| Contig-U15007-1 |
| Contig ID |
Contig-U15007-1 |
| Contig update |
2004. 6.11 |
| Contig sequence |
 |
| Gap |
no gap |
| Contig length |
1325 |
| Chromosome number (1..6, M) |
2 |
| Chromosome length |
8467578 |
| Start point |
6995155 |
| End point |
6993831 |
| Strand (PLUS/MINUS) |
MINUS |
| Number of clones |
20 |
| Number of EST |
30 |
| Link to clone list |
U15007 |
| List of clone(s) |
est1=AFJ670F,1,505
est2=VFM768F,1,380
est3=SFJ245F,6,570
est4=SFK828E,8,1277
est5=AFL316F,17,379
est6=VFJ190F,17,408
est7=VSF238F,17,376
est8=SSG768F,20,564
est9=SLB763E,37,1281
est10=FC-BC18F,48,711
est11=AFO759F,54,378
est12=VSG342F,76,569
est13=VFN254Z,488,1275
est14=VFJ190Z,512,1248
est15=SFI449Z,518,1291
est16=SSL843Z,555,1301
est17=SSF394Z,567,1302
est18=SFJ245Z,596,1277
est19=VFM768Z,596,1264
est20=AFL316Z,597,1242
est21=AFJ670Z,621,1323
est22=AFO759Z,622,1295
est23=VFH542Z,630,1325
est24=VSG342Z,633,1246
est25=SSG768Z,634,1317
est26=VSF238Z,671,1314
est27=SSB679Z,675,1300
est28=FC-BC18Z,700,1287
est29=SLA629Z,755,1293
est30=SLD540Z,1050,1294
|
| Translated Amino Acid sequence |
|
| Translated Amino Acid sequence (All Frames) |
|
| own update |
2004. 6.23 |
| Homology vs CSM-cDNA |
|
| dna update |
2009. 1. 8 |
| Homology vs DNA |
Query= Contig-U15007-1 (Contig-U15007-1Q) /CSM_Contig/Contig-U15007-1Q.Seq.d
(1325 letters)
Database: ddbj_A
92,845,959 sequences; 95,242,211,685 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value N
(BJ435600) Dictyostelium discoideum cDNA clone:ddv27k14, 3' ... 1425 0.0 1
(BJ401160) Dictyostelium discoideum cDNA clone:dds22h08, 3' ... 1425 0.0 1
(BJ402612) Dictyostelium discoideum cDNA clone:dds17b14, 3' ... 1366 0.0 1
(C92826) Dictyostelium discoideum slug cDNA, clone SSF394. 1269 0.0 1
(AU034117) Dictyostelium discoideum slug cDNA, clone SLB763. 1231 0.0 1
(BJ435265) Dictyostelium discoideum cDNA clone:ddv26h17, 3' ... 1195 0.0 1
(BJ432776) Dictyostelium discoideum cDNA clone:ddv19c23, 3' ... 1189 0.0 2
(BJ346318) Dictyostelium discoideum cDNA clone:dda30f15, 3' ... 1160 0.0 1
(BJ344832) Dictyostelium discoideum cDNA clone:dda20k18, 3' ... 1154 0.0 1
(BJ401775) Dictyostelium discoideum cDNA clone:dds19i12, 3' ... 1148 0.0 2
(BJ346546) Dictyostelium discoideum cDNA clone:dda24d11, 3' ... 1144 0.0 1
(AU266337) Dictyostelium discoideum vegetative cDNA clone:VS... 1130 0.0 1
(C89759) Dictyostelium discoideum slug cDNA, clone SSG768. 1128 0.0 1
(BJ345284) Dictyostelium discoideum cDNA clone:dda23p03, 3' ... 1128 0.0 2
(AC114263) Dictyostelium discoideum chromosome 2 map 215673-... 1094 0.0 1
(AU264920) Dictyostelium discoideum vegetative cDNA clone:VS... 1065 0.0 1
(AU060857) Dictyostelium discoideum slug cDNA, clone SLB763. 1055 0.0 1
(AU037257) Dictyostelium discoideum slug cDNA, clone SSB679. 1049 0.0 1
(BJ434231) Dictyostelium discoideum cDNA clone:ddv16c11, 3' ... 773 0.0 3
(C25783) Dictyostelium discoideum gamete cDNA, clone FC-BC18. 587 0.0 2
(C93899) Dictyostelium discoideum slug cDNA, clone SSL843. 959 0.0 2
(C25784) Dictyostelium discoideum gamete cDNA, clone FC-BC18. 1005 0.0 1
(BJ329240) Dictyostelium discoideum cDNA clone:dda24d11, 5' ... 739 0.0 2
(BJ390415) Dictyostelium discoideum cDNA clone:dds22h08, 5' ... 898 0.0 2
(AU033337) Dictyostelium discoideum slug cDNA, clone SLA629. 890 0.0 1
(AU266336) Dictyostelium discoideum vegetative cDNA clone:VS... 823 0.0 1
(BJ389599) Dictyostelium discoideum cDNA clone:dds19i12, 5' ... 777 0.0 2
(BJ327494) Dictyostelium discoideum cDNA clone:dda20k18, 5' ... 630 0.0 2
(BJ414599) Dictyostelium discoideum cDNA clone:ddv19c23, 5' ... 456 e-123 1
(BJ416491) Dictyostelium discoideum cDNA clone:ddv26h17, 5' ... 412 e-118 2
(BJ328174) Dictyostelium discoideum cDNA clone:dda23p03, 5' ... 422 e-113 1
(BJ329043) Dictyostelium discoideum cDNA clone:dda30f15, 5' ... 408 e-109 1
(AU264919) Dictyostelium discoideum vegetative cDNA clone:VS... 404 e-108 1
(AU052574) Dictyostelium discoideum slug cDNA, clone SLD540. 321 4e-83 1
(AU073357) Dictyostelium discoideum slug cDNA, clone SSG768. 208 4e-49 1
(FE766522) CCAG3280.b3 CCAG Petrolisthes cinctipes heart, gi... 54 0.014 1
(DY885635) CeleSEQ953 Cunninghamella elegans pBluescript (Ec... 44 0.016 3
(FD781384) 03PA2_T7_022_A04_08AUG2005_032 03PA2 Phaseolus an... 44 0.48 2
(FD800348) 05AV4_T7_023_E11_19APR2006_087 05AV4 Phaseolus an... 44 0.50 2
(FD782278) 03PA2_T7_034_G07_08AUG2005_051 03PA2 Phaseolus an... 44 0.52 2
(FD780660) 03PA2_T7_011_C01_08AUG2005_011 03PA2 Phaseolus an... 44 0.52 2
(FD780136) 03PA2_T7_004_H04_05AUG2005_018 03PA2 Phaseolus an... 44 0.53 2
(CB543301) PVEPSE3029B04.g Common bean seedling EST Library ... 44 0.69 2
(CV543805) RTS_139_G01 Phaseolus vulgaris P- root EST librar... 44 0.81 2
(EX303853) PvEST1094 Bean pod tissue cDNA Entry Library Phas... 44 0.81 2
(EH040403) PvEST0701 Bean pod tissue cDNA Entry Library Phas... 44 0.82 2
(CV540105) POD_027_D10 Phaseolus vulgaris pod EST library Ph... 44 0.82 2
(ER348776) 1092345434580 Global-Ocean-Sampling_GS-34-01-01-1... 48 0.86 1
(ER289894) 1092343594787 Global-Ocean-Sampling_GS-34-01-01-1... 48 0.86 1
(EK353721) 1095468277786 Global-Ocean-Sampling_GS-31-01-01-1... 48 0.86 1
(EK353639) 1095468265994 Global-Ocean-Sampling_GS-31-01-01-1... 48 0.86 1
(EK166118) 1095458052316 Global-Ocean-Sampling_GS-31-01-01-1... 48 0.86 1
(EK158639) 1095458015206 Global-Ocean-Sampling_GS-31-01-01-1... 48 0.86 1
(EK140574) 1095454101068 Global-Ocean-Sampling_GS-31-01-01-1... 48 0.86 1
(EK119309) 1092963340639 Global-Ocean-Sampling_GS-31-01-01-1... 48 0.86 1
(EJ551363) 1092959450919 Global-Ocean-Sampling_GS-29-01-01-1... 48 0.86 1
(EJ537930) 1092955313117 Global-Ocean-Sampling_GS-29-01-01-1... 48 0.86 1
(EJ504947) 1095403680344 Global-Ocean-Sampling_GS-28-01-01-1... 48 0.86 1
(EJ220272) 1092351222763 Global-Ocean-Sampling_GS-27-01-01-1... 48 0.86 1
(FE700685) Pv027D_M13R_E07.ab1 Phaseolus vulgaris cv Early g... 44 0.87 2
(FE900056) PvEST5918 Bean pod tissue cDNA Entry Library Phas... 44 0.99 2
(FE700684) Pv028D_M13R_D08.ab1 Phaseolus vulgaris cv Early g... 44 1.0 2
(FE700683) Pv028D_M13F_D08.ab1 Phaseolus vulgaris cv Early g... 44 1.0 2
(FE700682) Pv027D_M13F_E07.ab1 Phaseolus vulgaris cv Early g... 44 1.1 2
(ER306785) 1092343758873 Global-Ocean-Sampling_GS-34-01-01-1... 44 1.1 2
(FE700681) Pv055D_M13F_C01.ab1 Phaseolus vulgaris cv Early g... 44 1.1 2
(EJ925990) 1093018782282 Global-Ocean-Sampling_GS-30-02-01-1... 44 1.2 2
(ER357840) 1092351314911 Global-Ocean-Sampling_GS-34-01-01-1... 40 2.1 3
(CZ729792) OC__Ba0058E04.f OC__Ba Oryza coarctata genomic cl... 34 2.3 2
(CU234179) Zebrafish DNA sequence from clone CH73-315L8 in l... 46 3.4 1
