-29
AL954747_786(AL954747|pid:none) Nitrosomonas europaea ATCC 19718... 98 2e-29
CP000923_1583(CP000923|pid:none) Thermoanaerobacter sp. X514, co... 103 2e-29
CP000361_900(CP000361|pid:none) Arcobacter butzleri RM4018, comp... 98 2e-29
CP001344_3782(CP001344|pid:none) Cyanothece sp. PCC 7425, comple... 82 2e-29
CP000728_1970(CP000728|pid:none) Clostridium botulinum F str. La... 81 2e-29
AE004437_390(AE004437|pid:none) Halobacterium sp. NRC-1, complet... 77 2e-29
CP001635_312(CP001635|pid:none) Variovorax paradoxus S110 chromo... 83 2e-29
CP000512_3814(CP000512|pid:none) Acidovorax citrulli AAC00-1, co... 85 2e-29
CP000252_1599(CP000252|pid:none) Syntrophus aciditrophicus SB, c... 91 2e-29
BX842647_227(BX842647|pid:none) Bdellovibrio bacteriovorus compl... 87 2e-29
AM181176_3940(AM181176|pid:none) Pseudomonas fluorescens SBW25 c... 79 2e-29
CP000903_1448(CP000903|pid:none) Bacillus weihenstephanensis KBA... 101 2e-29
CP000813_1274(CP000813|pid:none) Bacillus pumilus SAFR-032, comp... 91 2e-29
CP000117_2121(CP000117|pid:none) Anabaena variabilis ATCC 29413,... 78 2e-29
AE2412(AE2412) aspartate aminotransferase [imported] - Nostoc sp... 78 2e-29
AP009493_2877(AP009493|pid:none) Streptomyces griseus subsp. gri... 89 3e-29
CP000133_2958(CP000133|pid:none) Rhizobium etli CFN 42, complete... 94 3e-29
CP000505_81(CP000505|pid:none) Thermofilum pendens Hrk 5, comple... 97 3e-29
CP000725_1256(CP000725|pid:none) Streptococcus gordonii str. Cha... 99 3e-29
DQ235303_1(DQ235303|pid:none) Wolbachia pipientis strain wSh asp... 89 3e-29
CP000633_2298(CP000633|pid:none) Agrobacterium vitis S4 chromoso... 94 4e-29
CP001349_1896(CP001349|pid:none) Methylobacterium nodulans ORS 2... 88 4e-29
AE005176_1830(AE005176|pid:none) Lactococcus lactis subsp. lacti... 100 4e-29
AP009179_1362(AP009179|pid:none) Sulfurovum sp. NBC37-1 genomic ... 98 4e-29
CP001099_1222(CP001099|pid:none) Chlorobaculum parvum NCIB 8327,... 85 5e-29
CP000633_784(CP000633|pid:none) Agrobacterium vitis S4 chromosom... 83 5e-29
AE016830_1597(AE016830|pid:none) Enterococcus faecalis V583, com... 83 5e-29
CP001365_1305(CP001365|pid:none) Halorubrum lacusprofundi ATCC 4... 88 5e-29
AE004437_488(AE004437|pid:none) Halobacterium sp. NRC-1, complet... 77 5e-29
DQ235301_1(DQ235301|pid:none) Wolbachia pipientis strain wYak as... 89 5e-29
AM181176_2181(AM181176|pid:none) Pseudomonas fluorescens SBW25 c... 83 7e-29
CP001189_3169(CP001189|pid:none) Gluconacetobacter diazotrophicu... 90 7e-29
CP000301_4069(CP000301|pid:none) Rhodopseudomonas palustris BisB... 90 7e-29
AE006470_956(AE006470|pid:none) Chlorobium tepidum TLS, complete... 82 7e-29
