| Contig-U14970-1 |
| Contig ID |
Contig-U14970-1 |
| Contig update |
2004. 6.11 |
| Contig sequence |
 |
| Gap |
no gap |
| Contig length |
1525 |
| Chromosome number (1..6, M) |
1 |
| Chromosome length |
4919822 |
| Start point |
2210192 |
| End point |
2208667 |
| Strand (PLUS/MINUS) |
MINUS |
| Number of clones |
4 |
| Number of EST |
6 |
| Link to clone list |
U14970 |
| List of clone(s) |
|
| Translated Amino Acid sequence |
|
| Translated Amino Acid sequence (All Frames) |
|
| own update |
2004. 6.23 |
| Homology vs CSM-cDNA |
|
| dna update |
2009. 1. 7 |
| Homology vs DNA |
Query= Contig-U14970-1 (Contig-U14970-1Q) /CSM_Contig/Contig-U14970-1Q.Seq.d
(1525 letters)
Database: ddbj_A
92,845,959 sequences; 95,242,211,685 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value N
(BJ430205) Dictyostelium discoideum cDNA clone:ddv6o08, 3' e... 1433 0.0 1
(AY466382) Dictyostelium discoideum uridine kinase uracil ph... 930 0.0 4
(C90548) Dictyostelium discoideum slug cDNA, clone SSI709. 898 0.0 1
(BJ325255) Dictyostelium discoideum cDNA clone:dda13d14, 5' ... 870 0.0 3
(BJ324969) Dictyostelium discoideum cDNA clone:dda8n24, 5' e... 858 0.0 1
(BJ411954) Dictyostelium discoideum cDNA clone:ddv6o08, 5' e... 856 0.0 1
(C92154) Dictyostelium discoideum slug cDNA, clone SSD154. 831 0.0 1
(BJ416827) Dictyostelium discoideum cDNA clone:ddv27o08, 5' ... 781 0.0 3
(BJ341963) Dictyostelium discoideum cDNA clone:dda8n24, 3' e... 587 e-163 1
(AU073908) Dictyostelium discoideum slug cDNA, clone SSI709. 452 e-122 1
(C93904) Dictyostelium discoideum slug cDNA, clone SSL849. 103 3e-31 2
(DY886271) CeleSEQ1856 Cunninghamella elegans pBluescript (E... 54 1e-22 6
(DY894946) CeleSEQ14640 Cunninghamella elegans pBluescript (... 54 9e-20 4
(DY893254) CeleSEQ12540 Cunninghamella elegans pBluescript (... 54 1e-19 4
(FE265267) CAZO4378.fwd CAZO Naegleria gruberi Flagellate St... 54 6e-11 3
(CX084095) EHABL63TR E. histolytica Normalized cDNA library ... 46 6e-07 3
(FE265266) CAZO4378.rev CAZO Naegleria gruberi Flagellate St... 46 2e-06 3
(AC117070) Dictyostelium discoideum chromosome 2 map 2097701... 42 2e-06 9
(DV185842) CT055_A11_CT055_3700_91.ab1 C. tentans tissue cul... 48 2e-06 2
(BT022059) Arabidopsis thaliana At4g26510 gene, complete cds. 40 7e-06 5
(AK228608) Arabidopsis thaliana mRNA for uracil phosphoribos... 40 2e-05 5
(BT005738) Arabidopsis thaliana clone RAFL15-43-C05 (R20963)... 40 2e-05 5
(AY086133) Arabidopsis thaliana clone 21702 mRNA, complete s... 40 2e-05 5
(AE017198) Lactobacillus johnsonii NCC 533, complete genome. 44 5e-05 2
(AX926713) Sequence 3 from Patent WO03084989. 44 5e-05 2
(DQ642846) Plasmodium falciparum HB3 apicoplast, complete ge... 40 2e-04 6
(BD455614) Listeria monocytogenes genome,polypeptides and uses. 42 2e-04 2
(AX641669) Sequence 2859 from Patent WO0101118. 42 2e-04 2
(AX641668) Sequence 2858 from Patent WO0101118. 42 2e-04 2
(AL591979) Listeria monocytogenes strain EGD, complete genom... 42 2e-04 2
(DB737188) Apis mellifera head cDNA, RIKEN full-length enric... 58 0.001 1
(AY814437) Schistosoma japonicum SJCHGC07127 protein mRNA, c... 42 0.002 2
(CV699036) SJS_042_71.T3 SJS Schistosoma japonicum cDNA, mRN... 42 0.002 2
(CD452276) USDA-FP_104703 Adult Alate Brown Citrus Aphid Tox... 38 0.002 4
(X95276) Plasmodium falciparum complete gene map of plastid-... 40 0.002 5
(AP007281) Lactobacillus reuteri F275 DNA, complete genome. 38 0.003 2
(CP000705) Lactobacillus reuteri F275, complete genome. 38 0.003 2
(CF452149) EST688494 normalized cDNA library of onion Allium... 46 0.004 3
(DT602018) wmi03-2ms3-g04 Wmi03 Welwitschia mirabilis cDNA c... 38 0.006 3
(DY891097) CeleSEQ7636 Cunninghamella elegans pBluescript (E... 50 0.006 3
(FK020153) GLNDI92TF JCVI-SOY3 Glycine max cDNA 5', mRNA seq... 42 0.015 3
(CU639897) Quercus petreae root EST, clone SSH2GFPL4E01. 40 0.018 2
(CD443682) EL01N0429H10.b Endosperm_4 Zea mays cDNA, mRNA se... 46 0.020 2
(DT748221) EST1182070 Aquilegia cDNA library Aquilegia formo... 42 0.020 2
(DN211928) MEST931_F06.T7-1 UGA-ZmSAM-XZ2 Zea mays cDNA, mRN... 46 0.023 2
(EE034432) ZM_BFc0096D17.r ZM_BFc Zea mays cDNA clone ZM_BFc... 46 0.023 2
(EE045750) ZM_BFc0115J13.r ZM_BFc Zea mays cDNA clone ZM_BFc... 46 0.024 2
(DR820710) ZM_BFb0059G24.r ZM_BFb Zea mays cDNA 5', mRNA seq... 46 0.024 2
(DR914923) EST1106462 Aquilegia cDNA library Aquilegia formo... 42 0.024 2
(EE177727) ZM_BFc0158J03.r ZM_BFc Zea mays cDNA clone ZM_BFc... 46 0.025 2
(DV531643) ZM_BFb0221N24.r ZM_BFb Zea mays cDNA 5', mRNA seq... 46 0.025 2
(DT757821) EST1191670 Aquilegia cDNA library Aquilegia formo... 42 0.026 2
(DT750474) EST1184323 Aquilegia cDNA library Aquilegia formo... 42 0.026 2
(EC888453) ZM_BFc0028E01.r ZM_BFc Zea mays cDNA clone ZM_BFc... 46 0.026 2
(DR912987) EST1104526 Aquilegia cDNA library Aquilegia formo... 42 0.028 2
(DT734480) EST1168330 Aquilegia cDNA library Aquilegia formo... 42 0.029 2
(AE017262) Listeria monocytogenes str. 4b F2365, complete ge... 42 0.035 2
(CP000233) Lactobacillus salivarius UCC118, complete genome. 42 0.036 2
(AX416554) Sequence 3545 from Patent WO0228891. 42 0.048 2
(AX414722) Sequence 1713 from Patent WO0228891. 42 0.049 2
(BT018511) Zea mays clone EL01N0429H10.d mRNA sequence. 46 0.051 2
(CP000742) Methanococcus vannielii SB, complete genome. 34 0.061 21
(AC006369) Homo sapiens BAC clone RP11-278G12 from 2, comple... 52 0.063 1
(EK201730) 1095460058469 Global-Ocean-Sampling_GS-31-01-01-1... 52 0.063 1
(EK131526) 1093009829268 Global-Ocean-Sampling_GS-31-01-01-1... 52 0.063 1
(EK110941) 1092963107413 Global-Ocean-Sampling_GS-31-01-01-1... 52 0.063 1
(AG200184) Pan troglodytes DNA, clone: RP43-082A08.TJ. 52 0.063 1
(X87631) P.falciparum putative plastid clpC gene (partial). 40 0.067 2
(FC817143) Sr_pAMT7_08b05_T7 S. ratti mixed stage pAMP Stron... 38 0.082 4
(FE646985) CBYZ6697.b1 CBYZ Panicum virgatum Kanlow 4 day ol... 40 0.083 2
(FE654753) CBYZ11555.b1 CBYZ Panicum virgatum Kanlow 4 day o... 40 0.089 2
(FE613491) CBYX11445.b1 CBYX Panicum virgatum Kanlow callus ... 40 0.090 2
(AZ672156) ENTKQ88TF Entamoeba histolytica Sheared DNA Entam... 46 0.097 2
(BH136640) ENTOW17TR Entamoeba histolytica Sheared DNA Entam... 46 0.10 2
(BH146387) ENTPP38TF Entamoeba histolytica Sheared DNA Entam... 46 0.10 2
(BI511384) BB160005B10F11.5 Bee Brain Normalized Library, BB... 34 0.11 3
(DY381492) ZO__Eg0009D22.r ZO__Eg Zingiber officinale cDNA c... 40 0.18 3
(AE014845) Plasmodium falciparum 3D7 chromosome 12, section ... 38 0.19 12
(EX631611) 255501850 Pea aphid whole body normalized full le... 40 0.21 3
(FF308258) 279372166 Pea aphid whole body normalized full le... 40 0.22 3
(DR684635) EST1074712 Normalized pine embryo library, Lib_D ... 38 0.22 3
(FF307529) 279368533 Pea aphid whole body normalized full le... 40 0.24 3
(BH770858) LLMGtag596 MG1363 Random Sequence Tag Library Lac... 50 0.25 1
(CB081334) hk49h07.g1 Gnetum leaves (NYBG) Gnetum gnemon cDN... 50 0.25 1
(BP189515) Dugesia japonica cDNA, clone: 06565_HH, expressed... 50 0.25 1
(BP187430) Dugesia japonica cDNA, clone: 00426_HH, expressed... 50 0.25 1
(BP187084) Dugesia japonica cDNA, clone: 00722_HH, expressed... 50 0.25 1
(CP000425) Lactococcus lactis subsp. cremoris SK11, complete... 50 0.25 1
(AM406671) Lactococcus lactis subsp. cremoris MG1363, comple... 50 0.25 1
(FF302644) 279353180 Pea aphid whole body normalized full le... 40 0.25 3
(AR395663) Sequence 1678 from patent US 6617156. 40 0.28 2
(DT632298) EST1147229 Normalized pine embryo library, Lib_D ... 38 0.30 3
(DR052200) RTCA1_3_C01.b1_A029 Roots minus calcium Pinus tae... 34 0.31 3
(FE636386) CBYY13520.b1 CBYY Panicum virgatum Kanlow crown P... 38 0.32 2
(BA000026) Mycoplasma penetrans HF-2 DNA, complete genome. 40 0.39 18
(AL407605) T3 end of clone AV0AA003C11 of library AV0AA from... 48 0.40 2
(AP009932) Lotus japonicus genomic DNA, clone: LjT16B12, TM2... 46 0.44 2
(CP000942) Ureaplasma parvum serovar 3 str. ATCC 27815, comp... 40 0.47 20
(AP010005) Lotus japonicus genomic DNA, chromosome 1, clone:... 36 0.54 8
(BM501354) PAC000000000718 Pioneer AF-1 array Zea mays cDNA,... 40 0.68 2
>(BJ430205) Dictyostelium discoideum cDNA clone:ddv6o08, 3' end,
single read.