(CT029999) Zebrafish DNA sequence from clone CH211-243P14 in... 46 3.4 1
(BX936438) Zebrafish DNA sequence from clone CH211-255D18 in... 46 3.4 1
(BX088707) Zebrafish DNA sequence from clone CH211-195B11 in... 46 3.4 1
(BX004878) Zebrafish DNA sequence from clone DKEY-11H2 in li... 46 3.4 1
(AL732507) Mouse DNA sequence from clone RP23-67E13 on chrom... 46 3.4 1
(AM445411) Vitis vinifera contig VV78X036901.3, whole genome... 46 3.4 1
(EA427602) Sequence 77 from patent US 7332281. 46 3.4 1
(DL007621) NOVEL THERAPEUTIC TARGETS IN CANCER. 46 3.4 1
(FI093612) MUGQ_CH252P464D03Sp6_CH0131_014 CHORI-252 Vervet ... 46 3.4 1
(ET057097) MUGQ_CH252P350A12Sp6_CP655_048 CHORI-252 Vervet M... 46 3.4 1
(EK079136) 1092961085928 Global-Ocean-Sampling_GS-31-01-01-1... 46 3.4 1
(EK024305) 1092955354896 Global-Ocean-Sampling_GS-31-01-01-1... 46 3.4 1
(AM647171) Entamoeba moshkovskii FIC GSS, clone mosh047e02.p1k. 46 3.4 1
(EJ241741) 1095328069696 Global-Ocean-Sampling_GS-27-01-01-1... 46 3.4 1
(EC853748) HDE00003055 Hyperamoeba dachnaya Non-normalized (... 46 3.4 1
(CX952555) UMC-bemiv_0B01-017-f02 Nuclear-transfer derived b... 46 3.4 1
(AM022695) Bos sp. 3' EST, clone C0007394m22. 46 3.4 1
(AM013433) Bos sp. 3' EST, clone C0007420o13. 46 3.4 1
(CI480667) Oryza sativa Japonica Group cDNA, clone: J07B5146... 46 3.4 1
(CB459961) 719780 MARC 6BOV Bos taurus cDNA 3', mRNA sequence. 46 3.4 1
(FE766523) CCAG3280.g1 CCAG Petrolisthes cinctipes heart, gi... 46 3.4 1
(DQ163658) Candidatus Hamiltonella defensa clone P140068 gen... 46 3.4 1
(DQ163555) Candidatus Hamiltonella defensa clone P120019 gen... 46 3.4 1
(DQ163384) Candidatus Hamiltonella defensa clone P080019 gen... 46 3.4 1
(AC026784) Homo sapiens chromosome 5 clone CTD-2138O14, comp... 36 3.7 6
(EJ384283) 1092963789772 Global-Ocean-Sampling_GS-28-01-01-1... 44 4.1 2
(CT027714) Zebrafish DNA sequence from clone CH211-168N8 in ... 42 4.2 5
(BX324212) Zebrafish DNA sequence from clone CH211-209N20 in... 42 7.1 5
(AC087807) Felis catus clone RP86-294B21, complete sequence. 36 7.3 3
(BH150955) ENTQF64TR Entamoeba histolytica Sheared DNA Entam... 32 8.4 2
>(BJ435600) Dictyostelium discoideum cDNA clone:ddv27k14, 3' end,
single read.
Length = 785
Score = 1425 bits (719), Expect = 0.0
Identities = 719/719 (100%)
Strand = Plus / Minus
Query: 488 tgccactgaagccgccaaagttggtgttgataaattcattgaagtttcaactgctcaaat 547
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 785 tgccactgaagccgccaaagttggtgttgataaattcattgaagtttcaactgctcaaat 726
Query: 548 ttacagttcaaataaaaaaccatcaaaagaaggtgataaaactgatccatggacactcat 607
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 725 ttacagttcaaataaaaaaccatcaaaagaaggtgataaaactgatccatggacactcat 666
Query: 608 tgcctctcataaacttaaagctgaaaaagctttaaaagaaattaatggattaaatttaat 667
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 665 tgcctctcataaacttaaagctgaaaaagctttaaaagaaattaatggattaaatttaat 606
Query: 668 tattgttcgtccatcagttgtttatggtccaggtgatattttaggtatttcaccaagaat 727
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 605 tattgttcgtccatcagttgtttatggtccaggtgatattttaggtatttcaccaagaat 546
Query: 728 tatcactggtgcagtttataaacatacaaatgaaaagatgaaattcctttgggatggtga 787
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 545 tatcactggtgcagtttataaacatacaaatgaaaagatgaaattcctttgggatggtga 486
Query: 788 cttgaaatataacactgttcacgtcaatgatgtctgtaaagcattatggttcctttctca 847
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 485 cttgaaatataacactgttcacgtcaatgatgtctgtaaagcattatggttcctttctca 426
Query: 848 aaatggtaaagttggtgatgtttacaatctttccgataaaggtgacactgatgcacaaac 907
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 425 aaatggtaaagttggtgatgtttacaatctttccgataaaggtgacactgatgcacaaac 366
Query: 908 catcagcaagatcttagagaaaatctttgcaatcaaaactggtttcgttggtaacatgtt 967
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 365 catcagcaagatcttagagaaaatctttgcaatcaaaactggtttcgttggtaacatgtt 306
Query: 968 atcaaatgttgcttcccttaaaatgaaagatgtttgcgaagaggtcaatgataaacatct 1027
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 305 atcaaatgttgcttcccttaaaatgaaagatgtttgcgaagaggtcaatgataaacatct 246
Query: 1028 caaaccatggtctgatctttgcaaagataaaggtatctcaaacactccattaactccata 1087
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 245 caaaccatggtctgatctttgcaaagataaaggtatctcaaacactccattaactccata 186
Query: 1088 tattgatcaagagttattatcaaatacccatctctctgttgatggtaccgccattgaagg 1147
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 185 tattgatcaagagttattatcaaatacccatctctctgttgatggtaccgccattgaagg 126
Query: 1148 acttggtttcaaatacgataatccagaaatcactgaagccctcgttagagaacaaatcg 1206
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 125 acttggtttcaaatacgataatccagaaatcactgaagccctcgttagagaacaaatcg 67
Lambda K H
1.37 0.711 1.31
Matrix: blastn matrix:1 -3
Number of Sequences: 92845959
Number of Hits to DB: 1,292,225,551
Number of extensions: 74438524
Number of successful extensions: 5787128
Number of sequences better than 10.0: 103
Length of query: 1325
Length of database: 95,242,211,685
Length adjustment: 24
Effective length of query: 1301
Effective length of database: 97,308,875,965
Effective search space: 126598847630465
Effective search space used: 126598847630465
X1: 11 (21.8 bits)
S2: 22 (44.1 bits)
|
| protein update |
2009. 7.13 |
| Homology vs Protein |
Query= Contig-U15007-1 (Contig-U15007-1Q) /CSM_Contig/Contig-U15007-1Q.Seq.d
(1325 letters)
Database: nrp_B
3,236,559 sequences; 1,051,180,864 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AE014297_3550(AE014297|pid:none) Drosophila melanogaster chromos... 321 3e-86
DQ311326_1(DQ311326|pid:none) Bombyx mori UDP-galactose 4-epimer... 293 1e-77
CU633438_741(CU633438|pid:none) Podospora anserina genomic DNA c... 282 2e-74
AM920428_328(AM920428|pid:none) Penicillium chrysogenum Wisconsi... 202 2e-50
CP000102_1077(CP000102|pid:none) Methanosphaera stadtmanae DSM 3... 74 9e-12
AC1210(AC1210) dTDP-D-glucose 4,6-dehydratase homolog lmo1083 [i... 74 1e-11
CP000885_3636(CP000885|pid:none) Clostridium phytofermentans ISD... 73 2e-11
AF328862_11(AF328862|pid:none) Geobacillus stearothermophilus st... 72 3e-11
CP000777_104(CP000777|pid:none) Leptospira biflexa serovar Patoc... 71 8e-11
EF101928_544(EF101928|pid:none) Acanthocystis turfacea Chlorella... 71 8e-11
CP000743_374(CP000743|pid:none) Methanococcus aeolicus Nankai-3,... 71 1e-10
CP000860_1616(CP000860|pid:none) Candidatus Desulforudis audaxvi... 70 2e-10
CP001393_52(CP001393|pid:none) Anaerocellum thermophilum DSM 672... 70 2e-10
AP009389_2578(AP009389|pid:none) Pelotomaculum thermopropionicum... 69 4e-10
AP006627_3679(AP006627|pid:none) Bacillus clausii KSM-K16 DNA, c... 69 5e-10
