| Contig-U14996-1 |
| Contig ID |
Contig-U14996-1 |
| Contig update |
2004. 6.11 |
| Contig sequence |
 |
| Gap |
no gap |
| Contig length |
1048 |
| Chromosome number (1..6, M) |
2 |
| Chromosome length |
8467578 |
| Start point |
6780975 |
| End point |
6779928 |
| Strand (PLUS/MINUS) |
MINUS |
| Number of clones |
4 |
| Number of EST |
4 |
| Link to clone list |
U14996 |
| List of clone(s) |
|
| Translated Amino Acid sequence |
|
| Translated Amino Acid sequence (All Frames) |
|
| own update |
2004. 6.23 |
| Homology vs CSM-cDNA |
|
| dna update |
2009. 1. 8 |
| Homology vs DNA |
Query= Contig-U14996-1 (Contig-U14996-1Q) /CSM_Contig/Contig-U14996-1Q.Seq.d
(1048 letters)
Database: ddbj_A
92,845,959 sequences; 95,242,211,685 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value N
(AC114261) Dictyostelium discoideum chromosome 2 map 126059-... 456 0.0 6
(BJ364499) Dictyostelium discoideum cDNA clone:ddc31o24, 5' ... 791 0.0 3
(L33847) Dictyostelium discoideum G protein alpha-7 subunit ... 791 0.0 3
(BJ326939) Dictyostelium discoideum cDNA clone:dda18g17, 5' ... 702 0.0 3
(AU267942) Dictyostelium discoideum vegetative cDNA clone:VS... 283 e-124 4
(U64319) Dictyostelium discoideum GTP-binding protein alpha ... 117 9e-22 1
(AC116924) Dictyostelium discoideum chromosome 2 map 6357117... 68 9e-10 2
(M25061) D.discoideum G protein alpha-subunit 2 mRNA, comple... 68 1e-09 2
(AU072968) Dictyostelium discoideum slug cDNA, clone SSF589. 68 1e-09 2
(AC116957) Dictyostelium discoideum chromosome 2 map 1685067... 42 0.010 11
(AC116918) Dictyostelium discoideum chromosome 2 map 6143698... 40 0.018 4
(CR391974) Zebrafish DNA sequence from clone CH211-59E10 in ... 38 0.028 2
(EH641916) EST13024 LK04 Laupala kohalensis cDNA clone 10610... 52 0.043 1
(EH640357) EST11465 LK04 Laupala kohalensis cDNA clone 10610... 52 0.043 1
(EH639560) EST10668 LK04 Laupala kohalensis cDNA clone 10610... 52 0.043 1
(EH638832) EST9940 LK04 Laupala kohalensis cDNA clone 106102... 52 0.043 1
(EH638095) EST9203 LK04 Laupala kohalensis cDNA clone 106102... 52 0.043 1
(EH637757) EST8865 LK04 Laupala kohalensis cDNA clone 106102... 52 0.043 1
(EH636720) EST7828 LK04 Laupala kohalensis cDNA clone 106102... 52 0.043 1
(EH636462) EST7570 LK04 Laupala kohalensis cDNA clone 106102... 52 0.043 1
(EH636415) EST7523 LK04 Laupala kohalensis cDNA clone 106102... 52 0.043 1
(EH635977) EST7085 LK04 Laupala kohalensis cDNA clone 106102... 52 0.043 1
(EH635787) EST6895 LK04 Laupala kohalensis cDNA clone 106102... 52 0.043 1
(EH634420) EST5528 LK04 Laupala kohalensis cDNA clone 106102... 52 0.043 1
(EH634332) EST5440 LK04 Laupala kohalensis cDNA clone 106102... 52 0.043 1
(EH633813) EST4920 LK04 Laupala kohalensis cDNA clone 106102... 52 0.043 1
(EH633444) EST4551 LK04 Laupala kohalensis cDNA clone 106102... 52 0.043 1
(EH633321) EST4428 LK04 Laupala kohalensis cDNA clone 106102... 52 0.043 1
(EH633249) EST4356 LK04 Laupala kohalensis cDNA clone 106102... 52 0.043 1
(EH632583) EST3690 LK04 Laupala kohalensis cDNA clone 106102... 52 0.043 1
(EH630892) EST1999 LK04 Laupala kohalensis cDNA clone 106102... 52 0.043 1
(EH630743) EST1850 LK04 Laupala kohalensis cDNA clone 106102... 52 0.043 1
(EH630707) EST1814 LK04 Laupala kohalensis cDNA clone 106102... 52 0.043 1
(EH629951) EST1058 LK04 Laupala kohalensis cDNA clone 106102... 52 0.043 1
(EH629059) EST166 LK01 Laupala kohalensis cDNA clone 1061020... 52 0.043 1
(EH012571) USDA-FP_185458 Lysiphlebus testaceipes adult whol... 52 0.043 1
(AY689436) Deerpox virus W-848-83, complete genome. 34 0.060 11
(AC115584) Dictyostelium discoideum chromosome 2 map complem... 38 0.068 4
(AC174112) Strongylocentrotus purpuratus clone R3-1016I17, W... 46 0.084 4
(AL929353) Plasmodium falciparum strain 3D7, chromosome 5, s... 36 0.094 9
(CJ401466) Molgula tectiformis cDNA, gonad clone:mtgd015c08,... 38 0.12 3
(S55498) G alpha 4=Guanine nucleotide-binding protein [Dicty... 50 0.17 1
(EK045288) 1092959547341 Global-Ocean-Sampling_GS-31-01-01-1... 50 0.17 1
(EJ618219) 1092963039079 Global-Ocean-Sampling_GS-29-01-01-1... 50 0.17 1
(BJ362766) Dictyostelium discoideum cDNA clone:ddc23l07, 5' ... 50 0.17 1
(AC117176) Dictyostelium discoideum chromosome 2 map 5018074... 34 0.34 11
(AC093699) Homo sapiens BAC clone RP11-810C20 from 4, comple... 40 0.44 6
(AL079351) Human chromosome 4 DNA sequence *** IN PROGRESS *... 40 0.48 7
(BX554466) Glossina morsitans morsitans (Tseatse fly) EST fr... 36 0.66 3
(DQ984911) Tylonycteris pachypus microsatellite A31 sequence. 48 0.67 1
(CE173723) tigr-gss-dog-17000326705482 Dog Library Canis lup... 48 0.67 1
(EH255000) JGI_ACAC17636.fwd ACAC Phakopsora pachyrhizi TW72... 48 0.67 1
(EB237302) PEG003-C-222727-501 Normalized Pedal-Pleural Gang... 48 0.67 1
(AM823532) Nicotiana tabacum EST, clone nt005189062. 48 0.67 1
(C23832) Dictyostelium discoideum gamete cDNA, clone FCL-AC11. 48 0.67 1
(BI500950) kx26b01.y1 Parastrongyloides trichosuri PA pAMP1 ... 48 0.67 1
(FK061723) XABT124901.b1 Gateway compatible cien cDNA librar... 48 0.67 1
(EY362752) CAWZ8412.fwd CAWZ Helobdella robusta Primary Late... 48 0.67 1
(EY295568) CAWX12325.fwd CAWX Helobdella robusta Primary Ear... 48 0.67 1
(AA228634) RRAMCA407SK Brugia malayi adult male cDNA (SAW94N... 48 0.67 1
(AC096573) Homo sapiens BAC clone RP11-458F24 from 2, comple... 40 0.69 5
(EU556754) Tetranychus urticae strain BR-VL mitochondrion, c... 36 0.79 4
(EU345430) Tetranychus urticae mitochondrion, complete genome. 36 0.79 4
(CR312757) mte1-35B11FM1 BAC end, cultivar Jemalong A17 of M... 32 0.81 3
(CU856138) Zebrafish DNA sequence *** SEQUENCING IN PROGRESS... 36 0.89 7
(AC094422) Rattus norvegicus clone CH230-3K14, *** SEQUENCIN... 44 1.0 3
(BH134748) ENTNV13TF Entamoeba histolytica Sheared DNA Entam... 30 1.2 4
(AE014846) Plasmodium falciparum 3D7 chromosome 12, section ... 32 1.2 10
(AL844507) Plasmodium falciparum chromosome 8. 40 1.3 15
(AC137197) Rattus norvegicus clone CH230-unknown, *** SEQUEN... 34 1.4 2
(AC192490) Cavia porcellus clone CH234-15A24, WORKING DRAFT ... 34 1.4 2
(AC183866) Felis catus clone RP86-170N5, WORKING DRAFT SEQUE... 36 1.4 2
(EB288675) CNSN01-F-009918-501 Normalized CNS library (juven... 44 1.5 2
(DE129436) Oryzias latipes DNA, reverse end of BAC clone: Mn... 42 1.5 2
(AE001397) Plasmodium falciparum 3D7 chromosome 2 section 34... 36 1.6 5
(BX204893) Danio rerio genomic clone DKEY-223J14, genomic su... 38 1.7 2
(CP000263) Buchnera aphidicola str. Cc (Cinara cedri), compl... 32 1.7 16
(AL929352) Plasmodium falciparum strain 3D7, chromosome 5, s... 38 1.7 10
(EK200843) 1095460056082 Global-Ocean-Sampling_GS-31-01-01-1... 36 1.8 2
(CT754561) Paramecium tetraurelia 5-PRIME EST from clone LK0... 36 1.8 2
(CT745134) Paramecium tetraurelia 5-PRIME EST from clone LK0... 36 1.8 2
(CT739761) Paramecium tetraurelia 3-PRIME EST from clone LK0... 36 1.8 2
(CT742365) Paramecium tetraurelia 5-PRIME EST from clone LK0... 36 1.9 2
(CT784537) Paramecium tetraurelia 5-PRIME EST from clone LK0... 36 1.9 2
(AC004136) Arabidopsis thaliana chromosome 2 BAC T8K22 genom... 36 2.3 5
(AY689437) Deerpox virus W-1170-84, complete genome. 34 2.4 9
(AC116960) Dictyostelium discoideum chromosome 2 map complem... 32 2.5 11
(AC014372) Drosophila melanogaster, *** SEQUENCING IN PROGRE... 44 2.6 3
(BX255907) Zebrafish DNA sequence from clone DKEY-4P13 in li... 46 2.7 1
(AC190151) Gallus gallus chromosome Z clone CH261-165J4, com... 46 2.7 1
(BC089036) Mus musculus GRB10 interacting GYF protein 2, mRN... 46 2.7 1
(BC082811) Mus musculus GRB10 interacting GYF protein 2, mRN... 46 2.7 1
(BC027137) Mus musculus GRB10 interacting GYF protein 2, mRN... 46 2.7 1
(AY176043) Mus musculus Grb10 interacting GYF protein 2 mRNA... 46 2.7 1
(AK122337) Mus musculus mRNA for mKIAA0642 protein. 46 2.7 1
(AC157811) Mus musculus chromosome 1, clone RP24-377C24, com... 46 2.7 1
(AJ504644) Glomus versiforme partial 18S rRNA gene, ITS1, 5.... 46 2.7 1
(DJ132044) Method for identification of useful proteins deri... 46 2.7 1
(AC104241) Homo sapiens chromosome 11, clone RP11-45A12, com... 46 2.7 1
(AC104010) Homo sapiens chromosome 11, clone RP11-244C20, co... 46 2.7 1
>(AC114261) Dictyostelium discoideum chromosome 2 map 126059-159710
strain AX4, complete sequence.
