Homology vs DNA |
Query= Contig-U14965-1 (Contig-U14965-1Q) /CSM_Contig/Contig-U14965-1Q.Seq.d (1651 letters)
Database: ddbj_A 92,845,959 sequences; 95,242,211,685 total letters
Searching..................................................done
Score E Sequences producing significant alignments: (bits) Value N
(BJ432104) Dictyostelium discoideum cDNA clone:ddv17k18, 3' ... 1336 0.0 1 (BJ341666) Dictyostelium discoideum cDNA clone:dda7l13, 3' e... 1225 0.0 1 (BJ343899) Dictyostelium discoideum cDNA clone:dda17f14, 3' ... 1152 0.0 2 (AU060809) Dictyostelium discoideum slug cDNA, clone SLB565. 1063 0.0 1 (BJ324720) Dictyostelium discoideum cDNA clone:dda7l13, 5' e... 898 0.0 2 (AU266008) Dictyostelium discoideum vegetative cDNA clone:VS... 965 0.0 2 (AU262348) Dictyostelium discoideum vegetative cDNA clone:VS... 965 0.0 1 (AU033883) Dictyostelium discoideum slug cDNA, clone SLB565. 747 0.0 2 (AU266009) Dictyostelium discoideum vegetative cDNA clone:VS... 674 0.0 1 (AU039956) Dictyostelium discoideum slug cDNA, clone SLG832. 214 8e-51 1 (EA163911) Sequence 28226 from patent US 7214786. 48 7e-12 4 (DJ129831) Method for identification of useful proteins deri... 46 2e-08 4 (DI025958) plasmid vectors for Pichia ciferrii. 40 2e-05 4 (DI010656) Glyceraldehyde-3-phosphate dehydrogenase promoter... 40 2e-05 4 (DI006527) A gene coding for serine palmitoyl transferase of... 40 2e-05 4 (BD218176) Plasmid for gene expression in pichia ciferri and... 40 2e-05 4 (AR411836) Sequence 3 from patent US 6638735. 40 2e-05 4 (AF053456) Pichia ciferrii serine palmitoyl Co-A transferase... 40 2e-05 4 (EC999139) ROE00003574 Rhizopus oryzae Company Rhizopus oryz... 46 2e-04 3 (U15645) Schizosaccharomyces pombe serine palmitoyltransfera... 46 4e-04 2 (CR531774) Anopheles gambiae EST, clone AGAGE70TR. 42 0.002 3 (EC825254) SME00001245 esmbsro2 Sawyeria marylandensis cDNA,... 48 0.007 2 (DR527699) WS02725.C21_I20 SS-IL-A-FL-14 Picea sitchensis cD... 46 0.096 2 (DR535218) WS02745.C21_J20 SS-IL-A-FL-14 Picea sitchensis cD... 46 0.097 2 (BW996653) Cryptomeria japonica cDNA, clone: CR0639, express... 38 0.20 2 (CW928928) EDCBU04TF A. castellanii, 6-8 kb library from tot... 36 0.20 2 (EC103613) ACE00013947 1:1 combination of non-normalized and... 36 0.21 2 (FE231419) CAPG1209.fwd CAPG Naegleria gruberi amoeba stage ... 34 0.30 3 (FE231649) CAPG1330.fwd CAPG Naegleria gruberi amoeba stage ... 34 0.32 3 (BM631431) 17000687502899 A.Gam.ad.cDNA1 Anopheles gambiae c... 42 0.32 2 (FE244722) CAPG8350.fwd CAPG Naegleria gruberi amoeba stage ... 34 0.34 3 (BX466369) Anopheles gambiae EST, clone NAP1-P154-A-12-5. 42 0.34 2 (BH385027) AG-ND-162B19.TF ND-TAM Anopheles gambiae genomic ... 42 0.35 2 (FE241254) CAPG6594.fwd CAPG Naegleria gruberi amoeba stage ... 34 0.36 3 (FE240281) CAPG5776.fwd CAPG Naegleria gruberi amoeba stage ... 34 0.36 3 (AJ242659) Solanum tuberosum partial mRNA for serine palmito... 38 0.38 3 (AL146045) Anopheles gambiae GSS T7 end of clone 11J20 of No... 42 0.50 2 (BX010490) Single read from an extremity of a full-length cD... 42 0.52 2 (EX851003) CBNC8785.rev CBNC Phycomyces blakesleeanus NRRL15... 