CT573071_1557(CT573071|pid:none) Kuenenia stuttgartiensis genome... 68 8e-10
AY883421_18(AY883421|pid:none) Geobacillus tepidamans strain GS5... 68 8e-10
AE010299_2128(AE010299|pid:none) Methanosarcina acetivorans str.... 67 1e-09
CP000909_2263(CP000909|pid:none) Chloroflexus aurantiacus J-10-f... 67 1e-09
CP001176_1147(CP001176|pid:none) Bacillus cereus B4264, complete... 67 2e-09
AE000666_1746(AE000666|pid:none) Methanothermobacter thermautotr... 67 2e-09
DQ857772_1(DQ857772|pid:none) Lactobacillus reuteri nucleoside-d... 67 2e-09
DQ149987_14(DQ149987|pid:none) Streptomyces neyagawaensis concan... 67 2e-09
CP000916_33(CP000916|pid:none) Thermotoga neapolitana DSM 4359, ... 67 2e-09
AF080235_13(AF080235|pid:none) Streptomyces cyanogenus landomyci... 66 2e-09
CP000254_3006(CP000254|pid:none) Methanospirillum hungatei JF-1,... 66 2e-09
CP001337_2984(CP001337|pid:none) Chloroflexus aggregans DSM 9485... 66 2e-09
CP001186_1112(CP001186|pid:none) Bacillus cereus G9842, complete... 65 4e-09
CP000939_1991(CP000939|pid:none) Clostridium botulinum B1 str. O... 65 4e-09
CP001581_2127(CP001581|pid:none) Clostridium botulinum A2 str. K... 65 4e-09
CP000879_913(CP000879|pid:none) Petrotoga mobilis SJ95, complete... 65 5e-09
AJ544861_9(AJ544861|pid:none) Thermotoga sp strain RQ2 rhamnose ... 65 5e-09
CP000962_2114(CP000962|pid:none) Clostridium botulinum A3 str. L... 65 5e-09
AE008384_1193(AE008384|pid:none) Methanosarcina mazei strain Goe... 65 5e-09
AM238664_487(AM238664|pid:none) Streptomyces ambofaciens ATCC 23... 65 5e-09
BA000004_3364(BA000004|pid:none) Bacillus halodurans C-125 DNA, ... 65 7e-09
AM412317_2041(AM412317|pid:none) Clostridium botulinum A str. AT... 65 7e-09
CP000716_497(CP000716|pid:none) Thermosipho melanesiensis BI429,... 64 9e-09
CP000113_4495(CP000113|pid:none) Myxococcus xanthus DK 1622, com... 64 9e-09
CP000939_2691(CP000939|pid:none) Clostridium botulinum B1 str. O... 64 9e-09
CP000924_1597(CP000924|pid:none) Thermoanaerobacter pseudethanol... 64 1e-08
(Q9LPG6) RecName: Full=Probable rhamnose biosynthetic enzyme 2; ... 64 1e-08
(O95455) RecName: Full=dTDP-D-glucose 4,6-dehydratase; ... 64 2e-08
AB173566_1(AB173566|pid:none) Macaca fascicularis brain cDNA clo... 64 2e-08
BT066151_1(BT066151|pid:none) Zea mays full-length cDNA clone ZM... 64 2e-08
BC005284_1(BC005284|pid:none) Homo sapiens TDP-glucose 4,6-dehyd... 64 2e-08
(A6QLW2) RecName: Full=dTDP-D-glucose 4,6-dehydratase; ... 63 2e-08
AE016879_1130(AE016879|pid:none) Bacillus anthracis str. Ames, c... 63 2e-08
CP000155_2137(CP000155|pid:none) Hahella chejuensis KCTC 2396, c... 63 2e-08
BC084333_1(BC084333|pid:none) Xenopus laevis hypothetical LOC495... 63 2e-08
CP000473_5382(CP000473|pid:none) Solibacter usitatus Ellin6076, ... 63 2e-08
CP001283_1210(CP001283|pid:none) Bacillus cereus AH820, complete... 63 2e-08
CU468135_1337(CU468135|pid:none) Erwinia tasmaniensis strain ET1... 63 3e-08
CP000300_2071(CP000300|pid:none) Methanococcoides burtonii DSM 6... 63 3e-08
EF138834_24(EF138834|pid:none) Lactobacillus johnsonii strain AT... 63 3e-08
FJ670504_25(FJ670504|pid:none) Micromonospora sp. Tu 6368 hypoth... 63 3e-08
CP000254_2990(CP000254|pid:none) Methanospirillum hungatei JF-1,... 63 3e-08
AE017198_890(AE017198|pid:none) Lactobacillus johnsonii NCC 533,... 62 4e-08
AK011555_1(AK011555|pid:none) Mus musculus 10 days embryo whole ... 62 4e-08
CP000903_1104(CP000903|pid:none) Bacillus weihenstephanensis KBA... 62 4e-08
AK154341_1(AK154341|pid:none) Mus musculus NOD-derived CD11c +ve... 62 4e-08
AY509120_11(AY509120|pid:none) Streptomyces bikiniensis strain N... 62 5e-08
CP001131_4385(CP001131|pid:none) Anaeromyxobacter sp. K, complet... 62 5e-08
CP000423_1941(CP000423|pid:none) Lactobacillus casei ATCC 334, c... 62 5e-08
CP001101_2118(CP001101|pid:none) Chlorobium phaeobacteroides BS1... 62 5e-08
EU961548_1(EU961548|pid:none) Zea mays clone 236423 RHM1 mRNA, c... 62 6e-08
CP000227_1183(CP000227|pid:none) Bacillus cereus Q1, complete ge... 62 6e-08
AE017194_1330(AE017194|pid:none) Bacillus cereus ATCC 10987, com... 61 8e-08
AE017355_1094(AE017355|pid:none) Bacillus thuringiensis serovar ... 61 8e-08
CP000678_1309(CP000678|pid:none) Methanobrevibacter smithii ATCC... 61 8e-08
AE014184_30(AE014184|pid:none) Tropheryma whipplei str. Twist, c... 61 8e-08
CP000598_64(CP000598|pid:none) Ostreococcus lucimarinus CCE9901 ... 61 1e-07
AJ871581_2(AJ871581|pid:none) Streptomyces achromogenes subsp. r... 61 1e-07
AF128273_3(AF128273|pid:none) Streptomyces griseus putative deox... 60 1e-07
BT075250_1(BT075250|pid:none) Osmerus mordax clone omor-eva-506-... 60 1e-07
EU147298_48(EU147298|pid:none) Streptomyces rishiriensis strain ... 60 1e-07
AP008230_3316(AP008230|pid:none) Desulfitobacterium hafniense Y5... 60 2e-07
AY659977_13(AY659977|pid:none) Lactobacillus rhamnosus strain RW... 60 2e-07
FJ479754_3(FJ479754|pid:none) Streptomyces aureofaciens strain C... 60 2e-07
CP001322_875(CP001322|pid:none) Desulfatibacillum alkenivorans A... 60 2e-07
CP001337_1492(CP001337|pid:none) Chloroflexus aggregans DSM 9485... 60 2e-07
CP000414_1342(CP000414|pid:none) Leuconostoc mesenteroides subsp... 60 2e-07
AP010904_2860(AP010904|pid:none) Desulfovibrio magneticus RS-1 D... 60 2e-07
CP000471_966(CP000471|pid:none) Magnetococcus sp. MC-1, complete... 60 2e-07
DQ176871_9(DQ176871|pid:none) Streptomyces aureofaciens strain T... 59 3e-07
CP000141_954(CP000141|pid:none) Carboxydothermus hydrogenoforman... 59 3e-07
CP000879_1278(CP000879|pid:none) Petrotoga mobilis SJ95, complet... 59 4e-07
AE008384_1134(AE008384|pid:none) Methanosarcina mazei strain Goe... 59 4e-07
AY899214_17(AY899214|pid:none) Streptomyces aizunensis strain NR... 59 4e-07
AY118081_13(AY118081|pid:none) Streptomyces sp. KCTC 0041BP dihy... 59 4e-07
CP000813_3179(CP000813|pid:none) Bacillus pumilus SAFR-032, comp... 59 4e-07
AB086653_3(AB086653|pid:none) Streptomyces halstedii vicenistati... 59 4e-07
AE009950_402(AE009950|pid:none) Pyrococcus furiosus DSM 3638, co... 59 4e-07
BA000002_783(BA000002|pid:none) Aeropyrum pernix K1 DNA, complet... 59 4e-07
CP000057_912(CP000057|pid:none) Haemophilus influenzae 86-028NP,... 59 5e-07
EF444927_4(EF444927|pid:none) Haemophilus influenzae strain DH1 ... 59 5e-07
CU207211_1063(CU207211|pid:none) Herminiimonas arsenicoxydans ch... 59 5e-07
AF306787_1(AF306787|pid:none) Streptomyces tenebrarius AprE gene... 59 5e-07
CP000084_537(CP000084|pid:none) Candidatus Pelagibacter ubique H... 58 7e-07
CP001147_1232(CP001147|pid:none) Thermodesulfovibrio yellowstoni... 58 7e-07
CP000017_735(CP000017|pid:none) Streptococcus pyogenes MGAS5005,... 58 7e-07