Length = 33651
Score = 456 bits (230), Expect(6) = 0.0
Identities = 230/230 (100%)
Strand = Plus / Minus
Query: 650 taatggatagtgaattaaaattattattacttggtactggtgattctggtaaatcaacag 709
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 32512 taatggatagtgaattaaaattattattacttggtactggtgattctggtaaatcaacag 32453
Query: 710 tcgttaaacaaatgaaaatcttacatcttgaaggttactctcaagaggaaagaattaatc 769
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 32452 tcgttaaacaaatgaaaatcttacatcttgaaggttactctcaagaggaaagaattaatc 32393
Query: 770 aaagacaatttgtttatagaaatatcattgaaattgcttattcaatcattcgtggttgtg 829
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 32392 aaagacaatttgtttatagaaatatcattgaaattgcttattcaatcattcgtggttgtg 32333
Query: 830 gtgttttaaatttaacaattccatcacaatttgattcaatttgttcatct 879
||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 32332 gtgttttaaatttaacaattccatcacaatttgattcaatttgttcatct 32283
Score = 335 bits (169), Expect(6) = 0.0
Identities = 169/169 (100%)
Strand = Plus / Minus
Query: 880 attgaagaaatttatgaaactaaaaattatacaaatttagataaaaatgtattaaaagga 939
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 32117 attgaagaaatttatgaaactaaaaattatacaaatttagataaaaatgtattaaaagga 32058
Query: 940 gttgcagaactttctaaaaatgaatcattcattaatgctgctaataatagtggttcaaat 999
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 32057 gttgcagaactttctaaaaatgaatcattcattaatgctgctaataatagtggttcaaat 31998
Query: 1000 ttccaattacattcatcttcacaatactttttagatgacattgcaagat 1048
|||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 31997 ttccaattacattcatcttcacaatactttttagatgacattgcaagat 31949
Score = 283 bits (143), Expect(6) = 0.0
Identities = 143/143 (100%)
Strand = Plus / Minus
Query: 242 ttttcataggtttcgttgtttgataactcctaatcatccacaaattctatattttttaaa 301
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 32920 ttttcataggtttcgttgtttgataactcctaatcatccacaaattctatattttttaaa 32861
Query: 302 tttcatatacatatatttatcactttattatactaaaaccaaacaaaaaataattttgta 361
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 32860 tttcatatacatatatttatcactttattatactaaaaccaaacaaaaaataattttgta 32801
Query: 362 tcactacacacatcctcaatatt 384
|||||||||||||||||||||||
Sbjct: 32800 tcactacacacatcctcaatatt 32778
Score = 109 bits (55), Expect(6) = 0.0
Identities = 55/55 (100%)
Strand = Plus / Minus
Query: 453 gagtagcactacaacaaatacaacaacagcaacaccagcaattcaagtgaatggt 507
|||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 32709 gagtagcactacaacaaatacaacaacagcaacaccagcaattcaagtgaatggt 32655
Score = 52.0 bits (26), Expect(6) = 0.0
Identities = 26/26 (100%)
Strand = Plus / Minus
Query: 149 taaaaacaatacccatttttcatatc 174
||||||||||||||||||||||||||
Sbjct: 33632 taaaaacaatacccatttttcatatc 33607
Score = 28.2 bits (14), Expect(6) = 0.0
Identities = 14/14 (100%)
Strand = Plus / Minus
Query: 578 ttttaactcgttat 591
||||||||||||||
Sbjct: 32584 ttttaactcgttat 32571
Lambda K H
1.37 0.711 1.31
Matrix: blastn matrix:1 -3
Number of Sequences: 92845959
Number of Hits to DB: 959,595,734
Number of extensions: 67572429
Number of successful extensions: 6688139
Number of sequences better than 10.0: 256
Length of query: 1048
Length of database: 95,242,211,685
Length adjustment: 24
Effective length of query: 1024
Effective length of database: 97,308,875,965
Effective search space: 99644288988160
Effective search space used: 99644288988160
X1: 11 (21.8 bits)
S2: 22 (44.1 bits)
|
| protein update |
2009. 7.13 |
| Homology vs Protein |
Query= Contig-U14996-1 (Contig-U14996-1Q) /CSM_Contig/Contig-U14996-1Q.Seq.d
(1048 letters)
Database: nrp_B
3,236,559 sequences; 1,051,180,864 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
L33847_1(L33847|pid:none) Dictyostelium discoideum G protein alp... 285 2e-75
(P34045) RecName: Full=Guanine nucleotide-binding protein alpha-... 285 2e-75
JH0248(JH0248)guanine nucleotide-binding protein alpha-7 chain -... 230 7e-59
EU170368_1(EU170368|pid:none) Dipolydora quadrilobata guanine nu... 84 1e-14
AB066282_1(AB066282|pid:none) Ciona intestinalis CiGi1 for G pro... 82 2e-14
AB066281_1(AB066281|pid:none) Ciona intestinalis CiGi1 for G pro... 82 2e-14
AY634285_1(AY634285|pid:none) Caenorhabditis briggsae strain AF1... 82 4e-14
(P50146) RecName: Full=Guanine nucleotide-binding protein G(i), ... 82 4e-14
(O73819) RecName: Full=Guanine nucleotide-binding protein subuni... 81 5e-14
AB180747_1(AB180747|pid:none) Cyprinus carpio Galpha-t2 mRNA for... 81 5e-14
(P27044) RecName: Full=Guanine nucleotide-binding protein G(i), ... 81 7e-14
BC044123_1(BC044123|pid:none) Xenopus laevis alpha-subunit of G-... 80 9e-14
AB047082_1(AB047082|pid:none) Halocynthia roretzi HrGi-1 mRNA fo... 80 9e-14
AF292562_1(AF292562|pid:none) Strongyloides stercoralis G protei... 80 1e-13
FJ362377_4(FJ362377|pid:none) Caenorhabditis sp. PS1010 contig J... 80 1e-13
CR859352_1(CR859352|pid:none) Pongo abelii mRNA; cDNA DKFZp469C1... 80 2e-13
PDBN(1CIP)A MOL_ID: 1;MOL_ID: 1; MOLECULE: GUANINE NUCLEOTIDE-BI... 80 2e-13
BT019775_1(BT019775|pid:none) Homo sapiens guanine nucleotide bi... 80 2e-13
(P63096) RecName: Full=Guanine nucleotide-binding protein G(i), ... 80 2e-13
(Q5RAD4) RecName: Full=Guanine nucleotide-binding protein G(i), ... 80 2e-13
(P38401) RecName: Full=Guanine nucleotide-binding protein G(i), ... 80 2e-13
BC108552_1(BC108552|pid:none) Xenopus laevis hypothetical protei... 80 2e-13
(P10824) RecName: Full=Guanine nucleotide-binding protein G(i), ... 80 2e-13
AY891138_1(AY891138|pid:none) Synthetic construct Homo sapiens c... 80 2e-13
BC026326_1(BC026326|pid:none) Homo sapiens guanine nucleotide bi... 80 2e-13
DQ397515_1(DQ397515|pid:none) Aplysia californica guanine nucleo... 79 2e-13
AE013599_1607(AE013599|pid:none) Drosophila melanogaster chromos... 79 2e-13
AB025782_1(AB025782|pid:none) Octopus vulgaris OvGaq mRNA for G ... 79 2e-13
BX649295_2(BX649295|pid:none) Zebrafish DNA sequence from clone ... 79 2e-13
BC080940_1(BC080940|pid:none) Xenopus tropicalis guanine nucleot... 79 3e-13
(P38403) RecName: Full=Guanine nucleotide-binding protein G(k) s... 79 3e-13
S47614_1(S47614|pid:none) G-protein alpha i subunit [Homarus ame... 78 5e-13
AJ563468_1(AJ563468|pid:none) Crassostrea gigas mRNA for guanine... 78 5e-13
AB425233_1(AB425233|pid:none) Bombyx mori Gq mRNA for G protein ... 78 5e-13