Length = 727
Score = 1433 bits (723), Expect = 0.0
Identities = 726/727 (99%)
Strand = Plus / Minus
Query: 799 agatattattgtgccaagaggatcagataatattgttgcaattaatttattaacaaatca 858
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 727 agatattattgtgccaagaggatcagataatattgttgcaattaatttattaacaaatca 668
Query: 859 tattagattaaaattaaaagagagaggatttgattcagaaaagacagcacaattggattt 918
|||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||
Sbjct: 667 tattagattaaaattaaaagagagaggatttgatccagaaaagacagcacaattggattt 608
Query: 919 ggagggattggaattaccaagttcaattcatgtaattaaggaaactaatcaaattaaagc 978
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 607 ggagggattggaattaccaagttcaattcatgtaattaaggaaactaatcaaattaaagc 548
Query: 979 aatgctttcaatacttagaaataaggataccaaagtcggtgatttcgttttctattctga 1038
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 547 aatgctttcaatacttagaaataaggataccaaagtcggtgatttcgttttctattctga 488
Query: 1039 tcgtttatgttcattaatcattgaagaggctttaacttatttaccattcactgaaaagat 1098
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 487 tcgtttatgttcattaatcattgaagaggctttaacttatttaccattcactgaaaagat 428
Query: 1099 tgttactactccaactggttcactttattatggtgaagaattaaatagtagaatttgtgc 1158
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 427 tgttactactccaactggttcactttattatggtgaagaattaaatagtagaatttgtgc 368
Query: 1159 tttagttgttttaagagctggtggttgtatggaacaaccacttcgttcaatttgtaaagg 1218
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 367 tttagttgttttaagagctggtggttgtatggaacaaccacttcgttcaatttgtaaagg 308
Query: 1219 tattagaactggaaaagttttaattcaatctgatgaaatgaaaaaaccacatttattcta 1278
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 307 tattagaactggaaaagttttaattcaatctgatgaaatgaaaaaaccacatttattcta 248
Query: 1279 tgaaaaattaccaaatgttacagattctcatgttttagttttagatccaacaattgcaac 1338
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 247 tgaaaaattaccaaatgttacagattctcatgttttagttttagatccaacaattgcaac 188
Query: 1339 tggtgcatcatcagagatggcaattagagttttattagatcatggtgttcctgaaaataa 1398
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 187 tggtgcatcatcagagatggcaattagagttttattagatcatggtgttcctgaaaataa 128
Query: 1399 aattatatttgttagcgttattgcttcactcaaaggtattttatatttaaattatagatt 1458
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 127 aattatatttgttagcgttattgcttcactcaaaggtattttatatttaaattatagatt 68
Query: 1459 ccctgatgttcaattcgtagttagtgccatcgataaagaattatctgacgaaggtttcat 1518
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 67 ccctgatgttcaattcgtagttagtgccatcgataaagaattatctgacgaaggtttcat 8
Query: 1519 tttacct 1525
|||||||
Sbjct: 7 tttacct 1
Lambda K H
1.37 0.711 1.31
Matrix: blastn matrix:1 -3
Number of Sequences: 92845959
Number of Hits to DB: 1,804,346,911
Number of extensions: 114572138
Number of successful extensions: 9903330
Number of sequences better than 10.0: 200
Length of query: 1525
Length of database: 95,242,211,685
Length adjustment: 24
Effective length of query: 1501
Effective length of database: 97,308,875,965
Effective search space: 146060622823465
Effective search space used: 146060622823465
X1: 11 (21.8 bits)
S2: 22 (44.1 bits)
|
| protein update |
2009. 7.13 |
| Homology vs Protein |
Query= Contig-U14970-1 (Contig-U14970-1Q) /CSM_Contig/Contig-U14970-1Q.Seq.d
(1525 letters)
Database: nrp_B
3,236,559 sequences; 1,051,180,864 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AE013599_2604(AE013599|pid:none) Drosophila melanogaster chromos... 426 e-117
AE013599_2605(AE013599|pid:none) Drosophila melanogaster chromos... 426 e-117
BT059390_1(BT059390|pid:none) Salmo salar clone ssal-rgf-518-011... 424 e-117
BC146741_1(BC146741|pid:none) Danio rerio similar to URKL1, mRNA... 420 e-116
AL831748_2(AL831748|pid:none) Zebrafish DNA sequence from clone ... 416 e-115
BX649575_6(BX649575|pid:none) Zebrafish DNA sequence from clone ... 416 e-115
AK303688_1(AK303688|pid:none) Homo sapiens cDNA FLJ53265 complet... 414 e-114
AY335675_1(AY335675|pid:none) Synthetic construct Homo sapiens u... 414 e-114
(Q91YL3) RecName: Full=Uridine-cytidine kinase-like 1; ... 410 e-113
T21110(T21110) hypothetical protein F19B6.1b - Caenorhabditis el... 408 e-112
AB024028_16(AB024028|pid:none) Arabidopsis thaliana genomic DNA,... 393 e-107
AP003920_7(AP003920|pid:none) Oryza sativa Japonica Group genomi... 384 e-105
AK102065_1(AK102065|pid:none) Oryza sativa Japonica Group cDNA c... 384 e-105
AB011477_10(AB011477|pid:none) Arabidopsis thaliana genomic DNA,... 384 e-105
AK175542_1(AK175542|pid:none) Arabidopsis thaliana mRNA for puta... 383 e-105
AM456869_1(AM456869|pid:none) Vitis vinifera contig VV78X229720.... 377 e-103
AK228608_1(AK228608|pid:none) Arabidopsis thaliana mRNA for urac... 375 e-102
CR954217_261(CR954217|pid:none) Ostreococcus tauri strain OTTH05... 350 1e-94
AM920437_918(AM920437|pid:none) Penicillium chrysogenum Wisconsi... 330 1e-88
AC002304_5(AC002304|pid:none) Genomic sequence for Arabidopsis t... 323 8e-87
CP000596_256(CP000596|pid:none) Ostreococcus lucimarinus CCE9901... 322 3e-86
AJ605558_1(AJ605558|pid:none) Homo sapiens mRNA for putative uri... 312 2e-83
AF298155_1(AF298155|pid:none) Cryptosporidium parvum uridine kin... 311 3e-83
AE017347_223(AE017347|pid:none) Cryptococcus neoformans var. neo... 311 5e-83
EU959693_1(EU959693|pid:none) Zea mays clone 219409 unknown mRNA. 306 1e-81
EU952606_1(EU952606|pid:none) Zea mays clone 1284326 unknown mRNA. 306 1e-81
FM992690_392(FM992690|pid:none) Candida dubliniensis CD36 chromo... 300 7e-80
CU928176_384(CU928176|pid:none) Zygosaccharomyces rouxii strain ... 290 1e-76
CU928165_244(CU928165|pid:none) Kluyveromyces thermotolerans str... 282 2e-74
(O74427) RecName: Full=Uridine kinase; EC=2.7.1.48; Alt... 280 8e-74
CR382134_367(CR382134|pid:none) Debaryomyces hansenii strain CBS... 279 2e-73
CP000496_721(CP000496|pid:none) Pichia stipitis CBS 6054 chromos... 276 2e-72
AE016817_688(AE016817|pid:none) Ashbya gossypii (= Eremothecium ... 275 2e-72
AY466381_1(AY466381|pid:none) Chlamydomonas reinhardtii uridine ... 273 2e-71
FN392320_824(FN392320|pid:none) Pichia pastoris GS115 chromosome... 273 2e-71
(P27515) RecName: Full=Uridine kinase; EC=2.7.1.48; Alt... 272 3e-71
FN357501_1(FN357501|pid:none) Schistosoma mansoni genome sequenc... 258 4e-67