EF583995_3(EF583995|pid:none) Uncultured haloarchaeon clone fosm... 58 7e-07
AY422724_8(AY422724|pid:none) Thermoanaerobacterium thermosaccha... 58 7e-07
CP001101_2064(CP001101|pid:none) Chlorobium phaeobacteroides BS1... 58 7e-07
AE001825_39(AE001825|pid:none) Deinococcus radiodurans R1 chromo... 58 9e-07
(P95780) RecName: Full=dTDP-glucose 4,6-dehydratase; EC... 58 9e-07
AF144042_2(AF144042|pid:none) Streptomyces rimosus subsp. paromo... 58 9e-07
AM480972_1(AM480972|pid:none) Vitis vinifera contig VV78X027392.... 58 9e-07
AF479753_2(AF479753|pid:none) Lactobacillus gasseri strain ADH r... 57 1e-06
AY659976_13(AY659976|pid:none) Lactobacillus rhamnosus strain AT... 57 1e-06
CP000774_1502(CP000774|pid:none) Parvibaculum lavamentivorans DS... 57 1e-06
CP000769_4401(CP000769|pid:none) Anaeromyxobacter sp. Fw109-5, c... 57 1e-06
CP000804_3342(CP000804|pid:none) Roseiflexus castenholzii DSM 13... 57 1e-06
CP001087_2276(CP001087|pid:none) Desulfobacterium autotrophicum ... 57 1e-06
D78182_6(D78182|pid:none) Streptococcus mutans DNA for dTDP-rham... 57 1e-06
CP000056_714(CP000056|pid:none) Streptococcus pyogenes MGAS6180,... 57 1e-06
AM114193_2500(AM114193|pid:none) Uncultured methanogenic archaeo... 57 1e-06
CP001055_1025(CP001055|pid:none) Elusimicrobium minutum Pei191, ... 57 1e-06
AM746676_7016(AM746676|pid:none) Sorangium cellulosum 'So ce 56'... 57 2e-06
CP000633_1100(CP000633|pid:none) Agrobacterium vitis S4 chromoso... 57 2e-06
AE017226_1428(AE017226|pid:none) Treponema denticola ATCC 35405,... 57 2e-06
CP000891_3000(CP000891|pid:none) Shewanella baltica OS195, compl... 57 2e-06
CP000633_1450(CP000633|pid:none) Agrobacterium vitis S4 chromoso... 57 2e-06
(Q9HDU4) RecName: Full=Uncharacterized protein PB2B2.11; &AL512... 57 2e-06
AE009948_1171(AE009948|pid:none) Streptococcus agalactiae 2603V/... 57 2e-06
BA000028_2420(BA000028|pid:none) Oceanobacillus iheyensis HTE831... 57 2e-06
FJ483966_26(FJ483966|pid:none) Streptomyces diastatochromogenes ... 57 2e-06
AE015928_3074(AE015928|pid:none) Bacteroides thetaiotaomicron VP... 57 2e-06
AJ509828_3(AJ509828|pid:none) Streptococcus suis rmlACBD gene cl... 56 3e-06
DQ280500_13(DQ280500|pid:none) Streptomyces olindensis DAUFPE 56... 56 3e-06
CP000875_4303(CP000875|pid:none) Herpetosiphon aurantiacus ATCC ... 56 3e-06
CP000947_1093(CP000947|pid:none) Haemophilus somnus 2336, comple... 56 3e-06
AM709784_6(AM709784|pid:none) Streptomyces ambofaciens region of... 56 3e-06
CP000112_2178(CP000112|pid:none) Desulfovibrio desulfuricans G20... 56 3e-06
AE016853_1718(AE016853|pid:none) Pseudomonas syringae pv. tomato... 56 3e-06
CP000259_794(CP000259|pid:none) Streptococcus pyogenes MGAS9429,... 56 3e-06
CP001071_29(CP001071|pid:none) Akkermansia muciniphila ATCC BAA-... 56 3e-06
CP001403_2055(CP001403|pid:none) Sulfolobus islandicus Y.G.57.14... 56 3e-06
AY391267_2(AY391267|pid:none) Rhizobium etli D-alanine-D-alanine... 56 3e-06
CP000686_213(CP000686|pid:none) Roseiflexus sp. RS-1, complete g... 56 3e-06
AY957470_1(AY957470|pid:none) Arabidopsis thaliana 4alpha-carbox... 56 3e-06
AE005673_3603(AE005673|pid:none) Caulobacter crescentus CB15, co... 56 3e-06
CP000667_2211(CP000667|pid:none) Salinispora tropica CNB-440, co... 56 3e-06
AY659978_13(AY659978|pid:none) Lactobacillus rhamnosus strain R ... 56 3e-06
CP001618_1175(CP001618|pid:none) Beutenbergia cavernae DSM 12333... 56 3e-06
AE001437_2303(AE001437|pid:none) Clostridium acetobutylicum ATCC... 56 3e-06
CP001399_1973(CP001399|pid:none) Sulfolobus islandicus L.S.2.15,... 56 3e-06
BA000045_3235(BA000045|pid:none) Gloeobacter violaceus PCC 7421 ... 56 3e-06
CP000139_1050(CP000139|pid:none) Bacteroides vulgatus ATCC 8482,... 55 4e-06
CP000023_1146(CP000023|pid:none) Streptococcus thermophilus LMG ... 55 4e-06
AM889123_2(AM889123|pid:none) Streptomyces olivaceus NDP-L-rhamn... 55 4e-06
CP001129_1189(CP001129|pid:none) Streptococcus equi subsp. zooep... 55 4e-06
AE016822_366(AE016822|pid:none) Leifsonia xyli subsp. xyli str. ... 55 4e-06
CP000828_1518(CP000828|pid:none) Acaryochloris marina MBIC11017,... 55 4e-06
AM270353_18(AM270353|pid:none) Aspergillus niger contig An16c001... 55 4e-06
CP001330_81(CP001330|pid:none) Micromonas sp. RCC299 chromosome ... 55 6e-06
CP000767_1178(CP000767|pid:none) Campylobacter curvus 525.92, co... 55 6e-06
AE016830_2039(AE016830|pid:none) Enterococcus faecalis V583, com... 55 6e-06
AE009950_1788(AE009950|pid:none) Pyrococcus furiosus DSM 3638, c... 55 6e-06
CP001080_1030(CP001080|pid:none) Sulfurihydrogenibium sp. YO3AOP... 55 6e-06
AB181235_20(AB181235|pid:none) Streptococcus mitis genes for Dex... 55 6e-06
CP000108_780(CP000108|pid:none) Chlorobium chlorochromatii CaD3,... 55 6e-06
AE010299_4347(AE010299|pid:none) Methanosarcina acetivorans str.... 55 6e-06
CP001197_140(CP001197|pid:none) Desulfovibrio vulgaris str. 'Miy... 55 7e-06
AF355468_1(AF355468|pid:none) Saccharopolyspora spinosa DTDP-glu... 55 7e-06
CP000494_996(CP000494|pid:none) Bradyrhizobium sp. BTAi1, comple... 55 7e-06
EU038272_13(EU038272|pid:none) Streptomyces eurythermus NDP-hexo... 55 7e-06
CP000568_185(CP000568|pid:none) Clostridium thermocellum ATCC 27... 55 7e-06
CP000099_1118(CP000099|pid:none) Methanosarcina barkeri str. Fus... 55 7e-06
BA000016_619(BA000016|pid:none) Clostridium perfringens str. 13 ... 55 7e-06
CP000246_462(CP000246|pid:none) Clostridium perfringens ATCC 131... 55 7e-06
AE001437_2301(AE001437|pid:none) Clostridium acetobutylicum ATCC... 54 1e-05
CR931693_22(CR931693|pid:none) Streptococcus pneumoniae strain 3... 54 1e-05
AM409314_18(AM409314|pid:none) Streptomyces glaucescens ORF1 (pa... 54 1e-05
CP000667_2188(CP000667|pid:none) Salinispora tropica CNB-440, co... 54 1e-05
AY085272_1(AY085272|pid:none) Arabidopsis thaliana clone 142354 ... 54 1e-05
CP000866_164(CP000866|pid:none) Nitrosopumilus maritimus SCM1, c... 54 1e-05
CP000423_1902(CP000423|pid:none) Lactobacillus casei ATCC 334, c... 54 1e-05
AY730594_1(AY730594|pid:none) Salmonella enterica subsp. salamae... 54 1e-05
BA000045_2450(BA000045|pid:none) Gloeobacter violaceus PCC 7421 ... 54 1e-05
AB088224_24(AB088224|pid:none) Streptomyces rochei plasmid pSLA2... 54 1e-05
CR931677_22(CR931677|pid:none) Streptococcus pneumoniae strain 7... 54 1e-05
FM204883_1344(FM204883|pid:none) Streptococcus equi subsp. equi ... 54 1e-05
CP000679_1524(CP000679|pid:none) Caldicellulosiruptor saccharoly... 54 1e-05
AE017285_1358(AE017285|pid:none) Desulfovibrio vulgaris subsp. v... 54 1e-05
BX842651_50(BX842651|pid:none) Bdellovibrio bacteriovorus comple... 54 1e-05
T15370(T15370) hypothetical protein C01F1.3 - Caenorhabditis ele... 54 1e-05
CP001581_2909(CP001581|pid:none) Clostridium botulinum A2 str. K... 54 1e-05