BC049537_1(BC049537|pid:none) Danio rerio guanine nucleotide bin... 78 5e-13
J03004_1(J03004|pid:none) Human guanine nucleotide-binding regul... 78 5e-13
(P04899) RecName: Full=Guanine nucleotide-binding protein G(i), ... 78 5e-13
AY677118_1(AY677118|pid:none) Homo sapiens Galphai2 protein mRNA... 78 5e-13
JN0115(JN0115)GTP-binding regulatory protein dgq alpha chain - f... 78 6e-13
EU369353_1(EU369353|pid:none) Oncorhynchus mykiss G protein alph... 78 6e-13
DQ917649_1(DQ917649|pid:none) Sus scrofa GBI2 mRNA, complete cds. 78 6e-13
AF540394_1(AF540394|pid:none) Schistosoma mansoni trimeric G-pro... 78 6e-13
BC063931_1(BC063931|pid:none) Xenopus tropicalis hypothetical pr... 78 6e-13
DQ917648_1(DQ917648|pid:none) Sus scrofa GBI1 mRNA, complete cds. 78 6e-13
NRL(1GIA) Gi alpha 1 (active form with bound gtp-gamma-s) - Rattus 78 6e-13
(O15975) RecName: Full=Guanine nucleotide-binding protein G(q) s... 78 6e-13
AY810966_1(AY810966|pid:none) Schistosoma japonicum SJCHGC05688 ... 78 6e-13
AB274828_1(AB274828|pid:none) Capra hircus Gi2 mRNA for guanine ... 78 6e-13
AY254175_1(AY254175|pid:none) Mucor circinelloides G protein alp... 77 8e-13
L24550_1(L24550|pid:none) Gallus gallus G protein alpha subunit ... 77 8e-13
(P30677) RecName: Full=Guanine nucleotide-binding protein subuni... 77 8e-13
(P38408) RecName: Full=Guanine nucleotide-binding protein subuni... 77 8e-13
BC084923_1(BC084923|pid:none) Xenopus laevis guanine nucleotide ... 77 8e-13
AY626792_1(AY626792|pid:none) Litopenaeus vannamei heterotrimeri... 77 8e-13
AF050654_1(AF050654|pid:none) Ambystoma tigrinum cone transducin... 77 8e-13
BX005248_1(BX005248|pid:none) Zebrafish DNA sequence from clone ... 77 8e-13
BC053164_1(BC053164|pid:none) Danio rerio guanine nucleotide bin... 77 8e-13
(P28051) RecName: Full=Guanine nucleotide-binding protein alpha-... 77 1e-12
AY534107_1(AY534107|pid:none) Lytechinus variegatus guanine nucl... 77 1e-12
DQ917647_1(DQ917647|pid:none) Sus scrofa GBAK mRNA, complete cds. 77 1e-12
(O95837) RecName: Full=Guanine nucleotide-binding protein subuni... 77 1e-12
AF050653_1(AF050653|pid:none) Ambystoma tigrinum rod transducin ... 77 1e-12
DQ182016_1(DQ182016|pid:none) Anopheles gambiae G(alpha)i mRNA, ... 77 1e-12
AB180748_1(AB180748|pid:none) Cyprinus carpio Galpha-t1-1 mRNA f... 77 1e-12
FJ958357_1(FJ958357|pid:none) Ovis aries GNAZ (GNAZ) mRNA, compl... 77 1e-12
(P38407) RecName: Full=Guanine nucleotide-binding protein G(t) s... 77 1e-12
AY534108_1(AY534108|pid:none) Strongylocentrotus purpuratus guan... 77 1e-12
FN357320_6(FN357320|pid:none) Schistosoma mansoni genome sequenc... 77 1e-12
(Q9DC51) RecName: Full=Guanine nucleotide-binding protein G(k) s... 76 2e-12
(P08753) RecName: Full=Guanine nucleotide-binding protein G(k) s... 76 2e-12
L24551_1(L24551|pid:none) Gallus gallus G protein (Galpa i3-o) m... 76 2e-12
AK167438_1(AK167438|pid:none) Mus musculus 15 days pregnant adul... 76 2e-12
AK157998_1(AK157998|pid:none) Mus musculus adult inner ear cDNA,... 76 2e-12
AY899210_1(AY899210|pid:none) Rattus norvegicus GTP-binding prot... 76 2e-12
(P30683) RecName: Full=Guanine nucleotide-binding protein G(o) s... 76 2e-12
(P51876) RecName: Full=Guanine nucleotide-binding protein G(i) s... 76 2e-12
DQ656111_1(DQ656111|pid:none) Aplysia californica guanine nucleo... 76 2e-12
DQ202702_1(DQ202702|pid:none) Cricetulus griseus guanine nucleot... 76 2e-12
S71213_1(S71213|pid:none) G protein Gi2 alpha [mice, CBA/J, coch... 76 2e-12
(P08752) RecName: Full=Guanine nucleotide-binding protein G(i), ... 76 2e-12
DQ202703_1(DQ202703|pid:none) Cricetulus griseus guanine nucleot... 76 2e-12
EU257502_1(EU257502|pid:none) Cavia porcellus alpha-transducin (... 76 2e-12
(Q9JID2) RecName: Full=Guanine nucleotide-binding protein subuni... 76 2e-12
(P38409) RecName: Full=Guanine nucleotide-binding protein subuni... 76 2e-12
(P08754) RecName: Full=Guanine nucleotide-binding protein G(k) s... 76 2e-12
(P30682) RecName: Full=Guanine nucleotide-binding protein G(i) s... 76 2e-12
AY899211_1(AY899211|pid:none) Rattus norvegicus GTP-binding prot... 76 2e-12
AY957405_1(AY957405|pid:none) Helicoverpa armigera GTP-binding p... 75 3e-12
BC168083_1(BC168083|pid:none) Xenopus tropicalis cDNA clone MGC:... 75 3e-12
EU057176_1(EU057176|pid:none) Helicoverpa assulta G(alpha)q mRNA... 75 3e-12
DQ656112_1(DQ656112|pid:none) Aplysia californica guanine nucleo... 75 3e-12
NRL(1TAG) Transducin-alpha complexed with gdp and magnesium 75 4e-12
NRL(1TNDA) Transducin (alpha subunit) complexed with the Nonhydr... 75 4e-12
M13963_1(M13963|pid:none) Mouse inhibitory G protein of adenylat... 75 4e-12
(P04695) RecName: Full=Guanine nucleotide-binding protein G(t) s... 75 4e-12
(P38400) RecName: Full=Guanine nucleotide-binding protein G(i), ... 75 4e-12
(P20612) RecName: Full=Guanine nucleotide-binding protein G(t) s... 75 4e-12
NRL(1TNDB) Transducin (alpha subunit) complexed with the Nonhydr... 75 4e-12
AB105070_1(AB105070|pid:none) Bombyx mori mRNA for Gq-like G pro... 75 4e-12
BC011169_1(BC011169|pid:none) Mus musculus guanine nucleotide bi... 75 4e-12
AJ851735_1(AJ851735|pid:none) Gallus gallus mRNA for hypothetica... 75 4e-12
M69013_1(M69013|pid:none) Human guanine nucleotide-binding regul... 75 5e-12
(Q60MJ0) RecName: Full=Guanine nucleotide-binding protein alpha-... 75 5e-12
(Q28300) RecName: Full=Guanine nucleotide-binding protein G(t) s... 75 5e-12
AB209435_1(AB209435|pid:none) Homo sapiens mRNA for Guanine nucl... 75 5e-12
(P50149) RecName: Full=Guanine nucleotide-binding protein G(t) s... 75 5e-12
(P11488) RecName: Full=Guanine nucleotide-binding protein G(t) s... 75 5e-12
AY892781_1(AY892781|pid:none) Synthetic construct Homo sapiens c... 75 5e-12
AJ250443_1(AJ250443|pid:none) Calliphora vicina mRNA for guanine... 75 5e-12
BC061608_1(BC061608|pid:none) Xenopus tropicalis guanine nucleot... 75 5e-12
AF200338_1(AF200338|pid:none) Gallus gallus rod-type transducin ... 75 5e-12
BC014627_1(BC014627|pid:none) Homo sapiens guanine nucleotide bi... 75 5e-12
X15088_1(X15088|pid:none) Human GNAT1 mRNA for transducin alpha-... 75 5e-12
AL671854_10(AL671854|pid:none) Mouse DNA sequence from clone RP2... 75 5e-12
AK147393_1(AK147393|pid:none) Mus musculus cDNA, RIKEN full-leng... 74 7e-12
AB271925_1(AB271925|pid:none) Sus scrofa GNAQ mRNA for guanine n... 74 7e-12