32 0.84 4 (EX847823) CBNC7091.rev CBNC Phycomyces blakesleeanus NRRL15... 32 0.88 4 (EX845330) CBNC5848.rev CBNC Phycomyces blakesleeanus NRRL15... 32 1.0 4 (AC210074) Zea mays chromosome 9 clone ZMMBBb-332G6; ZMMBBb0... 48 1.1 1 (AC181238) Strongylocentrotus purpuratus clone R3-4010K13, W... 48 1.1 1 (AC181237) Strongylocentrotus purpuratus clone R3-4010J24, W... 48 1.1 1 (EC951972) WIN0554.C21_D20 Cab Sauv flower, leaf and root no... 48 1.1 1 (EB028445) LscoSEQ9007 Leucosporidium scottii pBluescript (E... 48 1.1 1 (EB026166) LscoSEQ6305 Leucosporidium scottii pBluescript (E... 48 1.1 1 (DY379548) ZO__Eg0006I14.r ZO__Eg Zingiber officinale cDNA c... 48 1.1 1 (DV138779) CV03120B2H09.f1 CV03-normalized library Euphorbia... 48 1.1 1 (DN312777) PL06013B2E01 cDNA from juvenile hermaphodites Sch... 48 1.1 1 (AJ720538) Gallus gallus mRNA for hypothetical protein, clon... 40 1.1 2 (EX843674) CBNC493.rev CBNC Phycomyces blakesleeanus NRRL155... 32 1.2 4 (EC822194) SME00006846 esmbsro2 Sawyeria marylandensis cDNA,... 40 1.2 2 (EX813064) CBNA3284.rev CBNA Phycomyces blakesleeanus NRRL15... 32 1.2 4 (EX851099) CBNC8843.rev CBNC Phycomyces blakesleeanus NRRL15... 32 1.3 4 (EC853831) HDE00004475 Hyperamoeba dachnaya Non-normalized (... 38 1.6 3 (CA473279) AGENCOURT_10696006 NCI_CGAP_ZKid1 Danio rerio cDN... 42 1.7 2 (AC129452) Rattus norvegicus clone CH230-9I8, WORKING DRAFT ... 34 2.1 2 (DX214668) OR_ABa0088M23.r OR_ABa Oryza ridleyi genomic clon... 32 2.9 2 (AM471378) Vitis vinifera contig VV78X137856.13, whole genom... 38 4.1 4 (BV104984) MARC 24085-24086:1037392210:3 RTS-1 Bos indicus x... 46 4.2 1 (BV104970) MARC 24085-24086:1037392210:1 RTS-1 Bos indicus x... 46 4.2 1 (BV103808) MARC 24069-24070:1030027541:1 RTS-1 Bos indicus x... 46 4.2 1 (EU092396) Yucca filamentosa rps16 gene, intron; chloroplast. 46 4.2 1 (CU329670) Schizosaccharomyces pombe chromosome I. 46 4.2 1 (AF488723) Aspergillus nidulans serine palmitoyl transferase... 46 4.2 1 (EA387967) Sequence 36791 from patent US 7314974. 46 4.2 1 (EA378769) Sequence 27592 from patent US 7314974. 46 4.2 1 (AC220047) Bos taurus clone CH240-315E13, WORKING DRAFT SEQU... 46 4.2 1 (AC181216) Strongylocentrotus purpuratus clone R3-4008O05, W... 46 4.2 1 (AC181052) Strongylocentrotus purpuratus clone R3-3050L21, W... 46 4.2 1 (AC163192) Bos taurus clone CH240-124L12, WORKING DRAFT SEQU... 46 4.2 1 (EK388956) 1095469493472 Global-Ocean-Sampling_GS-31-01-01-1... 46 4.2 1 (EJ929626) 1093018799852 Global-Ocean-Sampling_GS-30-02-01-1... 46 4.2 1 (EJ924616) 1093018776188 Global-Ocean-Sampling_GS-30-02-01-1... 46 4.2 1 (ED798541) MG__Ba0002B21r MG__Ba Mimulus guttatus genomic, g... 46 4.2 1 (CW737042) MARC_831828 RPCI-42-290L9 Bos taurus genomic clon... 46 4.2 1 (DV977012) GQ00610.B3.1_D05 GQ006: Cambium and phloem from m... 46 4.2 1 (DR029704) bda010084_C12_11.b1_046.ab1 Antrodia cinnamomea c... 46 4.2 1 (DR028177) bda010042_B05_11.b1_023.ab1 Antrodia cinnamomea c... 46 4.2 1 (EX363685) GQ03207.B7_O10 GQ032 - Shoot tip (Normalized libr... 46 4.2 1 (BA000043) Geobacillus kaustophilus HTA426 DNA, complete gen... 46 4.2 1 (EC342617) KIDNEYF089708G2 POSSUM_01-POSSUM-KIDNEY-2KB Trich... 44 4.9 2 (AL953869) Zebrafish DNA sequence from clone CH211-261J13 in... 34 7.8 2