(Q7ZV79) RecName: Full=Uridine-cytidine kinase 2-B; Sho... 223 1e-56
(Q7SYM0) RecName: Full=Uridine-cytidine kinase 2-A; Sho... 223 1e-56
(Q9BZX2) RecName: Full=Uridine-cytidine kinase 2; Short... 222 3e-56
BT057591_1(BT057591|pid:none) Salmo salar clone ssal-rgb2-575-35... 221 4e-56
AB062451_1(AB062451|pid:none) Homo sapiens UCK2 mRNA for uridine... 221 4e-56
DQ213955_1(DQ213955|pid:none) Taeniopygia guttata clone 0061P002... 219 2e-55
(Q0P5A4) RecName: Full=Uridine-cytidine kinase 1; Short... 219 3e-55
CR457281_1(CR457281|pid:none) Homo sapiens full open reading fra... 218 4e-55
(Q9HA47) RecName: Full=Uridine-cytidine kinase 1; Short... 218 4e-55
(Q6PA79) RecName: Full=Uridine-cytidine kinase 1-A; Sho... 217 8e-55
BT056431_1(BT056431|pid:none) Salmo salar clone ssal-evd-550-363... 217 8e-55
AL844529_3(AL844529|pid:none) Mouse DNA sequence from clone RP23... 217 1e-54
(Q6GPD9) RecName: Full=Uridine-cytidine kinase 1-B; Sho... 216 2e-54
L31783_1(L31783|pid:none) Mus musculus uridine kinase mRNA, part... 216 2e-54
AL808027_9(AL808027|pid:none) Mouse DNA sequence from clone RP23... 216 2e-54
(P52623) RecName: Full=Uridine-cytidine kinase 1; Short... 216 2e-54
(Q66I71) RecName: Full=Uridine-cytidine kinase 1; Short... 209 2e-52
AK340648_1(AK340648|pid:none) Acyrthosiphon pisum ACYPI008262 mR... 209 2e-52
AE014297_3662(AE014297|pid:none) Drosophila melanogaster chromos... 200 1e-49
AK295471_1(AK295471|pid:none) Homo sapiens cDNA FLJ52965 complet... 197 7e-49
CP000407_1623(CP000407|pid:none) Streptococcus suis 05ZYH33, com... 194 6e-48
(A8AWT2) RecName: Full=Uridine kinase; EC=2.7.1.48; Alt... 193 1e-47
CP000387_916(CP000387|pid:none) Streptococcus sanguinis SK36, co... 193 2e-47
BC082833_1(BC082833|pid:none) Xenopus laevis hypothetical LOC494... 193 2e-47
BT076419_1(BT076419|pid:none) Caligus rogercresseyi clone crog-e... 192 2e-47
(A5VKU8) RecName: Full=Uridine kinase; EC=2.7.1.48; Alt... 191 6e-47
(Q03K46) RecName: Full=Uridine kinase; EC=2.7.1.48; Alt... 191 6e-47
AL844529_4(AL844529|pid:none) Mouse DNA sequence from clone RP23... 191 8e-47
CP000412_403(CP000412|pid:none) Lactobacillus delbrueckii subsp.... 191 8e-47
(A2RDZ9) RecName: Full=Uridine kinase; EC=2.7.1.48; Alt... 190 1e-46
CR954253_501(CR954253|pid:none) Lactobacillus delbrueckii subsp.... 190 1e-46
CP000003_1090(CP000003|pid:none) Streptococcus pyogenes MGAS1039... 190 1e-46
(B4U220) RecName: Full=Uridine kinase; EC=2.7.1.48; Alt... 189 2e-46
(A8YU29) RecName: Full=Uridine kinase; EC=2.7.1.48; Alt... 189 2e-46
AE015924_1524(AE015924|pid:none) Porphyromonas gingivalis W83, c... 189 2e-46
AP008937_1287(AP008937|pid:none) Lactobacillus fermentum IFO 395... 189 2e-46
CP000382_1369(CP000382|pid:none) Clostridium novyi NT, complete ... 188 4e-46
(Q88WR0) RecName: Full=Uridine kinase; EC=2.7.1.48; Alt... 188 4e-46
(Q8P0F8) RecName: Full=Uridine kinase; EC=2.7.1.48; Alt... 188 4e-46
CP000033_548(CP000033|pid:none) Lactobacillus acidophilus NCFM, ... 188 4e-46
AM946015_1191(AM946015|pid:none) Streptococcus uberis 0140J comp... 188 4e-46
(Q49Y49) RecName: Full=Uridine kinase; EC=2.7.1.48; Alt... 187 9e-46
CP000412_402(CP000412|pid:none) Lactobacillus delbrueckii subsp.... 187 1e-45
AP009484_1252(AP009484|pid:none) Macrococcus caseolyticus JCSC54... 186 2e-45
(Q8E5Y5) RecName: Full=Uridine kinase; EC=2.7.1.48; Alt... 186 2e-45
(Q896E3) RecName: Full=Uridine kinase; EC=2.7.1.48; Alt... 185 3e-45
(Q8DTG1) RecName: Full=Uridine kinase; EC=2.7.1.48; Alt... 184 6e-45
(Q4L6V8) RecName: Full=Uridine kinase; EC=2.7.1.48; Alt... 184 6e-45
(Q4R4K2) RecName: Full=Uridine-cytidine kinase 1; Short... 183 2e-44
(A5ITD6) RecName: Full=Uridine kinase; EC=2.7.1.48; Alt... 182 2e-44
CP000416_963(CP000416|pid:none) Lactobacillus brevis ATCC 367, c... 182 4e-44
CR382132_1283(CR382132|pid:none) Yarrowia lipolytica strain CLIB... 182 4e-44
CP000885_2356(CP000885|pid:none) Clostridium phytofermentans ISD... 181 5e-44
CP001615_2707(CP001615|pid:none) Exiguobacterium sp. AT1b, compl... 181 6e-44
(Q5HNT9) RecName: Full=Uridine kinase; EC=2.7.1.48; Alt... 181 8e-44
DQ489736_460(DQ489736|pid:none) Leuconostoc citreum KM20, comple... 180 1e-43
AM920435_46(AM920435|pid:none) Penicillium chrysogenum Wisconsin... 180 1e-43
BX294022_21(BX294022|pid:none) Neurospora crassa DNA linkage gro... 180 1e-43
AP008955_1908(AP008955|pid:none) Brevibacillus brevis NBRC 10059... 179 2e-43
CP001022_2031(CP001022|pid:none) Exiguobacterium sibiricum 255-1... 178 4e-43
(Q8Y727) RecName: Full=Uridine kinase; EC=2.7.1.48; Alt... 178 4e-43
(Q71ZH3) RecName: Full=Uridine kinase; EC=2.7.1.48; Alt... 178 5e-43
(Q5KWV3) RecName: Full=Uridine kinase; EC=2.7.1.48; Alt... 177 9e-43
(B7GIU0) RecName: Full=Uridine kinase; EC=2.7.1.48; Alt... 177 1e-42
(Q55GQ6) RecName: Full=Uracil phosphoribosyltransferase; ... 177 1e-42
(Q92BL6) RecName: Full=Uridine kinase; EC=2.7.1.48; Alt... 176 2e-42
(A4IR72) RecName: Full=Uridine kinase; EC=2.7.1.48; Alt... 176 2e-42
CP000853_1625(CP000853|pid:none) Alkaliphilus oremlandii OhILAs,... 176 2e-42
CP000413_517(CP000413|pid:none) Lactobacillus gasseri ATCC 33323... 176 3e-42
(Q5SKR5) RecName: Full=Uridine kinase; EC=2.7.1.48; Alt... 175 3e-42
(Q0SS52) RecName: Full=Uridine kinase; EC=2.7.1.48; Alt... 174 8e-42
(O32033) RecName: Full=Uridine kinase; EC=2.7.1.48; Alt... 174 1e-41
CP001185_1479(CP001185|pid:none) Thermosipho africanus TCF52B, c... 174 1e-41
AM398681_1087(AM398681|pid:none) Flavobacterium psychrophilum JI... 173 1e-41
CP001078_922(CP001078|pid:none) Clostridium botulinum E3 str. Al... 173 2e-41
(Q65GT3) RecName: Full=Uridine kinase; EC=2.7.1.48; Alt... 173 2e-41
AP006841_3191(AP006841|pid:none) Bacteroides fragilis YCH46 DNA,... 173 2e-41
(A7Z727) RecName: Full=Uridine kinase; EC=2.7.1.48; Alt... 172 3e-41
FN357478_12(FN357478|pid:none) Schistosoma mansoni genome sequen... 172 3e-41
CP000817_3693(CP000817|pid:none) Lysinibacillus sphaericus C3-41... 171 5e-41
(A7GT59) RecName: Full=Uridine kinase; EC=2.7.1.48; Alt... 171 5e-41
(A0RIZ3) RecName: Full=Uridine kinase; EC=2.7.1.48; Alt... 171 7e-41
CP000771_445(CP000771|pid:none) Fervidobacterium nodosum Rt17-B1... 171 9e-41
(B7HQD8) RecName: Full=Uridine kinase; EC=2.7.1.48; Alt... 170 1e-40