(P50148) RecName: Full=Guanine nucleotide-binding protein G(q) s... 74 7e-12
L76256_1(L76256|pid:none) Homo sapiens G alpha q mRNA, 5' end of... 74 7e-12
DQ100319_1(DQ100319|pid:none) Uta stansburiana cone transducin m... 74 7e-12
AK009388_1(AK009388|pid:none) Mus musculus adult male tongue cDN... 74 7e-12
(O13055) RecName: Full=Guanine nucleotide-binding protein G(i) s... 74 7e-12
(P43444) RecName: Full=Guanine nucleotide-binding protein subuni... 74 9e-12
AF234260_1(AF234260|pid:none) Rattus norvegicus heterotrimeric g... 74 9e-12
(P10823) RecName: Full=Guanine nucleotide-binding protein alpha-... 74 9e-12
AB025781_1(AB025781|pid:none) Octopus vulgaris OvGao mRNA for G ... 74 1e-11
BC170086_1(BC170086|pid:none) Xenopus laevis G protein alpha sub... 74 1e-11
AE013599_1135(AE013599|pid:none) Drosophila melanogaster chromos... 74 1e-11
(P16378) RecName: Full=Guanine nucleotide-binding protein G(o) s... 74 1e-11
AB066503_1(AB066503|pid:none) Schizophyllum commune ScGP-A gene ... 74 1e-11
U37413_1(U37413|pid:none) Mus musculus guanine nucleotide-bindin... 74 1e-11
BC170080_1(BC170080|pid:none) Xenopus laevis G protein alpha sub... 74 1e-11
CR761976_1(CR761976|pid:none) Xenopus tropicalis finished cDNA, ... 74 1e-11
BC059637_1(BC059637|pid:none) Danio rerio guanine nucleotide bin... 74 1e-11
(P10825) RecName: Full=Guanine nucleotide-binding protein G(o) s... 74 1e-11
AB051903_1(AB051903|pid:none) Schizophyllum commune ScGP-B gene ... 74 1e-11
(O15976) RecName: Full=Guanine nucleotide-binding protein G(o) s... 74 1e-11
EU571208_1(EU571208|pid:none) Petromyzon marinus short photorece... 73 1e-11
BC085433_1(BC085433|pid:none) Danio rerio zgc:101761, mRNA (cDNA... 73 1e-11
AK040065_1(AK040065|pid:none) Mus musculus 0 day neonate thymus ... 73 1e-11
DQ327708_1(DQ327708|pid:none) Schistosoma japonicum GTP-binding ... 73 1e-11
AF521583_1(AF521583|pid:none) Loligo pealei visual iGq-alpha pro... 73 1e-11
BC155288_1(BC155288|pid:none) Danio rerio guanine nucleotide bin... 73 1e-11
AF201328_1(AF201328|pid:none) Panulirus argus Gq/11 protein alph... 73 2e-11
AY487343_1(AY487343|pid:none) Sporothrix schenckii G-protein alp... 73 2e-11
DQ413186_1(DQ413186|pid:none) Sepia officinalis visual iGq-alpha... 73 2e-11
DQ993172_1(DQ993172|pid:none) Hypocrea jecorina G-alpha protein ... 73 2e-11
AY328525_1(AY328525|pid:none) Gekko gecko photoreceptor transduc... 73 2e-11
X12924_1(X12924|pid:none) Bovine mRNA for GTP-binding protein G39. 72 2e-11
(P38410) RecName: Full=Guanine nucleotide-binding protein G(q) s... 72 2e-11
RGXLOA(S02785)GTP-binding regulatory protein Go alpha chain - Af... 72 2e-11
(P08239) RecName: Full=Guanine nucleotide-binding protein G(o) s... 72 2e-11
(Q9XZV4) RecName: Full=Guanine nucleotide-binding protein G(q) s... 72 2e-11
M60162_1(M60162|pid:none) Human guanine nucleotide-binding regul... 72 2e-11
(P09471) RecName: Full=Guanine nucleotide-binding protein G(o) s... 72 2e-11
AF452097_1(AF452097|pid:none) Trichoderma atroviride G protein a... 72 2e-11
AB083056_1(AB083056|pid:none) Helicobasidium mompa hga1-2 gene f... 72 2e-11
M19182_1(M19182|pid:none) Homo sapiens guanine nucleotide-bindin... 72 2e-11
(O14438) RecName: Full=Guanine nucleotide-binding protein alpha-... 72 2e-11
(P16894) RecName: Full=Guanine nucleotide-binding protein alpha-... 72 2e-11
BC081126_1(BC081126|pid:none) Xenopus laevis guanine nucleotide ... 72 2e-11
(A8MTJ3) RecName: Full=Guanine nucleotide-binding protein G(t) s... 72 2e-11
AF011496_1(AF011496|pid:none) Homo sapiens GTP-binding protein a... 72 2e-11
CQ871846_1(CQ871846|pid:none) Sequence 19 from Patent WO20040790... 72 3e-11
DQ202701_1(DQ202701|pid:none) Cricetulus griseus guanine nucleot... 72 3e-11
AM888287_1(AM888287|pid:none) Sordaria macrospora partial gsa3 g... 72 3e-11
AF004846_1(AF004846|pid:none) Neurospora crassa G protein alpha ... 72 3e-11
RGRTO2(D40436;S12990)GTP-binding regulatory protein Go alpha cha... 72 3e-11
(P59215) RecName: Full=Guanine nucleotide-binding protein G(o) s... 72 3e-11
(Q05424) RecName: Full=Guanine nucleotide-binding protein alpha-... 72 3e-11
(P38404) RecName: Full=Guanine nucleotide-binding protein G(o) s... 72 4e-11
AJ132944_1(AJ132944|pid:none) Sclerotinia sclerotiorum sgp1 gene... 72 4e-11
BC162964_1(BC162964|pid:none) Danio rerio guanine nucleotide bin... 72 4e-11
BC075229_1(BC075229|pid:none) Xenopus laevis MGC84417 protein, m... 71 6e-11
(P20353) RecName: Full=Guanine nucleotide-binding protein G(i) s... 71 6e-11
AY146577_1(AY146577|pid:none) Caenorhabditis remanei strain EM46... 71 7e-11
AY146560_1(AY146560|pid:none) Caenorhabditis elegans strain CB49... 71 7e-11
AY146576_1(AY146576|pid:none) Caenorhabditis remanei strain PB26... 71 7e-11
(P29348) RecName: Full=Guanine nucleotide-binding protein G(t) s... 71 7e-11
CU640366_1097(CU640366|pid:none) Podospora anserina genomic DNA ... 71 7e-11
AK056008_1(AK056008|pid:none) Homo sapiens cDNA FLJ31446 fis, cl... 71 7e-11
AY146562_1(AY146562|pid:none) Caenorhabditis elegans strain CB48... 71 7e-11
AB167957_1(AB167957|pid:none) Bombyx mori mRNA for G protein alp... 71 7e-11
AY146574_1(AY146574|pid:none) Caenorhabditis remanei strain PB24... 71 7e-11
AB022098_1(AB022098|pid:none) Halocynthia roretzi mRNA for G pro... 71 7e-11
EU571207_1(EU571207|pid:none) Petromyzon marinus long photorecep... 71 7e-11
AY146571_1(AY146571|pid:none) Caenorhabditis remanei strain PB23... 71 7e-11
AY146558_1(AY146558|pid:none) Caenorhabditis elegans strain DH42... 71 7e-11
AY146566_1(AY146566|pid:none) Caenorhabditis elegans strain AB3 ... 71 7e-11
(Q61B55) RecName: Full=Guanine nucleotide-binding protein alpha-... 71 7e-11
FJ455725_1(FJ455725|pid:none) Caenorhabditis remanei strain PB24... 71 7e-11
FN357299_30(FN357299|pid:none) Schistosoma mansoni genome sequen... 71 7e-11
CR382139_99(CR382139|pid:none) Debaryomyces hansenii strain CBS7... 70 9e-11
DQ100316_1(DQ100316|pid:none) Uta stansburiana gustducin mRNA, c... 70 9e-11
AY634286_1(AY634286|pid:none) Caenorhabditis briggsae strain AF1... 70 1e-10
AF329891_1(AF329891|pid:none) Pisolithus sp. 441 G protein alpha... 70 1e-10
AE013599_1606(AE013599|pid:none) Drosophila melanogaster chromos... 70 2e-10
FN357726_16(FN357726|pid:none) Schistosoma mansoni genome sequen... 70 2e-10