CR931997_1888(CR931997|pid:none) Corynebacterium jeikeium K411 c... 54 2e-05
CP001146_147(CP001146|pid:none) Dictyoglomus thermophilum H-6-12... 54 2e-05
U09239_14(U09239|pid:none) Streptococcus pneumoniae type 19F cap... 54 2e-05
CP001131_1213(CP001131|pid:none) Anaeromyxobacter sp. K, complet... 54 2e-05
CP000678_327(CP000678|pid:none) Methanobrevibacter smithii ATCC ... 54 2e-05
CP000855_917(CP000855|pid:none) Thermococcus onnurineus NA1, com... 54 2e-05
CP001359_1308(CP001359|pid:none) Anaeromyxobacter dehalogenans 2... 54 2e-05
CR931722_20(CR931722|pid:none) Streptococcus pneumoniae strain 6... 54 2e-05
CP001099_263(CP001099|pid:none) Chlorobaculum parvum NCIB 8327, ... 54 2e-05
CP000527_1697(CP000527|pid:none) Desulfovibrio vulgaris subsp. v... 54 2e-05
CP001359_4391(CP001359|pid:none) Anaeromyxobacter dehalogenans 2... 54 2e-05
AE014295_883(AE014295|pid:none) Bifidobacterium longum NCC2705, ... 53 2e-05
CP000653_2630(CP000653|pid:none) Enterobacter sp. 638, complete ... 53 2e-05
CR931641_19(CR931641|pid:none) Streptococcus pneumoniae strain J... 53 2e-05
CT005245_35(CT005245|pid:none) Leishmania major strain Friedlin,... 53 2e-05
CP000251_1160(CP000251|pid:none) Anaeromyxobacter dehalogenans 2... 53 2e-05
AP006878_1709(AP006878|pid:none) Thermococcus kodakarensis KOD1 ... 53 2e-05
AB088119_2(AB088119|pid:none) Streptomyces sp. TP-A0274 staurosp... 53 2e-05
GM016257_109(GM016257|pid:none) Sequence 1087 from Patent EP1923... 53 2e-05
BA000040_5423(BA000040|pid:none) Bradyrhizobium japonicum USDA 1... 53 2e-05
CP000576_1400(CP000576|pid:none) Prochlorococcus marinus str. MI... 53 2e-05
AB054887_3(AB054887|pid:none) Streptomyces violaceus rhoF, rhoG,... 53 2e-05
AP011115_3961(AP011115|pid:none) Rhodococcus opacus B4 DNA, comp... 53 2e-05
CP000804_361(CP000804|pid:none) Roseiflexus castenholzii DSM 139... 53 2e-05
AB289547_19(AB289547|pid:none) Streptococcus oralis aliB-like, w... 53 3e-05
CP000921_382(CP000921|pid:none) Streptococcus pneumoniae Taiwan1... 53 3e-05
AF201913_1(AF201913|pid:none) Streptomyces globisporus SgcA (sgc... 53 3e-05
CR931638_17(CR931638|pid:none) Streptococcus pneumoniae strain 3... 53 3e-05
CR931667_23(CR931667|pid:none) Streptococcus pneumoniae strain R... 53 3e-05
AF094575_15(AF094575|pid:none) Streptococcus pneumoniae serotype... 53 3e-05
AJ007747_16(AJ007747|pid:none) Bordetella bronchiseptica cosmid ... 53 3e-05
AP009256_1507(AP009256|pid:none) Bifidobacterium adolescentis AT... 53 3e-05
CP000764_895(CP000764|pid:none) Bacillus cereus subsp. cytotoxis... 53 3e-05
CP000492_1293(CP000492|pid:none) Chlorobium phaeobacteroides DSM... 53 3e-05
AF316640_13(AF316640|pid:none) Streptococcus pneumoniae serotype... 53 3e-05
CP000852_1444(CP000852|pid:none) Caldivirga maquilingensis IC-16... 53 3e-05
CP000233_1551(CP000233|pid:none) Lactobacillus salivarius UCC118... 53 3e-05
CP000769_2078(CP000769|pid:none) Anaeromyxobacter sp. Fw109-5, c... 53 3e-05
CP000444_1392(CP000444|pid:none) Shewanella sp. MR-7, complete g... 53 3e-05
CP000383_2(CP000383|pid:none) Cytophaga hutchinsonii ATCC 33406,... 53 3e-05
AE007317_322(AE007317|pid:none) Streptococcus pneumoniae R6, com... 53 3e-05
CR931640_21(CR931640|pid:none) Streptococcus pneumoniae strain 2... 53 3e-05
CP001052_867(CP001052|pid:none) Burkholderia phytofirmans PsJN c... 52 4e-05
CP001114_2251(CP001114|pid:none) Deinococcus deserti VCD115, com... 52 4e-05
AE003849_255(AE003849|pid:none) Xylella fastidiosa 9a5c, complet... 52 4e-05
CR931714_20(CR931714|pid:none) Streptococcus pneumoniae strain 8... 52 4e-05
CP000481_413(CP000481|pid:none) Acidothermus cellulolyticus 11B ... 52 4e-05
EF147642_1(EF147642|pid:none) Populus trichocarpa clone WS0124_A... 52 4e-05
AF279622_1(AF279622|pid:none) Salmonella enterica isolate M287 d... 52 4e-05
CR931680_19(CR931680|pid:none) Streptococcus pneumoniae strain 5... 52 4e-05
CP000568_1076(CP000568|pid:none) Clostridium thermocellum ATCC 2... 52 4e-05
AM502224_35(AM502224|pid:none) Leishmania infantum chromosome 6. 52 4e-05
CP001104_77(CP001104|pid:none) Eubacterium eligens ATCC 27750, c... 52 4e-05
AM236080_1633(AM236080|pid:none) Rhizobium leguminosarum bv. vic... 52 4e-05
AJ628018_26(AJ628018|pid:none) Streptomyces sp. SCC 2136 deoxysu... 52 4e-05
CP000474_3026(CP000474|pid:none) Arthrobacter aurescens TC1, com... 52 4e-05
CP000487_1343(CP000487|pid:none) Campylobacter fetus subsp. fetu... 52 4e-05
CP000686_127(CP000686|pid:none) Roseiflexus sp. RS-1, complete g... 52 5e-05
CP000969_422(CP000969|pid:none) Thermotoga sp. RQ2, complete gen... 52 5e-05
CP000384_1058(CP000384|pid:none) Mycobacterium sp. MCS, complete... 52 5e-05
AF316642_17(AF316642|pid:none) Streptococcus pneumoniae serotype... 52 5e-05
AL445063_11(AL445063|pid:none) Thermoplasma acidophilum complete... 52 5e-05
CP001016_1289(CP001016|pid:none) Beijerinckia indica subsp. indi... 52 5e-05
AE006641_1621(AE006641|pid:none) Sulfolobus solfataricus P2, com... 52 5e-05
CP000454_2657(CP000454|pid:none) Arthrobacter sp. FB24, complete... 52 5e-05
AE004439_1030(AE004439|pid:none) Pasteurella multocida subsp. mu... 52 5e-05
CP000628_3659(CP000628|pid:none) Agrobacterium radiobacter K84 c... 52 5e-05
AE000666_377(AE000666|pid:none) Methanothermobacter thermautotro... 52 5e-05
CP000494_5288(CP000494|pid:none) Bradyrhizobium sp. BTAi1, compl... 52 5e-05
AF079762_6(AF079762|pid:none) Streptomyces venezuelae desosamine... 52 6e-05
AF055579_5(AF055579|pid:none) Streptomyces antibioticus putative... 52 6e-05
CP001097_2067(CP001097|pid:none) Chlorobium limicola DSM 245, co... 52 6e-05
T16444(T16444) hypothetical protein F53B1.4 - Caenorhabditis ele... 52 6e-05
CP001404_2076(CP001404|pid:none) Sulfolobus islandicus Y.N.15.51... 52 6e-05
AF279623_1(AF279623|pid:none) Salmonella enterica isolate M293 d... 52 6e-05
AF128272_2(AF128272|pid:none) Streptomyces spectabilis TDP-gluco... 52 6e-05
AF187532_10(AF187532|pid:none) Streptomyces nogalater SnoN (snoN... 52 6e-05
AB181234_19(AB181234|pid:none) Streptococcus oralis genes for hy... 51 8e-05
CP000721_4671(CP000721|pid:none) Clostridium beijerinckii NCIMB ... 51 8e-05
CP001080_1345(CP001080|pid:none) Sulfurihydrogenibium sp. YO3AOP... 51 8e-05
EU294175_1(EU294175|pid:none) Escherichia coli serogroup O58 O a... 51 8e-05
CP001147_582(CP001147|pid:none) Thermodesulfovibrio yellowstonii... 51 8e-05
AY596297_750(AY596297|pid:none) Haloarcula marismortui ATCC 4304... 51 8e-05
AY057452_7(AY057452|pid:none) Edwardsiella ictaluri isolate 93-1... 51 8e-05
AK165955_1(AK165955|pid:none) Mus musculus lung RCB-0558 LLC cDN... 51 8e-05
AP006618_212(AP006618|pid:none) Nocardia farcinica IFM 10152 DNA... 51 8e-05