(A9WCC8) RecName: Full=Uridine kinase; EC=2.7.1.48; Alt... 170 1e-40
(B1KXA7) RecName: Full=Uridine kinase; EC=2.7.1.48; Alt... 170 1e-40
CP001581_2687(CP001581|pid:none) Clostridium botulinum A2 str. K... 170 1e-40
AE017345_219(AE017345|pid:none) Cryptococcus neoformans var. neo... 170 1e-40
(Q81LK8) RecName: Full=Uridine kinase; EC=2.7.1.48; Alt... 169 2e-40
AL358781_19(AL358781|pid:none) Human DNA sequence from clone RP1... 169 2e-40
(Q9RXZ5) RecName: Full=Uridine kinase; EC=2.7.1.48; Alt... 169 2e-40
(B7HE15) RecName: Full=Uridine kinase; EC=2.7.1.48; Alt... 169 2e-40
CP001056_990(CP001056|pid:none) Clostridium botulinum B str. Ekl... 169 2e-40
AM270393_36(AM270393|pid:none) Aspergillus niger contig An17c011... 169 3e-40
CP000411_936(CP000411|pid:none) Oenococcus oeni PSU-1, complete ... 169 3e-40
CP000724_2383(CP000724|pid:none) Alkaliphilus metalliredigens QY... 168 4e-40
CP001083_2672(CP001083|pid:none) Clostridium botulinum Ba4 str. ... 168 4e-40
(A9VI01) RecName: Full=Uridine kinase; EC=2.7.1.48; Alt... 168 6e-40
CP000675_1943(CP000675|pid:none) Legionella pneumophila str. Cor... 167 9e-40
AE017354_1824(AE017354|pid:none) Legionella pneumophila subsp. p... 167 9e-40
PDBN(1BD3)A MOL_ID: 1;MOL_ID: 1; MOLECULE: URACIL PHOSPHORIBOSYL... 167 9e-40
AY812673_1(AY812673|pid:none) Schistosoma japonicum SJCHGC06086 ... 166 2e-39
CR380954_392(CR380954|pid:none) Candida glabrata strain CBS138 c... 166 2e-39
CP000499_267(CP000499|pid:none) Pichia stipitis CBS 6054 chromos... 166 2e-39
T18629(T18629)hypothetical protein B0001.4 - Caenorhabditis eleg... 166 2e-39
CP000359_200(CP000359|pid:none) Deinococcus geothermalis DSM 113... 166 2e-39
CP001365_1538(CP001365|pid:none) Halorubrum lacusprofundi ATCC 4... 166 2e-39
FM992692_312(FM992692|pid:none) Candida dubliniensis CD36 chromo... 166 2e-39
(A8FFL8) RecName: Full=Uridine kinase; EC=2.7.1.48; Alt... 166 3e-39
CP000388_529(CP000388|pid:none) Pseudoalteromonas atlantica T6c,... 166 3e-39
FN392319_572(FN392319|pid:none) Pichia pastoris GS115 chromosome... 165 4e-39
(Q8EPT5) RecName: Full=Uridine kinase; EC=2.7.1.48; Alt... 165 4e-39
AJ616008_1(AJ616008|pid:none) Candida albicans fur1 gene for put... 164 6e-39
BA000037_1261(BA000037|pid:none) Vibrio vulnificus YJ016 DNA, ch... 164 6e-39
EU327978_1(EU327978|pid:none) Candida tropicalis strain CBS 94 u... 164 6e-39
(Q7MM12) RecName: Full=Uridine kinase; EC=2.7.1.48; Alt... 164 6e-39
CP000159_512(CP000159|pid:none) Salinibacter ruber DSM 13855, co... 164 6e-39
CP000875_819(CP000875|pid:none) Herpetosiphon aurantiacus ATCC 2... 164 8e-39
AE016819_285(AE016819|pid:none) Ashbya gossypii (= Eremothecium ... 164 8e-39
AE017263_307(AE017263|pid:none) Mesoplasma florum L1 complete ge... 164 8e-39
(A5H0J4) RecName: Full=Uracil phosphoribosyltransferase; ... 163 1e-38
CR382137_404(CR382137|pid:none) Debaryomyces hansenii strain CBS... 163 1e-38
(Q17413) RecName: Full=Probable uridine-cytidine kinase; ... 163 2e-38
(O65583) RecName: Full=Uracil phosphoribosyltransferase; ... 163 2e-38
AE003852_1019(AE003852|pid:none) Vibrio cholerae O1 biovar eltor... 162 2e-38
(Q9KT67) RecName: Full=Uridine kinase; EC=2.7.1.48; Alt... 162 2e-38
AP008971_1450(AP008971|pid:none) Finegoldia magna ATCC 29328 DNA... 162 4e-38
CR378666_228(CR378666|pid:none) Photobacterium profundum SS9; se... 162 4e-38
AE016828_759(AE016828|pid:none) Coxiella burnetii RSA 493, compl... 161 5e-38
CP000716_1330(CP000716|pid:none) Thermosipho melanesiensis BI429... 161 5e-38
(Q87N09) RecName: Full=Uridine kinase; EC=2.7.1.48; Alt... 161 5e-38
(Q9HQC9) RecName: Full=Uridine kinase; EC=2.7.1.48; Alt... 161 7e-38
(Q081H5) RecName: Full=Uridine kinase; EC=2.7.1.48; Alt... 161 7e-38
CP001634_1518(CP001634|pid:none) Kosmotoga olearia TBF 19.5.1, c... 161 7e-38
CP000155_96(CP000155|pid:none) Hahella chejuensis KCTC 2396, com... 160 9e-38
AJ250199_2(AJ250199|pid:none) Streptomyces tendae nikkomycin bio... 159 2e-37
(A1S796) RecName: Full=Uridine kinase; EC=2.7.1.48; Alt... 159 3e-37
CU640366_545(CU640366|pid:none) Podospora anserina genomic DNA c... 159 3e-37
(Q662Z7) RecName: Full=Uridine kinase; EC=2.7.1.48; Alt... 159 3e-37
CP001098_1284(CP001098|pid:none) Halothermothrix orenii H 168, c... 158 4e-37
(A7MVE7) RecName: Full=Uridine kinase; EC=2.7.1.48; Alt... 158 4e-37
(B5RLM3) RecName: Full=Uridine kinase; EC=2.7.1.48; Alt... 157 1e-36
CP000896_1100(CP000896|pid:none) Acholeplasma laidlawii PG-8A, c... 157 1e-36
FM954972_919(FM954972|pid:none) Vibrio splendidus LGP32 chromoso... 157 1e-36
(Q9CM85) RecName: Full=Uridine kinase; EC=2.7.1.48; Alt... 156 2e-36
(Q12MJ0) RecName: Full=Uridine kinase; EC=2.7.1.48; Alt... 155 3e-36
CP000746_859(CP000746|pid:none) Actinobacillus succinogenes 130Z... 155 4e-36
(B2S1K4) RecName: Full=Uridine kinase; EC=2.7.1.48; Alt... 155 4e-36
(A8H3V4) RecName: Full=Uridine kinase; EC=2.7.1.48; Alt... 155 5e-36
CP000049_15(CP000049|pid:none) Borrelia turicatae 91E135, comple... 155 5e-36
AP006840_1046(AP006840|pid:none) Symbiobacterium thermophilum IA... 155 5e-36
CP000083_1922(CP000083|pid:none) Colwellia psychrerythraea 34H, ... 154 1e-35
(A1SUY9) RecName: Full=Uridine kinase; EC=2.7.1.48; Alt... 154 1e-35
BX293980_525(BX293980|pid:none) Mycoplasma mycoides subsp. mycoi... 153 1e-35
CP000821_2645(CP000821|pid:none) Shewanella sediminis HAW-EB3, c... 153 2e-35
(A1RIY2) RecName: Full=Uridine kinase; EC=2.7.1.48; Alt... 153 2e-35
(A6WP54) RecName: Full=Uridine kinase; EC=2.7.1.48; Alt... 152 2e-35
(A0KW26) RecName: Full=Uridine kinase; EC=2.7.1.48; Alt... 152 3e-35
CP000687_794(CP000687|pid:none) Actinobacillus pleuropneumoniae ... 152 3e-35
(A5UFT8) RecName: Full=Uridine kinase; EC=2.7.1.48; Alt... 152 3e-35
(A7MHG8) RecName: Full=Uridine kinase; EC=2.7.1.48; Alt... 152 3e-35
(B0TJ03) RecName: Full=Uridine kinase; EC=2.7.1.48; Alt... 152 4e-35
(B0UT65) RecName: Full=Uridine kinase; EC=2.7.1.48; Alt... 151 5e-35
(B8CPI6) RecName: Full=Uridine kinase; EC=2.7.1.48; Alt... 151 7e-35
CP000937_222(CP000937|pid:none) Francisella philomiragia subsp. ... 150 9e-35
CP000961_1962(CP000961|pid:none) Shewanella woodyi ATCC 51908, c... 150 9e-35
AE017340_1530(AE017340|pid:none) Idiomarina loihiensis L2TR, com... 150 2e-34