AY091588_1(AY091588|pid:none) Cryphonectria parasitica G-protein... 70 2e-10
(Q86FX7) RecName: Full=Guanine nucleotide-binding protein alpha-... 70 2e-10
AF200339_1(AF200339|pid:none) Gallus gallus cone-type transducin... 69 2e-10
(P54853) RecName: Full=Guanine nucleotide-binding protein subuni... 69 2e-10
AM920428_1167(AM920428|pid:none) Penicillium chrysogenum Wiscons... 69 2e-10
U64319_1(U64319|pid:none) Dictyostelium discoideum GTP-binding p... 69 2e-10
BT045919_1(BT045919|pid:none) Salmo salar clone ssal-rgf-536-281... 69 2e-10
AF157496_1(AF157496|pid:none) Suillus bovinus heterotrimeric G p... 69 3e-10
(O74259) RecName: Full=Guanine nucleotide-binding protein subuni... 69 3e-10
AM888285_1(AM888285|pid:none) Sordaria macrospora gsa1 gene for ... 69 3e-10
L47105_1(L47105|pid:none) Kluyveromyces lactis G protein alpha s... 69 3e-10
CU928169_56(CU928169|pid:none) Kluyveromyces thermotolerans stra... 69 3e-10
(P28052) RecName: Full=Guanine nucleotide-binding protein alpha-... 69 4e-10
(P30676) RecName: Full=Guanine nucleotide-binding protein G(i) s... 69 4e-10
AY634289_1(AY634289|pid:none) Caenorhabditis briggsae strain AF1... 69 4e-10
AY168002_1(AY168002|pid:none) Hypocrea virens G protein alpha su... 69 4e-10
(Q60W52) RecName: Full=Guanine nucleotide-binding protein alpha-... 69 4e-10
(Q05425) RecName: Full=Guanine nucleotide-binding protein alpha-... 69 4e-10
(Q05337) RecName: Full=Guanine nucleotide-binding protein G(f) s... 69 4e-10
S27015(S27015;S25590)GTP-binding regulatory protein Gs alpha cha... 69 4e-10
BT044658_1(BT044658|pid:none) Salmo salar clone ssal-rgf-002-092... 68 5e-10
FJ230780_1(FJ230780|pid:none) Arthrobotrys oligospora G protein ... 68 5e-10
AY603976_1(AY603976|pid:none) Sitobion avenae guanine nucleotide... 68 5e-10
DQ458050_1(DQ458050|pid:none) Mycosphaerella graminicola G-prote... 68 6e-10
BC016995_1(BC016995|pid:none) Homo sapiens guanine nucleotide bi... 68 6e-10
CP000498_625(CP000498|pid:none) Pichia stipitis CBS 6054 chromos... 68 6e-10
AY036905_1(AY036905|pid:none) Trichoderma atroviride protein GTP... 68 6e-10
AK302330_1(AK302330|pid:none) Homo sapiens cDNA FLJ61190 complet... 68 6e-10
AK096299_1(AK096299|pid:none) Homo sapiens cDNA FLJ38980 fis, cl... 68 6e-10
(Q61MC6) RecName: Full=Guanine nucleotide-binding protein alpha-... 67 8e-10
AF407334_1(AF407334|pid:none) Lentinula edodes guanine nucleotid... 67 8e-10
AY391429_1(AY391429|pid:none) Danio rerio guanine nucleotide bin... 67 8e-10
L79908_1(L79908|pid:none) Takifugu rubripes G protein alpha subu... 67 8e-10
AY170625_1(AY170625|pid:none) Penicillium marneffei G protein al... 67 8e-10
M20596_1(M20596|pid:none) Human Gi1 protein alpha subunit gene, ... 67 8e-10
AF306530_1(AF306530|pid:none) Schizophyllum commune heterotrimer... 67 8e-10
AF011341_1(AF011341|pid:none) Magnaporthe grisea G alpha subunit... 67 1e-09
AY301989_1(AY301989|pid:none) Penicillium marneffei G-alpha subu... 67 1e-09
AX885133_1(AX885133|pid:none) Sequence 996 from Patent EP1033401. 67 1e-09
(Q9TU29) RecName: Full=Guanine nucleotide-binding protein subuni... 67 1e-09
(O13315) RecName: Full=Guanine nucleotide-binding protein subuni... 67 1e-09
CQ830630_1(CQ830630|pid:none) Sequence 1 from Patent WO2004055048. 67 1e-09
AK291329_1(AK291329|pid:none) Homo sapiens cDNA FLJ76843 complet... 67 1e-09
FJ455134_1(FJ455134|pid:none) Gibberella moniliformis G protein ... 67 1e-09
(P30679) RecName: Full=Guanine nucleotide-binding protein subuni... 67 1e-09
AL671854_11(AL671854|pid:none) Mouse DNA sequence from clone RP2... 66 2e-09
(Q20907) RecName: Full=Guanine nucleotide-binding protein alpha-... 66 2e-09
DQ458049_1(DQ458049|pid:none) Mycosphaerella graminicola G-prote... 66 2e-09
(O42784) RecName: Full=Guanine nucleotide-binding protein subuni... 66 2e-09
AP007161_483(AP007161|pid:none) Aspergillus oryzae RIB40 genomic... 66 2e-09
AM270019_27(AM270019|pid:none) Aspergillus niger contig An02c024... 66 2e-09
AY219895_1(AY219895|pid:none) Cryptococcus neoformans var. grubi... 66 2e-09
U30792_1(U30792|pid:none) Pneumocystis carinii guanine nucleotid... 65 3e-09
(Q00743) RecName: Full=Guanine nucleotide-binding protein subuni... 65 3e-09
AB083069_1(AB083069|pid:none) Halocynthia roretzi HrGn gene for ... 65 3e-09
BC170038_1(BC170038|pid:none) Xenopus laevis GNAS complex locus,... 65 3e-09
AF011342_1(AF011342|pid:none) Magnaporthe grisea G alpha subunit... 65 3e-09
BC076540_1(BC076540|pid:none) Danio rerio zgc:92392, mRNA (cDNA ... 65 4e-09
(Q21917) RecName: Full=Guanine nucleotide-binding protein alpha-... 65 4e-09
AY576989_1(AY576989|pid:none) Danio rerio clone RK054A1C04 GNAS ... 65 4e-09
(P24799) RecName: Full=Guanine nucleotide-binding protein G(s) s... 65 4e-09
EF188807_1(EF188807|pid:none) Bombyx mori strain P50 G protein a... 65 5e-09
AY357297_1(AY357297|pid:none) Cryptococcus neoformans var. grubi... 65 5e-09
AM920433_161(AM920433|pid:none) Penicillium chrysogenum Wisconsi... 65 5e-09
AY814015_1(AY814015|pid:none) Schistosoma japonicum SJCHGC05797 ... 64 7e-09
BC077141_1(BC077141|pid:none) Danio rerio zgc:100942, mRNA (cDNA... 64 7e-09
DQ863321_1(DQ863321|pid:none) Penicillium marneffei GPA2-like pr... 64 7e-09
AF448796_1(AF448796|pid:none) Penicillium marneffei G-alpha subu... 64 7e-09
FN318225_1(FN318225|pid:none) Schistosoma japonicum isolate Anhu... 64 7e-09
AE017341_175(AE017341|pid:none) Cryptococcus neoformans var. neo... 64 7e-09
AB051904_1(AB051904|pid:none) Schizophyllum commune ScGP-C gene ... 64 9e-09
AF370014_1(AF370014|pid:none) Leptosphaeria maculans G-protein a... 64 9e-09
(O74227) RecName: Full=Guanine nucleotide-binding protein subuni... 64 9e-09
FJ230781_1(FJ230781|pid:none) Drechslerella dactyloides G protei... 64 9e-09
AP007151_631(AP007151|pid:none) Aspergillus oryzae RIB40 genomic... 64 9e-09
AB239917_1(AB239917|pid:none) Alternaria alternata AGA1 gene for... 64 9e-09
AY550248_1(AY550248|pid:none) Paracoccidioides brasiliensis smal... 64 9e-09
(Q292P9) RecName: Full=Guanine nucleotide-binding protein G(s) s... 64 1e-08
AM270168_167(AM270168|pid:none) Aspergillus niger contig An08c01... 64 1e-08
AJ294815_1(AJ294815|pid:none) Tapesia yallundae tyg1 gene for G ... 64 1e-08
AY292281_1(AY292281|pid:none) Synthetic construct rod transducin... 64 1e-08