CP001019_1179(CP001019|pid:none) Coxiella burnetii CbuG_Q212, co... 51 8e-05
AP008957_250(AP008957|pid:none) Rhodococcus erythropolis PR4 DNA... 51 8e-05
CP000387_1336(CP000387|pid:none) Streptococcus sanguinis SK36, c... 51 1e-04
AF521878_8(AF521878|pid:none) Streptomyces narbonensis desosamin... 51 1e-04
AE007870_1575(AE007870|pid:none) Agrobacterium tumefaciens str. ... 51 1e-04
CP000607_316(CP000607|pid:none) Chlorobium phaeovibrioides DSM 2... 51 1e-04
EU296418_1(EU296418|pid:none) Shigella boydii type 2 O-antigen g... 51 1e-04
CP001078_2915(CP001078|pid:none) Clostridium botulinum E3 str. A... 51 1e-04
(Q9ZAE8) RecName: Full=dTDP-glucose 4,6-dehydratase; EC... 51 1e-04
AE015928_2016(AE015928|pid:none) Bacteroides thetaiotaomicron VP... 51 1e-04
CP000780_1742(CP000780|pid:none) Candidatus Methanoregula boonei... 51 1e-04
AE000512_500(AE000512|pid:none) Thermotoga maritima MSB8, comple... 51 1e-04
CP000781_3530(CP000781|pid:none) Xanthobacter autotrophicus Py2,... 51 1e-04
AE017194_5348(AE017194|pid:none) Bacillus cereus ATCC 10987, com... 51 1e-04
AE006641_762(AE006641|pid:none) Sulfolobus solfataricus P2, comp... 51 1e-04
AE008226_3(AE008226|pid:none) Agrobacterium tumefaciens str. C58... 51 1e-04
AF387640_2(AF387640|pid:none) Coxiella burnetii dTDP-glucose-4,6... 51 1e-04
CP000725_978(CP000725|pid:none) Streptococcus gordonii str. Chal... 51 1e-04
CP001099_949(CP001099|pid:none) Chlorobaculum parvum NCIB 8327, ... 51 1e-04
AY147913_7(AY147913|pid:none) Streptococcus gordonii conserved h... 51 1e-04
AP009552_1092(AP009552|pid:none) Microcystis aeruginosa NIES-843... 51 1e-04
CP000578_687(CP000578|pid:none) Rhodobacter sphaeroides ATCC 170... 51 1e-04
AL954747_500(AL954747|pid:none) Nitrosomonas europaea ATCC 19718... 51 1e-04
CP000153_179(CP000153|pid:none) Sulfurimonas denitrificans DSM 1... 51 1e-04
AF521085_18(AF521085|pid:none) Streptomyces nanchangensis NS3226... 51 1e-04
CP000733_638(CP000733|pid:none) Coxiella burnetii Dugway 5J108-1... 51 1e-04
CP001399_929(CP001399|pid:none) Sulfolobus islandicus L.S.2.15, ... 50 1e-04
CP000489_312(CP000489|pid:none) Paracoccus denitrificans PD1222 ... 50 1e-04
AE017223_683(AE017223|pid:none) Brucella abortus biovar 1 str. 9... 50 1e-04
CP000497_156(CP000497|pid:none) Pichia stipitis CBS 6054 chromos... 50 1e-04
AE008917_1236(AE008917|pid:none) Brucella melitensis 16M chromos... 50 1e-04
CP000471_1387(CP000471|pid:none) Magnetococcus sp. MC-1, complet... 50 1e-04
AE001437_2915(AE001437|pid:none) Clostridium acetobutylicum ATCC... 50 1e-04
AE014291_690(AE014291|pid:none) Brucella suis 1330 chromosome I,... 50 1e-04
AE017355_4894(AE017355|pid:none) Bacillus thuringiensis serovar ... 50 1e-04
CP001110_1258(CP001110|pid:none) Pelodictyon phaeoclathratiforme... 50 1e-04
BC049462_1(BC049462|pid:none) Danio rerio TDP-glucose 4,6-dehydr... 50 1e-04
AF105113_5(AF105113|pid:none) Streptococcus pneumoniae type 19A ... 50 1e-04
AJ303361_1(AJ303361|pid:none) Zygosaccharomyces rouxii gl001-c g... 50 1e-04
AE016879_5093(AE016879|pid:none) Bacillus anthracis str. Ames, c... 50 1e-04
CT573213_4449(CT573213|pid:none) Frankia alni str. ACN14A chromo... 50 2e-04
AP007255_108(AP007255|pid:none) Magnetospirillum magneticum AMB-... 50 2e-04
CP000936_444(CP000936|pid:none) Streptococcus pneumoniae Hungary... 50 2e-04
CP000390_780(CP000390|pid:none) Mesorhizobium sp. BNC1, complete... 50 2e-04
CP001177_5200(CP001177|pid:none) Bacillus cereus AH187, complete... 50 2e-04
AM114193_2497(AM114193|pid:none) Uncultured methanogenic archaeo... 50 2e-04
CP000656_4977(CP000656|pid:none) Mycobacterium gilvum PYR-GCK, c... 50 2e-04
CP000968_832(CP000968|pid:none) Candidatus Korarchaeum cryptofil... 50 2e-04
CP001349_4157(CP001349|pid:none) Methylobacterium nodulans ORS 2... 50 2e-04
CP000872_694(CP000872|pid:none) Brucella canis ATCC 23365 chromo... 50 2e-04
CP001089_1635(CP001089|pid:none) Geobacter lovleyi SZ, complete ... 50 2e-04
A75008(A75008) udp-glucose 4-epimerase (gale-2) PAB1299 - Pyroco... 50 2e-04
AM270183_30(AM270183|pid:none) Aspergillus niger contig An08c028... 50 2e-04
CP001010_241(CP001010|pid:none) Polynucleobacter necessarius sub... 50 2e-04
CP001080_517(CP001080|pid:none) Sulfurihydrogenibium sp. YO3AOP1... 50 2e-04
CU861906_686(CU861906|pid:none) Ralstonia solanacearum strain Mo... 50 2e-04
AP010656_462(AP010656|pid:none) Candidatus Azobacteroides pseudo... 50 2e-04
CP000108_224(CP000108|pid:none) Chlorobium chlorochromatii CaD3,... 50 2e-04
AE016828_1590(AE016828|pid:none) Coxiella burnetii RSA 493, comp... 50 2e-04
CP000227_4966(CP000227|pid:none) Bacillus cereus Q1, complete ge... 50 2e-04
CP001280_148(CP001280|pid:none) Methylocella silvestris BL2, com... 50 2e-04
EU694096_1(EU694096|pid:none) Escherichia coli serogroup O117 O ... 50 2e-04
CP001349_5299(CP001349|pid:none) Methylobacterium nodulans ORS 2... 50 2e-04
CP001014_467(CP001014|pid:none) Thermoproteus neutrophilus V24St... 50 2e-04
CP001101_1244(CP001101|pid:none) Chlorobium phaeobacteroides BS1... 50 2e-04
CP001019_197(CP001019|pid:none) Coxiella burnetii CbuG_Q212, com... 50 2e-04
CP000025_1469(CP000025|pid:none) Campylobacter jejuni RM1221, co... 50 2e-04
CP001101_1843(CP001101|pid:none) Chlorobium phaeobacteroides BS1... 50 2e-04
CR936503_1492(CR936503|pid:none) Lactobacillus sakei strain 23K ... 50 2e-04
AL646052_682(AL646052|pid:none) Ralstonia solanacearum GMI1000 c... 50 2e-04
CU466930_1260(CU466930|pid:none) Candidatus Cloacamonas acidamin... 50 2e-04
CP000909_1592(CP000909|pid:none) Chloroflexus aurantiacus J-10-f... 50 2e-04
CP000116_1873(CP000116|pid:none) Thiobacillus denitrificans ATCC... 50 2e-04
CP000243_2270(CP000243|pid:none) Escherichia coli UTI89, complet... 50 2e-04
AM039952_3709(AM039952|pid:none) Xanthomonas campestris pv. vesi... 50 2e-04
AP007255_1364(AP007255|pid:none) Magnetospirillum magneticum AMB... 50 2e-04
CP000480_1471(CP000480|pid:none) Mycobacterium smegmatis str. MC... 50 2e-04
CP000911_710(CP000911|pid:none) Brucella suis ATCC 23445 chromos... 50 2e-04
CP000394_1138(CP000394|pid:none) Granulibacter bethesdensis CGDN... 49 3e-04
AL111168_1252(AL111168|pid:none) Campylobacter jejuni subsp. jej... 49 3e-04
CP000510_3269(CP000510|pid:none) Psychromonas ingrahamii 37, com... 49 3e-04
CP000890_1761(CP000890|pid:none) Coxiella burnetii RSA 331, comp... 49 3e-04
CP000473_6138(CP000473|pid:none) Solibacter usitatus Ellin6076, ... 49 3e-04
AM778931_10(AM778931|pid:none) Microcystis aeruginosa PCC 7806 g... 49 3e-04
AM181176_472(AM181176|pid:none) Pseudomonas fluorescens SBW25 co... 49 3e-04
CP001138_2076(CP001138|pid:none) Salmonella enterica subsp. ente... 49 3e-04