CP000036_825(CP000036|pid:none) Shigella boydii Sb227, complete ... 150 2e-34
A64973(A64973;I55002;S32738) uridine kinase (EC 2.7.1.48) - Esch... 149 2e-34
(Q65S71) RecName: Full=Uridine kinase; EC=2.7.1.48; Alt... 149 2e-34
(P0A8F4) RecName: Full=Uridine kinase; EC=2.7.1.48; Alt... 149 2e-34
(A9N7M0) RecName: Full=Uridine kinase; EC=2.7.1.48; Alt... 149 2e-34
AE014075_2524(AE014075|pid:none) Escherichia coli CFT073, comple... 149 2e-34
(B5RBW3) RecName: Full=Uridine kinase; EC=2.7.1.48; Alt... 149 3e-34
CP000915_1100(CP000915|pid:none) Francisella tularensis subsp. m... 149 3e-34
(B4SXV3) RecName: Full=Uridine kinase; EC=2.7.1.48; Alt... 148 5e-34
(Q6D7B4) RecName: Full=Uridine kinase; EC=2.7.1.48; Alt... 148 5e-34
AJ749949_702(AJ749949|pid:none) Francisella tularensis subsp. tu... 148 6e-34
AY967251_1(AY967251|pid:none) Synthetic construct isolate FTT070... 148 6e-34
(A1JTX4) RecName: Full=Uridine kinase; EC=2.7.1.48; Alt... 147 1e-33
(B7LV30) RecName: Full=Uridine kinase; EC=2.7.1.48; Alt... 147 1e-33
AE009952_2603(AE009952|pid:none) Yersinia pestis KIM, complete g... 147 1e-33
FP236842_1381(FP236842|pid:none) Erwinia pyrifoliae strain Ep1/9... 147 1e-33
BT080182_1(BT080182|pid:none) Caligus clemensi clone ccle-evs-51... 145 4e-33
BC015547_1(BC015547|pid:none) Homo sapiens uridine-cytidine kina... 144 7e-33
(A8GC40) RecName: Full=Uridine kinase; EC=2.7.1.48; Alt... 144 9e-33
AB198423_2(AB198423|pid:none) Klebsiella pneumoniae DNA, cps loc... 144 9e-33
(B1AIX1) RecName: Full=Uridine kinase; EC=2.7.1.48; Alt... 144 1e-32
(Q9Z7H0) RecName: Full=Uridine kinase; EC=2.7.1.48; Alt... 142 4e-32
AM502252_90(AM502252|pid:none) Leishmania infantum chromosome 34. 140 9e-32
AC080131_6(AC080131|pid:none) Trypanosoma brucei chromosome 4 cl... 140 1e-31
(Q2NUC7) RecName: Full=Uridine kinase; EC=2.7.1.48; Alt... 139 3e-31
AM494957_101(AM494957|pid:none) Leishmania braziliensis chromoso... 139 3e-31
AP007154_585(AP007154|pid:none) Aspergillus oryzae RIB40 genomic... 139 4e-31
CT005271_108(CT005271|pid:none) Leishmania major strain Friedlin... 138 6e-31
FM164414_19(FM164414|pid:none) Corynebacterium aurimucosum plasm... 135 3e-30
BT048287_1(BT048287|pid:none) Salmo salar clone ssal-evd-551-070... 135 3e-30
BT082445_1(BT082445|pid:none) Anoplopoma fimbria clone afim-evh-... 135 3e-30
(Q7VL27) RecName: Full=Uridine kinase; EC=2.7.1.48; Alt... 135 4e-30
(Q5ZIJ8) RecName: Full=Uracil phosphoribosyltransferase; ... 132 3e-29
T19992(T19992) hypothetical protein C47B2.2b - Caenorhabditis el... 132 4e-29
BX842653_112(BX842653|pid:none) Bdellovibrio bacteriovorus compl... 131 8e-29
AY466394_1(AY466394|pid:none) Cryptosporidium parvum uracil phos... 130 1e-28
AL731717_1(AL731717|pid:none) Mouse DNA sequence from clone RP23... 130 1e-28
CP000826_1689(CP000826|pid:none) Serratia proteamaculans 568, co... 129 3e-28
AB063065_1(AB063065|pid:none) Macaca fascicularis brain cDNA clo... 129 3e-28
EF134373_1(EF134373|pid:none) Prorocentrum minimum isolate Pmi-5... 129 4e-28
AM270290_18(AM270290|pid:none) Aspergillus niger contig An12c034... 128 6e-28
AE015450_448(AE015450|pid:none) Mycoplasma gallisepticum strain ... 127 1e-27
CP000473_3143(CP000473|pid:none) Solibacter usitatus Ellin6076, ... 127 1e-27
AE014296_1081(AE014296|pid:none) Drosophila melanogaster chromos... 126 2e-27
AL137013_5(AL137013|pid:none) Human DNA sequence from clone RP11... 125 5e-27
BT076535_1(BT076535|pid:none) Caligus rogercresseyi clone crog-e... 124 1e-26
AK056354_1(AK056354|pid:none) Homo sapiens cDNA FLJ31792 fis, cl... 123 2e-26
AP007154_586(AP007154|pid:none) Aspergillus oryzae RIB40 genomic... 122 3e-26
(P47622) RecName: Full=Uridine kinase; EC=2.7.1.48; Alt... 122 3e-26
AY675206_1(AY675206|pid:none) Oryzias latipes hypothetical prote... 121 8e-26
CP000158_3379(CP000158|pid:none) Hyphomonas neptunium ATCC 15444... 120 2e-25
T19987(T19987) hypothetical protein C47B2.2a - Caenorhabditis el... 119 4e-25
FN357878_3(FN357878|pid:none) Schistosoma mansoni genome sequenc... 118 5e-25
CP000383_114(CP000383|pid:none) Cytophaga hutchinsonii ATCC 3340... 118 7e-25
(P75217) RecName: Full=Uridine kinase; EC=2.7.1.48; Alt... 117 9e-25
AL118506_10(AL118506|pid:none) Human DNA sequence from clone RP4... 117 1e-24
FN359080_1(FN359080|pid:none) Schistosoma mansoni genome sequenc... 115 3e-24
CP000839_190(CP000839|pid:none) Acaryochloris marina MBIC11017 p... 113 2e-23
AY815607_1(AY815607|pid:none) Schistosoma japonicum SJCHGC06345 ... 110 1e-22
CP000749_3915(CP000749|pid:none) Marinomonas sp. MWYL1, complete... 110 1e-22
CP000261_1180(CP000261|pid:none) Streptococcus pyogenes MGAS2096... 110 1e-22
AB030700_1(AB030700|pid:none) Rattus norvegicus uk mRNA for urid... 108 4e-22
D78335_1(D78335|pid:none) Homo sapiens mRNA for 5'-terminal regi... 107 1e-21
AK003541_1(AK003541|pid:none) Mus musculus 18-day embryo whole b... 103 2e-20
AB170445_1(AB170445|pid:none) Macaca fascicularis brain cDNA clo... 103 2e-20
AD2321(AD2321) phosphoribulokinase [imported] - Nostoc sp. (stra... 102 3e-20
CP000117_779(CP000117|pid:none) Anabaena variabilis ATCC 29413, ... 102 4e-20
CP001037_2486(CP001037|pid:none) Nostoc punctiforme PCC 73102, c... 102 5e-20
AM285313_12(AM285313|pid:none) Spiroplasma citri GII3-3X chromos... 102 5e-20
AM778920_36(AM778920|pid:none) Microcystis aeruginosa PCC 7806 g... 101 6e-20
CP000951_2623(CP000951|pid:none) Synechococcus sp. PCC 7002, com... 100 1e-19
AC079829_16(AC079829|pid:none) Arabidopsis thaliana chromosome 1... 100 1e-19
CP000393_3187(CP000393|pid:none) Trichodesmium erythraeum IMS101... 99 3e-19
CP001287_3768(CP001287|pid:none) Cyanothece sp. PCC 8801, comple... 99 3e-19
CP001291_5075(CP001291|pid:none) Cyanothece sp. PCC 7424, comple... 98 9e-19
BA000022_1880(BA000022|pid:none) Synechocystis sp. PCC 6803 DNA,... 97 2e-18
AB035257_1(AB035257|pid:none) Synechococcus elongatus PCC 7942 p... 97 2e-18
BA000045_2296(BA000045|pid:none) Gloeobacter violaceus PCC 7421 ... 97 2e-18
AP008231_567(AP008231|pid:none) Synechococcus elongatus PCC 6301... 97 2e-18
CP000828_4797(CP000828|pid:none) Acaryochloris marina MBIC11017,... 96 3e-18
AK340270_1(AK340270|pid:none) Acyrthosiphon pisum mRNA for hypot... 94 1e-17