(P52206) RecName: Full=Guanine nucleotide-binding protein subuni... 64 1e-08
AE013599_3968(AE013599|pid:none) Drosophila melanogaster chromos... 63 2e-08
FJ882150_1(FJ882150|pid:none) Pleurotus abalonus strain YMF1.020... 63 2e-08
AY634306_1(AY634306|pid:none) Caenorhabditis briggsae strain AF1... 63 2e-08
T32578(T32578)hypothetical protein T07A9.7 - Caenorhabditis eleg... 63 2e-08
(Q9BIG5) RecName: Full=Guanine nucleotide-binding protein alpha-... 63 2e-08
(Q9XZV5) RecName: Full=Guanine nucleotide-binding protein G(s) s... 63 2e-08
M13964_1(M13964|pid:none) Mouse stimulatory G protein of adenyla... 63 2e-08
AE016815_371(AE016815|pid:none) Ashbya gossypii (= Eremothecium ... 63 2e-08
AL593857_10(AL593857|pid:none) Mouse DNA sequence from clone RP2... 63 2e-08
AL953843_1(AL953843|pid:none) Zebrafish DNA sequence from clone ... 63 2e-08
FN357327_58(FN357327|pid:none) Schistosoma mansoni genome sequen... 63 2e-08
AB003486_1(AB003486|pid:none) Caenorhabditis elegans mRNA for G ... 62 3e-08
(Q4VT31) RecName: Full=Guanine nucleotide-binding protein alpha-... 62 3e-08
FN357329_24(FN357329|pid:none) Schistosoma mansoni genome sequen... 62 3e-08
(P34042) RecName: Full=Guanine nucleotide-binding protein alpha-... 62 3e-08
AK300481_1(AK300481|pid:none) Homo sapiens cDNA FLJ56720 complet... 62 3e-08
AB045579_1(AB045579|pid:none) Rosellinia necatrix WGA3 gene for ... 62 3e-08
(P30669) RecName: Full=Guanine nucleotide-binding protein G(s) s... 62 4e-08
AF135552_1(AF135552|pid:none) Kluyveromyces lactis heterotrimeri... 62 4e-08
(P30678) RecName: Full=Guanine nucleotide-binding protein subuni... 62 4e-08
(Q9Y7B7) RecName: Full=Guanine nucleotide-binding protein alpha-... 62 4e-08
(Q9N2V6) RecName: Full=Guanine nucleotide-binding protein alpha-... 61 6e-08
BC063735_1(BC063735|pid:none) Xenopus laevis hypothetical protei... 61 6e-08
CR380952_270(CR380952|pid:none) Candida glabrata strain CBS138 c... 61 6e-08
AY327542_1(AY327542|pid:none) Phaeosphaeria nodorum G-alpha subu... 61 6e-08
BC066923_1(BC066923|pid:none) Homo sapiens GNAS complex locus, m... 61 7e-08
AL109840_15(AL109840|pid:none) Human DNA sequence from clone RP4... 61 7e-08
AL109840_26(AL109840|pid:none) Human DNA sequence from clone RP4... 61 7e-08
CR956413_7(CR956413|pid:none) Pig DNA sequence from clone CH242-... 61 7e-08
AY248719_1(AY248719|pid:none) Oryctolagus cuniculus guanine nucl... 61 7e-08
AB047087_1(AB047087|pid:none) Halocynthia roretzi HrGs mRNA for ... 61 7e-08
(P29797) RecName: Full=Guanine nucleotide-binding protein G(s) s... 61 7e-08
(O16118) RecName: Full=Guanine nucleotide-binding protein G(s) s... 61 7e-08
BC022875_1(BC022875|pid:none) Homo sapiens, Similar to GNAS comp... 60 1e-07
(Q54R41) RecName: Full=Guanine nucleotide-binding protein alpha-... 60 1e-07
AJ294816_1(AJ294816|pid:none) Tapesia yallundae tyg2 gene for G ... 60 1e-07
AY534105_1(AY534105|pid:none) Strongylocentrotus purpuratus guan... 60 2e-07
(Q7PD79) RecName: Full=Guanine nucleotide-binding protein G(s) s... 60 2e-07
AF157495_1(AF157495|pid:none) Schizophyllum commune heterotrimer... 60 2e-07
CP000496_1010(CP000496|pid:none) Pichia stipitis CBS 6054 chromo... 59 2e-07
EF095216_1(EF095216|pid:none) Daucus carota GTP-binding protein ... 59 2e-07
(Q93743) RecName: Full=Guanine nucleotide-binding protein alpha-... 59 2e-07
(P34043) RecName: Full=Guanine nucleotide-binding protein alpha-... 59 2e-07
AB274829_1(AB274829|pid:none) Capra hircus Golf mRNA for guanine... 59 2e-07
(P08539) RecName: Full=Guanine nucleotide-binding protein alpha-... 59 3e-07
(P87032) RecName: Full=Guanine nucleotide-binding protein alpha-... 59 3e-07
CR382136_587(CR382136|pid:none) Debaryomyces hansenii strain CBS... 59 4e-07
A41106(A41106) GTP-binding protein alpha chain gpa1 - fission ye... 59 4e-07
FJ654726_1(FJ654726|pid:none) Chrysomela tremulae G protein alph... 59 4e-07
AK035320_1(AK035320|pid:none) Mus musculus adult male urinary bl... 59 4e-07
CQ760002_1(CQ760002|pid:none) Sequence 28 from Patent EP1382613. 59 4e-07
(P27584) RecName: Full=Guanine nucleotide-binding protein alpha-... 59 4e-07
AL593857_5(AL593857|pid:none) Mouse DNA sequence from clone RP23... 58 5e-07
BC078439_1(BC078439|pid:none) Mus musculus guanine nucleotide bi... 58 5e-07
BC026342_1(BC026342|pid:none) Homo sapiens guanine nucleotide bi... 58 5e-07
BC050021_1(BC050021|pid:none) Homo sapiens guanine nucleotide bi... 58 5e-07
BC037333_1(BC037333|pid:none) Homo sapiens guanine nucleotide bi... 58 5e-07
BC168579_1(BC168579|pid:none) Xenopus tropicalis cDNA clone MGC:... 58 5e-07
BC085540_1(BC085540|pid:none) Danio rerio guanine nucleotide bin... 58 5e-07
AF116268_1(AF116268|pid:none) Mus musculus G-protein XLalphas mR... 58 5e-07
AK158831_1(AK158831|pid:none) Mus musculus visual cortex cDNA, R... 58 5e-07
(P26981) RecName: Full=Guanine nucleotide-binding protein alpha-... 58 5e-07
AK147051_1(AK147051|pid:none) Mus musculus cDNA, RIKEN full-leng... 58 5e-07
(P19086) RecName: Full=Guanine nucleotide-binding protein G(z) s... 58 6e-07
AL671854_12(AL671854|pid:none) Mouse DNA sequence from clone RP2... 58 6e-07
AY650382_1(AY650382|pid:none) Macaca fascicularis guanine nucleo... 58 6e-07
D90150_1(D90150|pid:none) Homo sapiens Gx-alpha gene for pertuss... 58 6e-07
(Q60XS3) RecName: Full=Guanine nucleotide-binding protein alpha-... 58 6e-07
BT059303_1(BT059303|pid:none) Salmo salar clone ssal-rgf-540-070... 58 6e-07
(P19627) RecName: Full=Guanine nucleotide-binding protein G(z) s... 57 8e-07
M17414_1(M17414|pid:none) Saccharomyces cerevisiae SCG1 gene enc... 57 8e-07
DQ082154_1(DQ082154|pid:none) Paradoxurus hermaphroditus GNAZ (G... 57 8e-07
FN318224_1(FN318224|pid:none) Schistosoma japonicum isolate Anhu... 57 8e-07
DQ082114_1(DQ082114|pid:none) Felis catus GNAZ (GNAZ) gene, part... 57 8e-07
BC106133_1(BC106133|pid:none) Mus musculus GNAS (guanine nucleot... 57 8e-07
CR382127_296(CR382127|pid:none) Yarrowia lipolytica strain CLIB1... 57 8e-07
DQ082152_1(DQ082152|pid:none) Prionodon linsang GNAZ (GNAZ) gene... 57 8e-07
EU069505_1(EU069505|pid:none) Sorghum bicolor G protein alpha su... 57 1e-06
AE016817_554(AE016817|pid:none) Ashbya gossypii (= Eremothecium ... 57 1e-06
BC122955_1(BC122955|pid:none) Xenopus tropicalis hypothetical pr... 57 1e-06
(Q4VT38) RecName: Full=Guanine nucleotide-binding protein alpha-... 57 1e-06