>(BJ432104) Dictyostelium discoideum cDNA clone:ddv17k18, 3' end, single read. Length = 674
Score = 1336 bits (674), Expect = 0.0 Identities = 674/674 (100%) Strand = Plus / Minus
Query: 747 gagagtcaatcattcaaggtcaaccacgtactcatcgtccatggactatgattttaatca 806 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 674 gagagtcaatcattcaaggtcaaccacgtactcatcgtccatggactatgattttaatca 615
Query: 807 ttattgaaggtatctactctatggagggtgaggttgcaaatcttccagagattcttgcca 866 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 614 ttattgaaggtatctactctatggagggtgaggttgcaaatcttccagagattcttgcca 555
Query: 867 tcaaaaagaagtacaaatgttacctctacatcgatgaggctcattcaattggtgcccttg 926 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 554 tcaaaaagaagtacaaatgttacctctacatcgatgaggctcattcaattggtgcccttg 495
Query: 927 gtaaaacgggtcgtggtatcgtcgattactatggtatcgatccaaaggagatcgatatcc 986 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 494 gtaaaacgggtcgtggtatcgtcgattactatggtatcgatccaaaggagatcgatatcc 435
Query: 987 ttatgggtacttacacaaaatcatttggtgcaatcggtggttatgttgcaagtgataaat 1046 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 434 ttatgggtacttacacaaaatcatttggtgcaatcggtggttatgttgcaagtgataaat 375
Query: 1047 ctttgatcgatcatcttcgtcaatcttctttctctcaagtttatgcaaatagtatgagtc 1106 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 374 ctttgatcgatcatcttcgtcaatcttctttctctcaagtttatgcaaatagtatgagtc 315
Query: 1107 cagtttgcgctgtgcaagctttggaggctttacgtgttatcatgggtgaagatggtactg 1166 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 314 cagtttgcgctgtgcaagctttggaggctttacgtgttatcatgggtgaagatggtactg 255
Query: 1167 acactggtgcaaagaaattaaaacaattacatgacaattcaaattactttagagagaaaa 1226 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 254 acactggtgcaaagaaattaaaacaattacatgacaattcaaattactttagagagaaaa 195
Query: 1227 ttcgtgaaatgggtttcgttatcttgggtaataaagactctccagtcattcctttgatgt 1286 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 194 ttcgtgaaatgggtttcgttatcttgggtaataaagactctccagtcattcctttgatgt 135
Query: 1287 tatttaatcctgctaaattatcggctttctcccgtctttgtctagagaaacatattgctg 1346 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 134 tatttaatcctgctaaattatcggctttctcccgtctttgtctagagaaacatattgctg 75
Query: 1347 tcgttgtcgttggttatcctgctacacctttaactgaaccacgtactcgtttctgtattt 1406 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 74 tcgttgtcgttggttatcctgctacacctttaactgaaccacgtactcgtttctgtattt 15
Query: 1407 cagcttctcatacc 1420 |||||||||||||| Sbjct: 14 cagcttctcatacc 1
Lambda K H 1.37 0.711 1.31
Matrix: blastn matrix:1 -3 Number of Sequences: 92845959 Number of Hits to DB: 1,542,242,108 Number of extensions: 85192759 Number of successful extensions: 6424117 Number of sequences better than 10.0: 85 Length of query: 1651 Length of database: 95,242,211,685 Length adjustment: 24 Effective length of query: 1627 Effective length of database: 97,308,875,965 Effective search space: 158321541195055 Effective search space used: 158321541195055 X1: 11 (21.8 bits) S2: 22 (44.1 bits)