(B8E009) RecName: Full=Uracil phosphoribosyltransferase; ... 94 1e-17
AY223453_1(AY223453|pid:none) Schistosoma japonicum clone ZZZ47 ... 94 2e-17
(Q5WB67) RecName: Full=Uracil phosphoribosyltransferase; ... 94 2e-17
(B5YDB8) RecName: Full=Uracil phosphoribosyltransferase; ... 92 4e-17
CP000090_2498(CP000090|pid:none) Ralstonia eutropha JMP134 chrom... 92 4e-17
CP000812_118(CP000812|pid:none) Thermotoga lettingae TMO, comple... 92 5e-17
AC016662_15(AC016662|pid:none) Arabidopsis thaliana chromosome 1... 92 7e-17
CP001068_2353(CP001068|pid:none) Ralstonia pickettii 12J chromos... 91 1e-16
(B5ZAU8) RecName: Full=Uracil phosphoribosyltransferase; ... 91 1e-16
AP008971_1081(AP008971|pid:none) Finegoldia magna ATCC 29328 DNA... 90 3e-16
Y08610_1(Y08610|pid:none) Odontella sinensis mRNA for phosphorib... 89 4e-16
U75301_4(U75301|pid:none) Sulfobacillus acidophilus Calvin cycle... 89 6e-16
(Q2SZS9) RecName: Full=Uracil phosphoribosyltransferase; ... 89 6e-16
AK294537_1(AK294537|pid:none) Homo sapiens cDNA FLJ57922 complet... 89 6e-16
AY772246_1(AY772246|pid:none) Guillardia theta chloroplast phosp... 88 7e-16
(A5VIQ0) RecName: Full=Uracil phosphoribosyltransferase; ... 88 7e-16
(A1V2G4) RecName: Full=Uracil phosphoribosyltransferase; ... 88 1e-15
(A3N7G1) RecName: Full=Uracil phosphoribosyltransferase; ... 87 2e-15
AF480496_13(AF480496|pid:none) Oryza sativa clone BAC 49D11, com... 87 2e-15
AK102236_1(AK102236|pid:none) Oryza sativa Japonica Group cDNA c... 87 2e-15
CP001080_1170(CP001080|pid:none) Sulfurihydrogenibium sp. YO3AOP... 87 2e-15
(A3DIL9) RecName: Full=Uracil phosphoribosyltransferase; ... 86 4e-15
AJ012719_1(AJ012719|pid:none) Galdieria sulphuraria mRNA for pho... 86 4e-15
(B8DP34) RecName: Full=Uracil phosphoribosyltransferase; ... 86 5e-15
(P09559) RecName: Full=Phosphoribulokinase, chloroplastic; ... 86 5e-15
(A5IJ64) RecName: Full=Uracil phosphoribosyltransferase; ... 86 5e-15
CP001503_2498(CP001503|pid:none) Burkholderia glumae BGR1 chromo... 86 5e-15
M21338_1(M21338|pid:none) Spinach phosphoribulokinase (PRK) mRNA... 86 5e-15
S16585(S16585)phosphoribulokinase (EC 2.7.1.19) - wheat 86 5e-15
(Q9WZI0) RecName: Full=Uracil phosphoribosyltransferase; ... 86 5e-15
(A7NRA6) RecName: Full=Uracil phosphoribosyltransferase; ... 85 6e-15
CP000458_2290(CP000458|pid:none) Burkholderia cenocepacia HI2424... 85 6e-15
X57952_1(X57952|pid:none) T.aestivum PRK gene for ribulose-5-pho... 85 6e-15
(Q9CEC9) RecName: Full=Uracil phosphoribosyltransferase; ... 85 8e-15
CP000378_1669(CP000378|pid:none) Burkholderia cenocepacia AU 105... 85 8e-15
(P43049) RecName: Full=Uracil phosphoribosyltransferase; ... 84 1e-14
AP009385_2227(AP009385|pid:none) Burkholderia multivorans ATCC 1... 84 1e-14
(Q0BD86) RecName: Full=Uracil phosphoribosyltransferase; ... 84 1e-14
(B7IDR9) RecName: Full=Uracil phosphoribosyltransferase; ... 84 1e-14
EU970086_1(EU970086|pid:none) Zea mays clone 339518 phosphoribul... 84 1e-14
CP001015_670(CP001015|pid:none) Streptococcus pneumoniae G54, co... 84 1e-14
BT054956_1(BT054956|pid:none) Zea mays full-length cDNA clone ZM... 84 1e-14
CU633749_838(CU633749|pid:none) Cupriavidus taiwanensis str. LMG... 84 1e-14
(A4VWM9) RecName: Full=Uracil phosphoribosyltransferase; ... 84 1e-14
BT039247_1(BT039247|pid:none) Zea mays full-length cDNA clone ZM... 84 1e-14
AY772252_1(AY772252|pid:none) Prymnesium parvum chloroplast phos... 84 1e-14
AE007317_655(AE007317|pid:none) Streptococcus pneumoniae R6, com... 84 1e-14
CP001276_693(CP001276|pid:none) Thermomicrobium roseum DSM 5159 ... 84 1e-14
AM747720_2383(AM747720|pid:none) Burkholderia cenocepacia J2315 ... 84 1e-14
(A8AYQ0) RecName: Full=Uracil phosphoribosyltransferase; ... 84 1e-14
(Q03EK5) RecName: Full=Uracil phosphoribosyltransferase; ... 84 1e-14
(Q02WM7) RecName: Full=Uracil phosphoribosyltransferase; ... 84 1e-14
AM456133_4(AM456133|pid:none) Vitis vinifera contig VV78X175632.... 84 2e-14
(Q5SIQ7) RecName: Full=Uracil phosphoribosyltransferase; ... 84 2e-14
CP001575_224(CP001575|pid:none) Micromonas sp. RCC299 chromosome... 84 2e-14
CP001615_1310(CP001615|pid:none) Exiguobacterium sp. AT1b, compl... 84 2e-14
CP000918_747(CP000918|pid:none) Streptococcus pneumoniae 70585, ... 84 2e-14
(Q39EA2) RecName: Full=Uracil phosphoribosyltransferase; ... 84 2e-14
CP001142_393(CP001142|pid:none) Phaeodactylum tricornutum CCAP 1... 84 2e-14
(P25697) RecName: Full=Phosphoribulokinase, chloroplastic; ... 84 2e-14
(A4JGH4) RecName: Full=Uracil phosphoribosyltransferase; ... 84 2e-14
(A6LMU0) RecName: Full=Uracil phosphoribosyltransferase; ... 83 2e-14
BT052257_1(BT052257|pid:none) Medicago truncatula clone MTYF9_FA... 83 3e-14
CP000562_1925(CP000562|pid:none) Methanoculleus marisnigri JR1, ... 83 3e-14
AL607004_5(AL607004|pid:none) Oryza sativa genomic DNA, chromoso... 83 3e-14
CP001129_1559(CP001129|pid:none) Streptococcus equi subsp. zooep... 83 3e-14
CP001392_1665(CP001392|pid:none) Diaphorobacter sp. TPSY, comple... 83 3e-14
(Q831G0) RecName: Full=Uracil phosphoribosyltransferase; ... 83 3e-14
CP000584_270(CP000584|pid:none) Ostreococcus lucimarinus CCE9901... 83 3e-14
CP000091_522(CP000091|pid:none) Ralstonia eutropha JMP134 chromo... 82 4e-14
AE017198_774(AE017198|pid:none) Lactobacillus johnsonii NCC 533,... 82 4e-14
(A1VEW8) RecName: Full=Uracil phosphoribosyltransferase; ... 82 5e-14
(Q8DST6) RecName: Full=Uracil phosphoribosyltransferase; ... 82 7e-14
CP001098_1778(CP001098|pid:none) Halothermothrix orenii H 168, c... 82 7e-14
(A7HJR3) RecName: Full=Uracil phosphoribosyltransferase; ... 82 7e-14
CP000661_277(CP000661|pid:none) Rhodobacter sphaeroides ATCC 170... 82 7e-14
CP001393_591(CP001393|pid:none) Anaerocellum thermophilum DSM 67... 82 7e-14
(P75081) RecName: Full=Uracil phosphoribosyltransferase; ... 81 9e-14
(Q03A25) RecName: Full=Uracil phosphoribosyltransferase; ... 81 9e-14
(Q8EM74) RecName: Full=Uracil phosphoribosyltransferase; ... 81 9e-14
EF085276_1(EF085276|pid:none) Picea sitchensis clone WS0272_B08 ... 81 1e-13
BX294151_34(BX294151|pid:none) Rhodopirellula baltica SH 1 compl... 81 1e-13
CP000394_2366(CP000394|pid:none) Granulibacter bethesdensis CGDN... 81 1e-13
(Q9K6G5) RecName: Full=Uracil phosphoribosyltransferase; ... 81 1e-13