BT060740_1(BT060740|pid:none) Zea mays full-length cDNA clone ZM... 57 1e-06
BC149402_1(BC149402|pid:none) Bos taurus guanine nucleotide bind... 57 1e-06
CR956413_6(CR956413|pid:none) Pig DNA sequence from clone CH242-... 56 2e-06
(O70443) RecName: Full=Guanine nucleotide-binding protein G(z) s... 56 2e-06
(Q20910) RecName: Full=Guanine nucleotide-binding protein alpha-... 56 2e-06
AL109840_3(AL109840|pid:none) Human DNA sequence from clone RP4-... 56 2e-06
AF056973_1(AF056973|pid:none) Mus musculus GTP binding protein G... 56 2e-06
CU459096_4(CU459096|pid:none) Zebrafish DNA sequence from clone ... 56 2e-06
AF267485_1(AF267485|pid:none) Hordeum vulgare G protein alpha su... 56 2e-06
AB066591_1(AB066591|pid:none) Nicotiana tabacum NtGA2 gene for h... 56 2e-06
AL121917_14(AL121917|pid:none) Human DNA sequence from clone RP1... 56 2e-06
EU489474_1(EU489474|pid:none) Scoparia dulcis heterotrimeric GTP... 56 2e-06
D87723(D87723)protein R06A10.2 [imported] - Caenorhabditis elegans 56 2e-06
AY815795_1(AY815795|pid:none) Schistosoma japonicum SJCHGC09316 ... 55 3e-06
CU928181_26(CU928181|pid:none) Zygosaccharomyces rouxii strain C... 55 3e-06
AB066592_1(AB066592|pid:none) Nicotiana tabacum NtGA1 gene for h... 55 3e-06
AF249742_1(AF249742|pid:none) Nicotiana tabacum heterotrimeric G... 55 3e-06
AB066594_1(AB066594|pid:none) Nicotiana tomentosiformis NtGA2t g... 55 3e-06
(O04279) RecName: Full=Guanine nucleotide-binding protein alpha-... 55 3e-06
AY534101_1(AY534101|pid:none) Strongylocentrotus purpuratus guan... 55 3e-06
AF533439_1(AF533439|pid:none) Pisum sativum G protein alpha II s... 55 3e-06
AY386360_1(AY386360|pid:none) Danio rerio G-protein alpha 13a mR... 55 4e-06
BX649295_4(BX649295|pid:none) Zebrafish DNA sequence from clone ... 55 4e-06
BC095814_1(BC095814|pid:none) Danio rerio guanine nucleotide bin... 55 4e-06
AY063128_1(AY063128|pid:none) Solanum tuberosum G protein alpha ... 55 4e-06
AY371698_1(AY371698|pid:none) Cryptococcus neoformans var. grubi... 55 4e-06
L28001_1(L28001|pid:none) Rice G protein alpha-subunit (RGA1) mR... 55 4e-06
GQ223793_1(GQ223793|pid:none) Nicotiana benthamiana heterotrimer... 55 4e-06
(P93564) RecName: Full=Guanine nucleotide-binding protein alpha-... 55 4e-06
AF533438_1(AF533438|pid:none) Pisum sativum G protein alpha II s... 55 4e-06
CU928167_40(CU928167|pid:none) Kluyveromyces thermotolerans stra... 55 5e-06
AY534102_1(AY534102|pid:none) Lytechinus variegatus guanine nucl... 55 5e-06
T23705(T23705)hypothetical protein M04C7.1 - Caenorhabditis eleg... 54 7e-06
AP008211_854(AP008211|pid:none) Oryza sativa (japonica cultivar-... 54 7e-06
(P25157) RecName: Full=Guanine nucleotide-binding protein subuni... 54 7e-06
(Q63803) RecName: Full=Guanine nucleotide-binding protein G(s) s... 54 9e-06
X84047_1(X84047|pid:none) Rattus norvegicus mRNA for XLalphas pr... 54 9e-06
AK168996_1(AK168996|pid:none) Mus musculus 17 days embryo stomac... 54 9e-06
(Q6R0H7) RecName: Full=Guanine nucleotide-binding protein G(s) s... 54 9e-06
(Q61DE0) RecName: Full=Guanine nucleotide-binding protein alpha-... 54 9e-06
(P63093) RecName: Full=Guanine nucleotide-binding protein G(s) s... 54 9e-06
S52418(S52418)GTP-binding regulatory protein Gs alpha-XL chain -... 54 9e-06
AK032407_1(AK032407|pid:none) Mus musculus adult male olfactory ... 54 1e-05
T09152(T09152) GTP-binding regulatory protein alpha chain - spin... 54 1e-05
EU142021_1(EU142021|pid:none) Phaseolus vulgaris hetrotrimeric G... 54 1e-05
A46393(A46393)GTP-binding protein alpha chain gpa2 - fission yea... 53 2e-05
(Q04665) RecName: Full=Guanine nucleotide-binding protein alpha-... 53 2e-05
FM992692_479(FM992692|pid:none) Candida dubliniensis CD36 chromo... 53 2e-05
(P27600) RecName: Full=Guanine nucleotide-binding protein subuni... 52 3e-05
(Q63210) RecName: Full=Guanine nucleotide-binding protein subuni... 52 3e-05
(P34044) RecName: Full=Guanine nucleotide-binding protein alpha-... 52 3e-05
AF493901_1(AF493901|pid:none) Homo sapiens guanine nucleotide bi... 52 3e-05
S56670(S56670;S56669)GTP-binding regulatory protein alpha chain ... 52 3e-05
(P22454) RecName: Full=Guanine nucleotide-binding protein alpha-... 52 3e-05
(P27601) RecName: Full=Guanine nucleotide-binding protein subuni... 52 3e-05
AK149766_1(AK149766|pid:none) Mus musculus bone marrow macrophag... 52 3e-05
U11249_1(U11249|pid:none) Sus scrofa Gi-alpha-1 protein mRNA, pa... 52 3e-05
AY892114_1(AY892114|pid:none) Synthetic construct Homo sapiens c... 52 3e-05
AY376066_1(AY376066|pid:none) Bos taurus guanine nucleotide bind... 52 3e-05
X07036_1(X07036|pid:none) Human mRNA stimulatory GTP-binding pro... 52 3e-05
RGMSA2(S03075) GTP-binding regulatory protein Gs alpha-S2 chain ... 52 3e-05
(P04896) RecName: Full=Guanine nucleotide-binding protein G(s) s... 52 3e-05
AL109840_17(AL109840|pid:none) Human DNA sequence from clone RP4... 52 3e-05
CR956413_3(CR956413|pid:none) Pig DNA sequence from clone CH242-... 52 3e-05
AC004933_1(AC004933|pid:none) Homo sapiens PAC clone RP5-952L21 ... 52 3e-05
(Q03113) RecName: Full=Guanine nucleotide-binding protein subuni... 52 3e-05
(P18064) RecName: Full=Guanine nucleotide-binding protein alpha-... 52 3e-05
AL109840_2(AL109840|pid:none) Human DNA sequence from clone RP4-... 52 5e-05
AB234091_1(AB234091|pid:none) Phaseolus lunatus PlGPA2 mRNA for ... 52 5e-05
AL109840_22(AL109840|pid:none) Human DNA sequence from clone RP4... 52 5e-05
DQ202707_1(DQ202707|pid:none) Cricetulus griseus guanine nucleot... 52 5e-05
(P49082) RecName: Full=Guanine nucleotide-binding protein alpha-... 51 6e-05
BT073829_1(BT073829|pid:none) Oncorhynchus mykiss clone omyk-evo... 51 6e-05
(P49084) RecName: Full=Guanine nucleotide-binding protein alpha-... 51 6e-05
BC134004_1(BC134004|pid:none) Danio rerio guanine nucleotide bin... 51 8e-05
CU462975_6(CU462975|pid:none) Zebrafish DNA sequence from clone ... 51 8e-05
AY812492_1(AY812492|pid:none) Schistosoma japonicum SJCHGC04031 ... 51 8e-05
BC087537_1(BC087537|pid:none) Homo sapiens guanine nucleotide bi... 50 1e-04
BC088948_1(BC088948|pid:none) Xenopus laevis hypothetical LOC496... 50 1e-04
(Q54VG1) RecName: Full=Guanine nucleotide-binding protein alpha-... 50 1e-04
(Q40224) RecName: Full=Guanine nucleotide-binding protein alpha-... 50 1e-04