BX294137_116(BX294137|pid:none) Rhodopirellula baltica SH 1 comp... 49 3e-04
CP000323_616(CP000323|pid:none) Psychrobacter cryohalolentis K5,... 49 3e-04
CP001601_249(CP001601|pid:none) Corynebacterium aurimucosum ATCC... 49 3e-04
CP000477_941(CP000477|pid:none) Methanosaeta thermophila PT, com... 49 3e-04
CP000764_1965(CP000764|pid:none) Bacillus cereus subsp. cytotoxi... 49 3e-04
EU443633_17(EU443633|pid:none) Micromonospora chalcea tetrocarci... 49 3e-04
AE005176_211(AE005176|pid:none) Lactococcus lactis subsp. lactis... 49 3e-04
CP001298_2185(CP001298|pid:none) Methylobacterium chloromethanic... 49 4e-04
BA000023_2126(BA000023|pid:none) Sulfolobus tokodaii str. 7 DNA,... 49 4e-04
EU294171_1(EU294171|pid:none) Escherichia coli serotype O105 O a... 49 4e-04
CP001131_2124(CP001131|pid:none) Anaeromyxobacter sp. K, complet... 49 4e-04
EU294174_1(EU294174|pid:none) Shigella dysenteriae O antigen gen... 49 4e-04
AE016795_736(AE016795|pid:none) Vibrio vulnificus CMCP6 chromoso... 49 4e-04
DQ176871_21(DQ176871|pid:none) Streptomyces aureofaciens strain ... 49 4e-04
CP000425_185(CP000425|pid:none) Lactococcus lactis subsp. cremor... 49 4e-04
CP000885_3464(CP000885|pid:none) Clostridium phytofermentans ISD... 49 4e-04
CP001277_172(CP001277|pid:none) Candidatus Hamiltonella defensa ... 49 4e-04
BC093332_1(BC093332|pid:none) Danio rerio NAD(P) dependent stero... 49 4e-04
CP000908_2001(CP000908|pid:none) Methylobacterium extorquens PA1... 49 4e-04
CP000142_2767(CP000142|pid:none) Pelobacter carbinolicus DSM 238... 49 4e-04
CP001139_186(CP001139|pid:none) Vibrio fischeri MJ11 chromosome ... 49 4e-04
EF151801_4(EF151801|pid:none) Actinomadura hibisca strain P157-2... 49 5e-04
CP001095_2309(CP001095|pid:none) Bifidobacterium longum subsp. i... 49 5e-04
AP009049_1837(AP009049|pid:none) Clostridium kluyveri NBRC 12016... 49 5e-04
CP000468_1942(CP000468|pid:none) Escherichia coli APEC O1, compl... 49 5e-04
AP009510_593(AP009510|pid:none) Uncultured Termite group 1 bacte... 49 5e-04
CP001365_782(CP001365|pid:none) Halorubrum lacusprofundi ATCC 49... 49 5e-04
CP000529_3452(CP000529|pid:none) Polaromonas naphthalenivorans C... 49 5e-04
CP001013_1386(CP001013|pid:none) Leptothrix cholodnii SP-6, comp... 49 5e-04
EU694095_1(EU694095|pid:none) Escherichia coli serogroup O107 O ... 49 5e-04
CP001324_502(CP001324|pid:none) Micromonas sp. RCC299 chromosome... 49 5e-04
DQ519081_16(DQ519081|pid:none) Bordetella parapertussis clone fo... 49 5e-04
CP000555_3287(CP000555|pid:none) Methylibium petroleiphilum PM1,... 49 5e-04
AC004484_10(AC004484|pid:none) Arabidopsis thaliana chromosome 2... 49 5e-04
CP000254_2978(CP000254|pid:none) Methanospirillum hungatei JF-1,... 49 5e-04
AF458777_3(AF458777|pid:none) Lactococcus lactis subsp. cremoris... 49 5e-04
AY422197_19(AY422197|pid:none) Campylobacter jejuni putative ABC... 49 5e-04
CP000758_2698(CP000758|pid:none) Ochrobactrum anthropi ATCC 4918... 49 5e-04
CP000159_573(CP000159|pid:none) Salinibacter ruber DSM 13855, co... 49 5e-04
DQ676934_1(DQ676934|pid:none) Escherichia coli strain CB9827 ser... 48 7e-04
AE017226_1430(AE017226|pid:none) Treponema denticola ATCC 35405,... 48 7e-04
CP000915_1188(CP000915|pid:none) Francisella tularensis subsp. m... 48 7e-04
AB089954_20(AB089954|pid:none) Micromonospora griseorubida gene ... 48 7e-04
CP000478_797(CP000478|pid:none) Syntrophobacter fumaroxidans MPO... 48 7e-04
AY596297_151(AY596297|pid:none) Haloarcula marismortui ATCC 4304... 48 7e-04
AY035396_1(AY035396|pid:none) Escherichia coli O91 O-antigen gen... 48 7e-04
CP001341_2373(CP001341|pid:none) Arthrobacter chlorophenolicus A... 48 7e-04
CP000113_1493(CP000113|pid:none) Myxococcus xanthus DK 1622, com... 48 7e-04
DQ868765_1(DQ868765|pid:none) Escherichia coli serogroup O141 O-... 48 7e-04
A81320(A81320) ADPglyceromanno-heptose 6-epimerase (EC 5.1.3.20)... 48 7e-04
CP000746_814(CP000746|pid:none) Actinobacillus succinogenes 130Z... 48 7e-04
CP000113_1640(CP000113|pid:none) Myxococcus xanthus DK 1622, com... 48 7e-04
CP000859_2187(CP000859|pid:none) Desulfococcus oleovorans Hxd3, ... 48 7e-04
CP000628_3611(CP000628|pid:none) Agrobacterium radiobacter K84 c... 48 7e-04
AM233362_606(AM233362|pid:none) Francisella tularensis subsp. ho... 48 7e-04
CP000608_338(CP000608|pid:none) Francisella tularensis subsp. tu... 48 7e-04
CP000885_1198(CP000885|pid:none) Clostridium phytofermentans ISD... 48 7e-04
CP000127_951(CP000127|pid:none) Nitrosococcus oceani ATCC 19707,... 48 7e-04
DQ676933_1(DQ676933|pid:none) Escherichia coli strain 43w serogr... 48 7e-04
AE014133_346(AE014133|pid:none) Streptococcus mutans UA159, comp... 48 7e-04
AE000511_846(AE000511|pid:none) Helicobacter pylori 26695, compl... 48 7e-04
EU294178_2(EU294178|pid:none) Shigella dysenteriae O antigen gen... 48 7e-04
AY568960_2(AY568960|pid:none) Escherichia coli serotype O4:K3:H5... 48 7e-04
AF529080_2(AF529080|pid:none) Escherichia coli serotype O26:K60:... 48 7e-04
CP000159_806(CP000159|pid:none) Salinibacter ruber DSM 13855, co... 48 7e-04
CP000698_1662(CP000698|pid:none) Geobacter uraniireducens Rf4, c... 48 7e-04
AF167344_19(AF167344|pid:none) Campylobacter jejuni HS:19 lipool... 48 7e-04
AF237894_5(AF237894|pid:none) Streptomyces antibioticus Tu99 ole... 48 7e-04
CP000852_1428(CP000852|pid:none) Caldivirga maquilingensis IC-16... 48 7e-04
CU633900_698(CU633900|pid:none) Podospora anserina genomic DNA c... 48 7e-04
CP000133_1495(CP000133|pid:none) Rhizobium etli CFN 42, complete... 48 0.001
CP000656_2057(CP000656|pid:none) Mycobacterium gilvum PYR-GCK, c... 48 0.001
CP001638_1854(CP001638|pid:none) Geobacillus sp. WCH70, complete... 48 0.001
CP000716_1059(CP000716|pid:none) Thermosipho melanesiensis BI429... 48 0.001
CP001127_2177(CP001127|pid:none) Salmonella enterica subsp. ente... 48 0.001
CP000937_1254(CP000937|pid:none) Francisella philomiragia subsp.... 48 0.001
AF279628_1(AF279628|pid:none) Salmonella enterica isolate M1795 ... 48 0.001
CP001393_879(CP001393|pid:none) Anaerocellum thermophilum DSM 67... 48 0.001
CP000855_1843(CP000855|pid:none) Thermococcus onnurineus NA1, co... 48 0.001
CP000927_3972(CP000927|pid:none) Caulobacter sp. K31, complete g... 48 0.001
DQ109552_1(DQ109552|pid:none) Escherichia coli O139 O-antigen ge... 48 0.001
AM180088_1717(AM180088|pid:none) Haloquadratum walsbyi DSM 16790... 48 0.001
CU928169_345(CU928169|pid:none) Kluyveromyces thermotolerans str... 48 0.001
CP000875_4678(CP000875|pid:none) Herpetosiphon aurantiacus ATCC ... 48 0.001
AM746676_2157(AM746676|pid:none) Sorangium cellulosum 'So ce 56'... 48 0.001
CP001111_503(CP001111|pid:none) Stenotrophomonas maltophilia R55... 48 0.001