(Q97RQ3) RecName: Full=Uracil phosphoribosyltransferase; ... 81 1e-13
CP000362_3700(CP000362|pid:none) Roseobacter denitrificans OCh 1... 81 1e-13
(B7HFL2) RecName: Full=Uracil phosphoribosyltransferase; ... 80 2e-13
AY772251_1(AY772251|pid:none) Chondrus crispus chloroplast phosp... 80 2e-13
(A7Z9Q8) RecName: Full=Uracil phosphoribosyltransferase; ... 80 2e-13
CP001145_692(CP001145|pid:none) Coprothermobacter proteolyticus ... 80 2e-13
(A0RLA2) RecName: Full=Uracil phosphoribosyltransferase; ... 80 2e-13
(P47276) RecName: Full=Uracil phosphoribosyltransferase; ... 80 3e-13
(Q042K8) RecName: Full=Uracil phosphoribosyltransferase; ... 80 3e-13
(Q38WJ8) RecName: Full=Uracil phosphoribosyltransferase; ... 79 3e-13
(B7GMG3) RecName: Full=Uracil phosphoribosyltransferase; ... 79 3e-13
CP001344_4146(CP001344|pid:none) Cyanothece sp. PCC 7425, comple... 79 3e-13
(P36399) RecName: Full=Uracil phosphoribosyltransferase; ... 79 3e-13
(Q9RGY8) RecName: Full=Uracil phosphoribosyltransferase; ... 79 3e-13
DQ489736_543(DQ489736|pid:none) Leuconostoc citreum KM20, comple... 79 3e-13
(O67914) RecName: Full=Uracil phosphoribosyltransferase; ... 79 4e-13
(Q0SK44) RecName: Full=Uracil phosphoribosyltransferase; ... 79 4e-13
(A6TK51) RecName: Full=Uracil phosphoribosyltransferase; ... 79 4e-13
(A7GV65) RecName: Full=Uracil phosphoribosyltransferase; ... 79 4e-13
CP000577_250(CP000577|pid:none) Rhodobacter sphaeroides ATCC 170... 79 6e-13
(Q03M79) RecName: Full=Uracil phosphoribosyltransferase; ... 79 6e-13
BT071184_1(BT071184|pid:none) Picea sitchensis clone WS0277_I07 ... 78 8e-13
(A8YUJ4) RecName: Full=Uracil phosphoribosyltransferase; ... 78 8e-13
CP000594_315(CP000594|pid:none) Ostreococcus lucimarinus CCE9901... 78 8e-13
CU633750_1394(CU633750|pid:none) Cupriavidus taiwanensis str. LM... 78 8e-13
(Q24MM7) RecName: Full=Uracil phosphoribosyltransferase; ... 78 8e-13
(A5IUQ7) RecName: Full=Uracil phosphoribosyltransferase; ... 78 8e-13
(Q8RG35) RecName: Full=Uracil phosphoribosyltransferase; ... 78 1e-12
AE009951_1059(AE009951|pid:none) Fusobacterium nucleatum subsp. ... 78 1e-12
(A0RR59) RecName: Full=Uracil phosphoribosyltransferase; ... 78 1e-12
AE017345_213(AE017345|pid:none) Cryptococcus neoformans var. neo... 78 1e-12
(B3PM96) RecName: Full=Uracil phosphoribosyltransferase; ... 78 1e-12
DQ074977_41(DQ074977|pid:none) Janthinobacterium lividum contig ... 78 1e-12
(A7H0F9) RecName: Full=Uracil phosphoribosyltransferase; ... 78 1e-12
CP001056_435(CP001056|pid:none) Clostridium botulinum B str. Ekl... 77 1e-12
(Q9RU32) RecName: Full=Uracil phosphoribosyltransferase; ... 77 1e-12
CP000557_3265(CP000557|pid:none) Geobacillus thermodenitrificans... 77 1e-12
FM992688_527(FM992688|pid:none) Candida dubliniensis CD36 chromo... 77 1e-12
CP000909_1491(CP000909|pid:none) Chloroflexus aurantiacus J-10-f... 77 1e-12
(Q2S320) RecName: Full=Uracil phosphoribosyltransferase; ... 77 2e-12
CP000240_433(CP000240|pid:none) Synechococcus sp. JA-2-3B'a(2-13... 77 2e-12
CP000264_2983(CP000264|pid:none) Jannaschia sp. CCS1, complete g... 77 2e-12
AM295250_1606(AM295250|pid:none) Staphylococcus carnosus subsp. ... 77 2e-12
AP009179_1102(AP009179|pid:none) Sulfurovum sp. NBC37-1 genomic ... 76 3e-12
EU958212_1(EU958212|pid:none) Zea mays clone 1678901 phosphoribu... 76 3e-12
AY772247_1(AY772247|pid:none) Lingulodinium polyedrum chloroplas... 76 3e-12
AK301602_1(AK301602|pid:none) Homo sapiens cDNA FLJ52789 complet... 76 3e-12
AC111016_11(AC111016|pid:none) Oryza sativa (japonica cultivar-g... 76 3e-12
CP000513_556(CP000513|pid:none) Dichelobacter nodosus VCS1703A, ... 76 4e-12
AM889285_3345(AM889285|pid:none) Gluconacetobacter diazotrophicu... 76 4e-12
AY826861_1(AY826861|pid:none) Isochrysis galbana clone ISPRK1 ch... 76 4e-12
CP001338_931(CP001338|pid:none) Candidatus Methanosphaerula palu... 76 4e-12
CP000679_1139(CP000679|pid:none) Caldicellulosiruptor saccharoly... 76 4e-12
BT039566_1(BT039566|pid:none) Zea mays full-length cDNA clone ZM... 76 4e-12
AY772245_1(AY772245|pid:none) Pavlova lutheri chloroplast phosph... 76 4e-12
CP001107_108(CP001107|pid:none) Eubacterium rectale ATCC 33656, ... 75 5e-12
(Q04DP1) RecName: Full=Uracil phosphoribosyltransferase; ... 75 5e-12
CR382132_113(CR382132|pid:none) Yarrowia lipolytica strain CLIB1... 75 5e-12
AP011115_387(AP011115|pid:none) Rhodococcus opacus B4 DNA, compl... 75 6e-12
(A1RV13) RecName: Full=Probable uracil phosphoribosyltransferase... 75 6e-12
S73447(S73447)uracil phosphoribosyltransferase (EC 2.4.2.9) upp ... 75 6e-12
(A1W0S0) RecName: Full=Uracil phosphoribosyltransferase; ... 75 6e-12
CP000414_1360(CP000414|pid:none) Leuconostoc mesenteroides subsp... 75 6e-12
(Q67TC9) RecName: Full=Uracil phosphoribosyltransferase; ... 75 8e-12
(B2A3H5) RecName: Full=Uracil phosphoribosyltransferase; ... 75 8e-12
(Q9PJJ6) RecName: Full=Uracil phosphoribosyltransferase; ... 75 8e-12
CP000316_1926(CP000316|pid:none) Polaromonas sp. JS666, complete... 75 8e-12
CP000386_1628(CP000386|pid:none) Rubrobacter xylanophilus DSM 99... 75 8e-12
(A8MJX1) RecName: Full=Uracil phosphoribosyltransferase; ... 75 8e-12
CP001074_233(CP001074|pid:none) Rhizobium etli CIAT 652, complet... 75 8e-12
(Q9PN13) RecName: Full=Uracil phosphoribosyltransferase; ... 75 8e-12
(A4WMQ7) RecName: Full=Probable uracil phosphoribosyltransferase... 75 8e-12
(Q6F210) RecName: Full=Uracil phosphoribosyltransferase; ... 74 1e-11
CP001104_1207(CP001104|pid:none) Eubacterium eligens ATCC 27750,... 74 1e-11
AP009484_1767(AP009484|pid:none) Macrococcus caseolyticus JCSC54... 74 1e-11
(Q927V5) RecName: Full=Uracil phosphoribosyltransferase; ... 74 1e-11
CP000884_3507(CP000884|pid:none) Delftia acidovorans SPH-1, comp... 74 1e-11
(Q311Z9) RecName: Full=Uracil phosphoribosyltransferase; ... 74 1e-11
(Q1MMV8) RecName: Full=Uracil phosphoribosyltransferase; ... 74 1e-11
BA000045_4424(BA000045|pid:none) Gloeobacter violaceus PCC 7421 ... 74 1e-11
(B0T2R0) RecName: Full=Uracil phosphoribosyltransferase; ... 74 1e-11
EF147572_1(EF147572|pid:none) Populus trichocarpa clone WS0123_I... 74 1e-11
CP000697_1864(CP000697|pid:none) Acidiphilium cryptum JF-5, comp... 74 1e-11