AK011851_1(AK011851|pid:none) Mus musculus 10 days embryo whole ... 50 2e-04
(Q14344) RecName: Full=Guanine nucleotide-binding protein subuni... 50 2e-04
AK159563_1(AK159563|pid:none) Mus musculus osteoclast-like cell ... 50 2e-04
(Q19572) RecName: Full=Guanine nucleotide-binding protein alpha-... 50 2e-04
BC057665_1(BC057665|pid:none) Mus musculus guanine nucleotide bi... 49 2e-04
AY232211_1(AY232211|pid:none) Drosophila yakuba clone yak-ad_cta... 49 4e-04
BC161136_1(BC161136|pid:none) Xenopus tropicalis hypothetical pr... 48 5e-04
EU142020_1(EU142020|pid:none) Phaseolus vulgaris hetrotrimeric G... 48 7e-04
AF107844_2(AF107844|pid:none) Rattus norvegicus neuroendocrine-s... 48 7e-04
AL121917_7(AL121917|pid:none) Human DNA sequence from clone RP1-... 47 0.001
A46685(A46685) GTP-binding regulatory protein Gs alpha, form N1 ... 47 0.001
AL121917_6(AL121917|pid:none) Human DNA sequence from clone RP1-... 47 0.001
AL109840_4(AL109840|pid:none) Human DNA sequence from clone RP4-... 47 0.001
CR956413_12(CR956413|pid:none) Pig DNA sequence from clone CH242... 47 0.001
BC036081_1(BC036081|pid:none) Homo sapiens GNAS complex locus, m... 47 0.001
AK304473_1(AK304473|pid:none) Homo sapiens cDNA FLJ61561 complet... 47 0.001
(Q4VT35) RecName: Full=Guanine nucleotide-binding protein alpha-... 47 0.001
AK126708_1(AK126708|pid:none) Homo sapiens cDNA FLJ44754 fis, cl... 47 0.001
AF003739_2(AF003739|pid:none) Caenorhabditis elegans cosmid M01D... 46 0.002
AB066285_1(AB066285|pid:none) Ciona intestinalis CiGi2 for G pro... 45 0.004
AB006549_1(AB006549|pid:none) Ephydatia fluviatilis mRNA for G p... 44 0.009
AY542969_1(AY542969|pid:none) Bigelowiella natans guanine nucleo... 43 0.016
CP001141_76(CP001141|pid:none) Phaeodactylum tricornutum CCAP 10... 43 0.016
AJ880000_1(AJ880000|pid:none) Triticum durum partial mRNA for G ... 43 0.016
AJ879999_1(AJ879999|pid:none) Triticum durum partial mRNA for G ... 43 0.016
AF010476_1(AF010476|pid:none) Avena fatua Af12-amino acid (Af12-... 43 0.021
S34421(S34421;S40964) GTP-binding regulatory protein Gs alpha ch... 43 0.021
BT001768_1(BT001768|pid:none) Drosophila melanogaster RH09776 fu... 43 0.021
DQ092852_1(DQ092852|pid:none) Phytophthora alni subsp. alni isol... 42 0.027
S49985_1(S49985|pid:none) transducin alpha subunit homolog {clon... 42 0.036
S49982_1(S49982|pid:none) inhibitory G protein alpha subunit {cl... 42 0.036
AB006545_1(AB006545|pid:none) Ephydatia fluviatilis mRNA for G p... 42 0.036
AB192569_1(AB192569|pid:none) Lyophyllum shimeji gpa1 gene for g... 42 0.036
BC030027_1(BC030027|pid:none) Homo sapiens guanine nucleotide bi... 42 0.036
S49984_1(S49984|pid:none) transducin alpha subunit homolog {clon... 42 0.047
AB066284_1(AB066284|pid:none) Ciona intestinalis CiGq for G prot... 42 0.047
AF157566_1(AF157566|pid:none) Cricetulus griseus guanine nucleot... 42 0.047
AX657506_1(AX657506|pid:none) Sequence 89 from Patent WO03000893. 41 0.080
EU020934_1(EU020934|pid:none) Antheraea paukstadtorum clone Apau... 40 0.10
AB006550_1(AB006550|pid:none) Ephydatia fluviatilis mRNA for G p... 39 0.23
AP008217_470(AP008217|pid:none) Oryza sativa (japonica cultivar-... 39 0.40
AJ310909_1(AJ310909|pid:none) Mucor racemosus partial gpa2 gene ... 39 0.40
AK069964_1(AK069964|pid:none) Oryza sativa Japonica Group cDNA c... 39 0.40
JH0247(JH0247)guanine nucleotide-binding protein alpha-6 chain -... 38 0.68
(P34046) RecName: Full=Guanine nucleotide-binding protein alpha-... 38 0.68
T29826(T29826)hypothetical protein C55H1.2 - Caenorhabditis eleg... 38 0.68
FJ374687_1(FJ374687|pid:none) Spodoptera frugiperda heterotrimer... 38 0.68
(Q4VT42) RecName: Full=Guanine nucleotide-binding protein alpha-... 38 0.68
CP000937_1365(CP000937|pid:none) Francisella philomiragia subsp.... 37 0.88
CP001147_1631(CP001147|pid:none) Thermodesulfovibrio yellowstoni... 37 0.88
AB066283_1(AB066283|pid:none) Ciona intestinalis CiGx forG prote... 37 0.88
(Q86D96) RecName: Full=Guanine nucleotide-binding protein subuni... 37 1.2
S16961(S16961)GTP-binding protein - bovine (fragments) 37 1.2
AP008216_51(AP008216|pid:none) Oryza sativa (japonica cultivar-g... 37 1.2
AE014188_418(AE014188|pid:none) Plasmodium falciparum 3D7 chromo... 37 1.5
EU492905_16(EU492905|pid:none) Francisella piscicida strain GM22... 36 2.0
CU633876_151(CU633876|pid:none) Podospora anserina genomic DNA c... 36 2.0
AE005176_11(AE005176|pid:none) Lactococcus lactis subsp. lactis ... 36 2.6
AB006544_1(AB006544|pid:none) Ephydatia fluviatilis mRNA for G p... 36 2.6
>L33847_1(L33847|pid:none) Dictyostelium discoideum G protein alpha-7
subunit mRNA, complete cds.
Length = 390
Score = 285 bits (729), Expect = 2e-75
Identities = 152/189 (80%), Positives = 152/189 (80%)
Frame = +1
Query: 481 ATPAIQVNGNQXXXXXXXXXXXXXXXXXXXXXXXXRYREQKAVNXXXXXXXXXXXXXMDS 660
ATPAIQVNGNQ RYREQKAVN MDS
Sbjct: 11 ATPAIQVNGNQSSSPQSPSSSTSTLSPPMSPSLLTRYREQKAVNKQIEKQLKEEKKIMDS 70
Query: 661 ELKLLLLGTGDSGKSTVVKQMKILHLEGYSQEERINQRQFVYRNIIEIAYSIIRGCGVLN 840
ELKLLLLGTGDSGKSTVVKQMKILHLEGYSQEERINQRQFVYRNIIEIAYSIIRGCGVLN
Sbjct: 71 ELKLLLLGTGDSGKSTVVKQMKILHLEGYSQEERINQRQFVYRNIIEIAYSIIRGCGVLN 130
Query: 841 LTIPSQFDSICSSIEEIYETKNYTNLDKNVLKGVAELSKNESFINAANNSGSNFQLHSSS 1020
LTIPSQFDSICSSIEEIYETKNYTNLDKNVLKGVAELSKNESFINAANNSGSNFQLHSSS
Sbjct: 131 LTIPSQFDSICSSIEEIYETKNYTNLDKNVLKGVAELSKNESFINAANNSGSNFQLHSSS 190
Query: 1021 QYFLDDIAR 1047
QYFLDDIAR
Sbjct: 191 QYFLDDIAR 199
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3236559
Number of Hits to DB: 936,365,348
Number of extensions: 13621994
Number of successful extensions: 44574
Number of sequences better than 10.0: 510
Number of HSP's gapped: 44269
Number of HSP's successfully gapped: 510
Length of query: 349
Length of database: 1,051,180,864
Length adjustment: 129
Effective length of query: 220
Effective length of database: 633,664,753
Effective search space: 139406245660
Effective search space used: 139406245660
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 32 (16.9 bits)
|
| PSORT |
|
| VS (DIR, S) |
1 |
| VH (FL, L) |
0 |
| VF (FL, S) |
0 |
| AH (FL, L) |
0 |
| AF (FL, S) |
1 |
| SL (DIR, L) |
0 |
| SS (DIR, S) |
1 |
| SH (FL, L) |
0 |
| SF (FL, S) |
0 |
| CH (FL, L) |
1 |
| CF (FL, S) |
0 |
| FCL (DIR, L) |
0 |
| FC (DIR, S) |
0 |
| FC-IC (SUB) |
0 |