AE009950_522(AE009950|pid:none) Pyrococcus furiosus DSM 3638, co... 91 7e-29
>(Q54KM6) RecName: Full=Kynurenine--oxoglutarate transaminase;
EC=2.6.1.7; AltName: Full=Kynurenine
aminotransferase; AltName:
Full=Glutamine--phenylpyruvate transaminase;
EC=2.6.1.64; AltName: Full=Glutamine transaminase K;
EC=4.4.1.13;
Length = 435
Score = 445 bits (1144), Expect(2) = 0.0
Identities = 223/223 (100%), Positives = 223/223 (100%)
Frame = +2
Query: 62 MLRNTVKRLMTYTFKPSKQTSSFGPSVWLEFSPLAIKYNAVNLGQGFPNFEPPKFVKDAM 241
MLRNTVKRLMTYTFKPSKQTSSFGPSVWLEFSPLAIKYNAVNLGQGFPNFEPPKFVKDAM
Sbjct: 1 MLRNTVKRLMTYTFKPSKQTSSFGPSVWLEFSPLAIKYNAVNLGQGFPNFEPPKFVKDAM 60
Query: 242 IKTIEVGGFNQYTRSPGHIRLVKALSSVYSPYFGRELNAMTEIMVGVGASESLFAAISSI 421
IKTIEVGGFNQYTRSPGHIRLVKALSSVYSPYFGRELNAMTEIMVGVGASESLFAAISSI
Sbjct: 61 IKTIEVGGFNQYTRSPGHIRLVKALSSVYSPYFGRELNAMTEIMVGVGASESLFAAISSI 120
Query: 422 VNEGDEVILIEPFFDIYIGPILMAGGIPKFVTLKEEESSQAGSSDKKRSSKHWKINKEEL 601
VNEGDEVILIEPFFDIYIGPILMAGGIPKFVTLKEEESSQAGSSDKKRSSKHWKINKEEL
Sbjct: 121 VNEGDEVILIEPFFDIYIGPILMAGGIPKFVTLKEEESSQAGSSDKKRSSKHWKINKEEL 180
Query: 602 AAAFTDKTKLIILNNPHNPVGKVYSKEELQEIADVVAKHGPNT 730
AAAFTDKTKLIILNNPHNPVGKVYSKEELQEIADVVAKHGPNT
Sbjct: 181 AAAFTDKTKLIILNNPHNPVGKVYSKEELQEIADVVAKHGPNT 223
Score = 435 bits (1118), Expect(2) = 0.0
Identities = 206/206 (100%), Positives = 206/206 (100%)
Frame = +3
Query: 732 TVISDEVYEWMTFDGEEHHRFATLPGMWERTITIGSAGKTFSITGWKVGWCIGPSNIIGA 911
TVISDEVYEWMTFDGEEHHRFATLPGMWERTITIGSAGKTFSITGWKVGWCIGPSNIIGA
Sbjct: 224 TVISDEVYEWMTFDGEEHHRFATLPGMWERTITIGSAGKTFSITGWKVGWCIGPSNIIGA 283
Query: 912 IANTHQYVPFSVPTPTQEAVAIALEQPNIKDYFKELATMYQNKRDTLLNSLTQAGLDPVI 1091
IANTHQYVPFSVPTPTQEAVAIALEQPNIKDYFKELATMYQNKRDTLLNSLTQAGLDPVI
Sbjct: 284 IANTHQYVPFSVPTPTQEAVAIALEQPNIKDYFKELATMYQNKRDTLLNSLTQAGLDPVI 343
Query: 1092 PQGTYFIMGDTSSIHLQGDQGKDTSITGMGLHLRDWNIARYLTTEYGVTTIPPSAFYCDD 1271
PQGTYFIMGDTSSIHLQGDQGKDTSITGMGLHLRDWNIARYLTTEYGVTTIPPSAFYCDD
Sbjct: 344 PQGTYFIMGDTSSIHLQGDQGKDTSITGMGLHLRDWNIARYLTTEYGVTTIPPSAFYCDD 403
Query: 1272 HQKIPENFVRFTFCKDDLTLQKAHDN 1349
HQKIPENFVRFTFCKDDLTLQKAHDN
Sbjct: 404 HQKIPENFVRFTFCKDDLTLQKAHDN 429
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3236559
Number of Hits to DB: 2,321,612,681
Number of extensions: 49613739
Number of successful extensions: 151362
Number of sequences better than 10.0: 2566
Number of HSP's gapped: 148617
Number of HSP's successfully gapped: 4252
Length of query: 490
Length of database: 1,051,180,864
Length adjustment: 133
Effective length of query: 357
Effective length of database: 620,718,517
Effective search space: 221596510569
Effective search space used: 221596510569
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 32 (16.9 bits)
|