CT971583_1367(CT971583|pid:none) Synechococcus WH7803 complete g... 74 2e-11
(B5ZXI2) RecName: Full=Uracil phosphoribosyltransferase; ... 74 2e-11
(A0ALM3) RecName: Full=Uracil phosphoribosyltransferase; ... 74 2e-11
(A9NEQ2) RecName: Full=Uracil phosphoribosyltransferase; ... 74 2e-11
(A1B467) RecName: Full=Uracil phosphoribosyltransferase; ... 73 2e-11
CP000930_858(CP000930|pid:none) Heliobacterium modesticaldum Ice... 73 2e-11
(Q8EUA1) RecName: Full=Uracil phosphoribosyltransferase; ... 73 3e-11
AY772249_1(AY772249|pid:none) Pyrocystis lunula chloroplast phos... 73 3e-11
CP000628_262(CP000628|pid:none) Agrobacterium radiobacter K84 ch... 73 3e-11
CP000267_2036(CP000267|pid:none) Rhodoferax ferrireducens T118, ... 72 4e-11
CP001014_648(CP001014|pid:none) Thermoproteus neutrophilus V24St... 72 4e-11
DQ118593_1(DQ118593|pid:none) Karlodinium micrum isolate 7629 ch... 72 4e-11
AP009608_575(AP009608|pid:none) Mycoplasma fermentans PG18 DNA, ... 72 4e-11
CP000879_1389(CP000879|pid:none) Petrotoga mobilis SJ95, complet... 72 5e-11
(Q5HMB1) RecName: Full=Uracil phosphoribosyltransferase; ... 72 5e-11
DQ882766_1(DQ882766|pid:none) Acer saccharum strain PASLIP5_a ph... 72 7e-11
(Q9RE01) RecName: Full=Uracil phosphoribosyltransferase; ... 72 7e-11
DQ882688_1(DQ882688|pid:none) Acer saccharum strain ILGLEN2_b ph... 72 7e-11
AM502249_317(AM502249|pid:none) Leishmania infantum chromosome 31. 72 7e-11
(Q1IEV9) RecName: Full=Uracil phosphoribosyltransferase; ... 72 7e-11
DQ882736_1(DQ882736|pid:none) Acer saccharum strain NHCANA5 phos... 72 7e-11
DQ882708_1(DQ882708|pid:none) Acer saccharum strain KYALEX1_a PR... 72 7e-11
DQ882698_1(DQ882698|pid:none) Acer saccharum strain KSJING6 PRK ... 72 7e-11
DQ882801_1(DQ882801|pid:none) Acer saccharum strain QCMATA1_a ph... 72 7e-11
DQ882768_1(DQ882768|pid:none) Acer saccharum strain PECHAR5 PRK ... 72 7e-11
(Q9GNF0) RecName: Full=Uridine-cytidine kinase D; EC=2.... 72 7e-11
CP000969_175(CP000969|pid:none) Thermotoga sp. RQ2, complete gen... 71 9e-11
DQ882843_1(DQ882843|pid:none) Acer grandidentatum strain QCMONT4... 71 9e-11
(Q5HTC1) RecName: Full=Uracil phosphoribosyltransferase; ... 71 9e-11
(Q8UJ06) RecName: Full=Uracil phosphoribosyltransferase; ... 71 9e-11
(B1JEN1) RecName: Full=Uracil phosphoribosyltransferase; ... 71 9e-11
AE000512_739(AE000512|pid:none) Thermotoga maritima MSB8, comple... 71 9e-11
(A1WQN5) RecName: Full=Uracil phosphoribosyltransferase; ... 71 1e-10
CP001635_2623(CP001635|pid:none) Variovorax paradoxus S110 chrom... 71 1e-10
(A5N3J1) RecName: Full=Uracil phosphoribosyltransferase; ... 71 1e-10
(Q7NBH2) RecName: Full=Uracil phosphoribosyltransferase; ... 71 1e-10
(Q2ST42) RecName: Full=Uracil phosphoribosyltransferase; ... 71 1e-10
FJ645227_1(FJ645227|pid:none) Crucihimalaya mollissima clone 1 p... 70 2e-10
FJ645210_1(FJ645210|pid:none) Arabidopsis lyrata subsp. lyrata c... 70 2e-10
FJ645209_1(FJ645209|pid:none) Arabidopsis lyrata subsp. lyrata c... 70 2e-10
CP000820_5797(CP000820|pid:none) Frankia sp. EAN1pec, complete g... 70 2e-10
FJ645246_1(FJ645246|pid:none) Lepidium apetalum clone 5 phosphor... 70 2e-10
CP001634_380(CP001634|pid:none) Kosmotoga olearia TBF 19.5.1, co... 70 3e-10
(A5VYH8) RecName: Full=Uracil phosphoribosyltransferase; ... 70 3e-10
(A5F642) RecName: Full=Uracil phosphoribosyltransferase; ... 70 3e-10
(Q7VZ79) RecName: Full=Uracil phosphoribosyltransferase; ... 70 3e-10
(Q4K6B5) RecName: Full=Uracil phosphoribosyltransferase; ... 70 3e-10
AE017354_1143(AE017354|pid:none) Legionella pneumophila subsp. p... 70 3e-10
>AE013599_2604(AE013599|pid:none) Drosophila melanogaster chromosome
2R, complete sequence.
Length = 561
Score = 426 bits (1094), Expect = e-117
Identities = 215/443 (48%), Positives = 308/443 (69%), Gaps = 7/443 (1%)
Frame = +2
Query: 218 KKVYTSGRPPWYDSKGNLKNPLVIGVCGGSASGKTTVCDKIIANLNVRWVVLLSMDSFYK 397
+ +YT+GRPPWY+ G P VIG+CGGSASGKTTV +KII +L+V WV LLSMD FYK
Sbjct: 101 RTIYTAGRPPWYNCAGQQVEPFVIGICGGSASGKTTVAEKIIESLDVPWVTLLSMDCFYK 160
Query: 398 SLSKDNDP----SKYNFDHPNAFDYDLMVKTISELRAGKKVNIPKYCFKTHSRLVHQDTV 565
L++ ++YNFDHP+AFD +L++ +++L+ G+KV +P Y F TH R T+
Sbjct: 161 ILNEKQHEQALINEYNFDHPDAFDIELLLDVLTKLKEGRKVEVPVYNFVTHGRESQTKTM 220
Query: 566 YGADVIILEGILTLYSKELRDLMDIKIFIDTDDDVRLARRLKRDIAERGRTLESVLHQYN 745
YGA+VII EGILT +S E+ L+D+KIF+DTD D+RLARRL+RDI++RGR L+ VL QY
Sbjct: 221 YGANVIIFEGILTFHSPEVLKLLDMKIFVDTDPDIRLARRLRRDISQRGRDLKGVLKQYL 280
Query: 746 TFVKPSFDDYIIPLKKYADIIVPRGSDNIVAINLLTNHIRLKLKERGFDSEKTAQLDLEG 925
VKPS+ +YI P +ADIIVPRG DN VAI+L+ H+ +L+ RGF +T +
Sbjct: 281 NMVKPSYCNYIAPTMAHADIIVPRGGDNKVAIHLIVQHVHTQLQLRGFKLRETLANSYKD 340
Query: 926 LELPSSIHVIKETNQIKAMLSILRNKDTKVGDFVFYSDRLCSLIIEEALTYLPFTEKIVT 1105
+P S+H++ T QIK + + +R ++T +F+FYS RL L+IE AL+ PF + V
Sbjct: 341 QPMPHSLHLLHPTPQIKGLHTFIRCRNTSRDEFIFYSKRLIRLVIEYALSLFPFKKTTVE 400
Query: 1106 TPTGSLYYGEELNSR-ICALVVLRAGGCMEQPLRSICKGIRTGKVLIQSD-EMKKPHLFY 1279
TP G LY G+ + SR IC + +LRAG MEQ + +CK IR GK+LIQ++ + +P L+Y
Sbjct: 401 TPQGVLYEGKRMESRKICGVSILRAGETMEQAVCDVCKDIRIGKILIQTNLKTGEPELYY 460
Query: 1280 EKLP-NVTDSHVLVLDPTIATGASSEMAIRVLLDHGVPENKIIFVSVIASLKGILYLNYR 1456
+LP ++ D V+++D T+ATGA++ MAIRVLLDH VPE+ II S++ + G+ + Y
Sbjct: 461 LRLPKDIKDYKVILMDATVATGAAAMMAIRVLLDHDVPEDNIILASLLMAEIGVHSIAYA 520
Query: 1457 FPDVQFVVSAIDKELSDEGFILP 1525
FP V+ V SA+D E++ + +++P
Sbjct: 521 FPKVKIVTSALDPEINSKFYVIP 543
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3236559
Number of Hits to DB: 1,900,012,831
Number of extensions: 34296664
Number of successful extensions: 110219
Number of sequences better than 10.0: 1036
Number of HSP's gapped: 109139
Number of HSP's successfully gapped: 1041
Length of query: 508
Length of database: 1,051,180,864
Length adjustment: 133
Effective length of query: 375
Effective length of database: 620,718,517
Effective search space: 232769443875
Effective search space used: 232769443875
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 32 (16.9 bits)
|
| PSORT |
|
| VS (DIR, S) |
0 |
| VH (FL, L) |
0 |
| VF (FL, S) |
2 |
| AH (FL, L) |
0 |
| AF (FL, S) |
2 |
| SL (DIR, L) |
0 |
| SS (DIR, S) |
0 |
| SH (FL, L) |
0 |
| SF (FL, S) |
0 |
| CH (FL, L) |
0 |
| CF (FL, S) |
0 |
| FCL (DIR, L) |
0 |
| FC (DIR, S) |
0 |
| FC-IC (SUB) |
0 |