BA000045_1747(BA000045|pid:none) Gloeobacter violaceus PCC 7421 ... 48 0.001
CP000270_678(CP000270|pid:none) Burkholderia xenovorans LB400 ch... 47 0.001
CP001099_1692(CP001099|pid:none) Chlorobaculum parvum NCIB 8327,... 47 0.001
AY948196_1(AY948196|pid:none) Shigella boydii serogroup 18 O ant... 47 0.001
CP000316_3913(CP000316|pid:none) Polaromonas sp. JS666, complete... 47 0.001
AE014613_732(AE014613|pid:none) Salmonella enterica subsp. enter... 47 0.001
AF097519_1(AF097519|pid:none) Klebsiella pneumoniae dTDP-D-gluco... 47 0.001
CP001349_4143(CP001349|pid:none) Methylobacterium nodulans ORS 2... 47 0.001
CP000301_1410(CP000301|pid:none) Rhodopseudomonas palustris BisB... 47 0.001
EU549862_13(EU549862|pid:none) Escherichia coli strain F10598-41... 47 0.001
AY596297_2556(AY596297|pid:none) Haloarcula marismortui ATCC 430... 47 0.001
CP000744_1023(CP000744|pid:none) Pseudomonas aeruginosa PA7, com... 47 0.001
CP000348_2380(CP000348|pid:none) Leptospira borgpetersenii serov... 47 0.001
AF279615_1(AF279615|pid:none) Salmonella enterica isolate M1635 ... 47 0.001
CP000961_1667(CP000961|pid:none) Shewanella woodyi ATCC 51908, c... 47 0.001
EU805803_1(EU805803|pid:none) Salmonella enterica subsp. enteric... 47 0.001
CP000826_165(CP000826|pid:none) Serratia proteamaculans 568, com... 47 0.001
AP009389_1095(AP009389|pid:none) Pelotomaculum thermopropionicum... 47 0.001
AL583924_2(AL583924|pid:none) Mycobacterium leprae strain TN com... 47 0.001
U43540_1(U43540|pid:none) Mycobacterium tuberculosis rhamnose bi... 47 0.002
AB001455_4(AB001455|pid:none) Porphyromonas gingivalis rmlA, rml... 47 0.002
AP008955_556(AP008955|pid:none) Brevibacillus brevis NBRC 100599... 47 0.002
CP001634_198(CP001634|pid:none) Kosmotoga olearia TBF 19.5.1, co... 47 0.002
CP000117_2574(CP000117|pid:none) Anabaena variabilis ATCC 29413,... 47 0.002
M87049_24(M87049|pid:none) E. coli genomic sequence of the regio... 47 0.002
EU118168_2(EU118168|pid:none) Shigella flexneri strain IB1833 O-... 47 0.002
CP000672_1298(CP000672|pid:none) Haemophilus influenzae PittGG, ... 47 0.002
CP001087_3233(CP001087|pid:none) Desulfobacterium autotrophicum ... 47 0.002
AJ248284_7(AJ248284|pid:none) Pyrococcus abyssi complete genome;... 47 0.002
AE005674_3864(AE005674|pid:none) Shigella flexneri 2a str. 301, ... 47 0.002
CP000383_825(CP000383|pid:none) Cytophaga hutchinsonii ATCC 3340... 47 0.002
CP000463_1499(CP000463|pid:none) Rhodopseudomonas palustris BisA... 47 0.002
(P27830) RecName: Full=dTDP-glucose 4,6-dehydratase; EC... 47 0.002
AE016853_661(AE016853|pid:none) Pseudomonas syringae pv. tomato ... 47 0.002
AE016877_5017(AE016877|pid:none) Bacillus cereus ATCC 14579, com... 47 0.002
G65182(G65182;S30682)dTDPglucose 4,6-dehydratase (EC 4.2.1.46) -... 47 0.002
AE015451_1771(AE015451|pid:none) Pseudomonas putida KT2440 compl... 47 0.002
CP001390_2888(CP001390|pid:none) Geobacter sp. FRC-32, complete ... 47 0.002
EU294168_1(EU294168|pid:none) Escherichia coli serotype O150 O a... 47 0.002
BA000043_2149(BA000043|pid:none) Geobacillus kaustophilus HTA426... 47 0.002
EU892458_1(EU892458|pid:none) Escherichia coli strain TB182A glu... 47 0.002
AE016830_2012(AE016830|pid:none) Enterococcus faecalis V583, com... 47 0.002
CP000575_289(CP000575|pid:none) Staphylothermus marinus F1, comp... 47 0.002
AM167904_1238(AM167904|pid:none) Bordetella avium 197N complete ... 47 0.002
AB041266_11(AB041266|pid:none) Actinobacillus actinomycetemcomit... 47 0.002
CP000050_3561(CP000050|pid:none) Xanthomonas campestris pv. camp... 47 0.002
CP000800_2223(CP000800|pid:none) Escherichia coli E24377A, compl... 47 0.002
AP006841_4556(AP006841|pid:none) Bacteroides fragilis YCH46 DNA,... 47 0.002
BA000011_922(BA000011|pid:none) Thermoplasma volcanium GSS1 DNA,... 47 0.002
A91219(A91219) dTDP-glucose 4,6-dehydratase [imported] - Escheri... 47 0.002
CP000058_3488(CP000058|pid:none) Pseudomonas syringae pv. phaseo... 47 0.002
CP000885_1153(CP000885|pid:none) Clostridium phytofermentans ISD... 47 0.002
EU026118_20(EU026118|pid:none) Sphingomonas sp. ATCC 53159 diuta... 47 0.002
AP009044_688(AP009044|pid:none) Corynebacterium glutamicum R DNA... 47 0.002
>AE014297_3550(AE014297|pid:none) Drosophila melanogaster chromosome
3R, complete sequence. &BT004487_1(BT004487|pid:none)
&FJ630290_1(FJ630290|pid:none)
&FJ635167_1(FJ635167|pid:none)
Length = 371
Score = 321 bits (823), Expect = 3e-86
Identities = 164/364 (45%), Positives = 226/364 (62%), Gaps = 4/364 (1%)
Frame = +3
Query: 159 KPNVLILGGVGFIGRNLVQYLVEQKCCNKIRVADKVLPATAFLGAKHLEAFADPSVEYMQ 338
KP VLILGG GFIGRNL YL++ + +IR+ADK P A+L + F VE+
Sbjct: 4 KPTVLILGGCGFIGRNLATYLLDNELAQEIRLADKTPPQMAWLNEEQTRVFESDRVEFCS 63
Query: 339 GNLASAASITKCFT---LEGGKFNIVFNLAGETKYGQTDAVYNEKVYDVSVKCATEAAKV 509
NL +AAS F G ++IV N A ET+ Q DAVY E + +S+ CA EAA
Sbjct: 64 ANLINAASCKAAFAPHPTTGRAWDIVINCAAETRANQDDAVYKEGILKLSLNCANEAANQ 123
Query: 510 GVDKFIEVSTAQIYSSNKKPSKEGDKTDPWTLIASHKLKAEKALKEINGLNLIIVRPSVV 689
V +++E+S+ + SS K P KE KTDPWT +A KLK EK L I+ L+ +VR VV
Sbjct: 124 RVKRYVELSSGCVNSSEKTPLKEDCKTDPWTGVAKQKLKVEKELANIDDLSYTVVRLPVV 183
Query: 690 YGPGDILGISPRIITGAVYKHTNEKMKFLWDGDLKYNTVHVNDVCKALWFLSQNGK-VGD 866
YG GD + PRII A+YK+ NE MK LW+ ++ NTVHV+DVC A+W L+Q+ K G
Sbjct: 184 YGIGDKRYLMPRIIIAAIYKYLNETMKLLWNDAMRLNTVHVSDVCAAVWQLAQSPKTAGQ 243
Query: 867 VYNLSDKGDTDAQTISKILEKIFAIKTGFVGNMLSNVASLKMKDVCEEVNDKHLKPWSDL 1046
+YN+ D + TIS +L IF I F G ++SN+A L D E+NDKH+ PW+++
Sbjct: 244 IYNICDDSASTQGTISNLLVDIFDINLDFFGLVMSNLAKLYPTDTVSEINDKHMAPWAEI 303
Query: 1047 CKDKGISNTPLTPYIDQELLSNTHLSVDGTAIEGLGFKYDNPEITEALVREQIDYFINQN 1226
C+ GI NTPLTPY+D+E L + HL +D T ++ G+ +P++T L+ E I+ ++ Q
Sbjct: 304 CQRNGIDNTPLTPYLDEEQLQHKHLYLDNTKLKDFGYVLQHPKVTRELLMEMINDYVKQQ 363
Query: 1227 LFPK 1238
LFPK
Sbjct: 364 LFPK 367
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3236559
Number of Hits to DB: 1,923,892,230
Number of extensions: 39314005
Number of successful extensions: 115476
Number of sequences better than 10.0: 1509
Number of HSP's gapped: 114594
Number of HSP's successfully gapped: 1510
Length of query: 441
Length of database: 1,051,180,864
Length adjustment: 132
Effective length of query: 309
Effective length of database: 623,955,076
Effective search space: 192802118484
Effective search space used: 192802118484
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 32 (16.9 bits)
|
| PSORT |
|
| VS (DIR, S) |
2 |
| VH (FL, L) |
0 |
| VF (FL, S) |
4 |
| AH (FL, L) |
0 |
| AF (FL, S) |
3 |
| SL (DIR, L) |
3 |
| SS (DIR, S) |
4 |
| SH (FL, L) |
0 |
| SF (FL, S) |
3 |
| CH (FL, L) |
0 |
| CF (FL, S) |
0 |
| FCL (DIR, L) |
0 |
| FC (DIR, S) |
1 |
| FC-IC (SUB) |
0 |