|
Homology vs Protein |
Query= Contig-U14965-1 (Contig-U14965-1Q) /CSM_Contig/Contig-U14965-1Q.Seq.d (1651 letters)
Database: nrp_B 3,236,559 sequences; 1,051,180,864 total letters
Searching..................................................done
Score E Sequences producing significant alignments: (bits) Value
(Q54EX5) RecName: Full=Serine palmitoyltransferase 2; E... 962 0.0 BC159260_1(BC159260|pid:none) Danio rerio zgc:175221, mRNA (cDNA... 510 e-143 BC073312_1(BC073312|pid:none) Xenopus laevis MGC80715 protein, m... 504 e-141 AK120617_1(AK120617|pid:none) Oryza sativa Japonica Group cDNA c... 503 e-140 BC107662_1(BC107662|pid:none) Rattus norvegicus serine palmitoyl... 502 e-140 (P97363) RecName: Full=Serine palmitoyltransferase 2; E... 502 e-140 JC5180(JC5180)serine C-palmitoyltransferase (EC 2.3.1.50) Lcb2 c... 502 e-140 AB011098_1(AB011098|pid:none) Homo sapiens mRNA for KIAA0526 pro... 499 e-139 (O15270) RecName: Full=Serine palmitoyltransferase 2; E... 499 e-139 BT054227_1(BT054227|pid:none) Zea mays full-length cDNA clone ZM... 494 e-138 BT061034_1(BT061034|pid:none) Zea mays full-length cDNA clone ZM... 494 e-138 BC095355_1(BC095355|pid:none) Danio rerio serine palmitoyltransf... 494 e-138 AP008217_981(AP008217|pid:none) Oryza sativa (japonica cultivar-... 490 e-137 AB025633_19(AB025633|pid:none) Arabidopsis thaliana genomic DNA,... 489 e-137 AB378334_1(AB378334|pid:none) Nicotiana benthamiana mRNA for ser... 488 e-136 AB264104_1(AB264104|pid:none) Nicotiana tabacum NtLCB2 mRNA for ... 487 e-136 AB074928_1(AB074928|pid:none) Arabidopsis thaliana AtLCB2.2 mRNA... 485 e-135 BC110750_1(BC110750|pid:none) Xenopus laevis hypothetical protei... 484 e-135 AP004330_9(AP004330|pid:none) Oryza sativa Japonica Group genomi... 480 e-134 AM270166_30(AM270166|pid:none) Aspergillus niger contig An08c011... 474 e-132 AK241034_1(AK241034|pid:none) Oryza sativa Japonica Group cDNA, ... 473 e-132 (Q9NUV7) RecName: Full=Serine palmitoyltransferase 3; E... 473 e-132 AM920428_1080(AM920428|pid:none) Penicillium chrysogenum Wiscons... 466 e-129 CU633900_545(CU633900|pid:none) Podospora anserina genomic DNA c... 464 e-129 CU928180_338(CU928180|pid:none) Kluyveromyces thermotolerans str... 451 e-125 FN357583_20(FN357583|pid:none) Schistosoma mansoni genome sequen... 449 e-124 AB017359_1(AB017359|pid:none) Drosophila melanogaster mRNA for s... 444 e-123 AE014134_2692(AE014134|pid:none) Drosophila melanogaster chromos... 444 e-123 AP007150_412(AP007150|pid:none) Aspergillus oryzae RIB40 genomic... 444 e-123 L33931_1(L33931|pid:none) Saccharomyces cerevisiae Scs1p (SCS1) ... 443 e-123 AE016820_496(AE016820|pid:none) Ashbya gossypii (= Eremothecium ... 443 e-123 (P40970) RecName: Full=Serine palmitoyltransferase 2; S... 443 e-122 AY723771_1(AY723771|pid:none) Saccharomyces cerevisiae clone FLH... 442 e-122 CP000081_33(CP000081|pid:none) Leishmania major chromosome 35, c... 440 e-122 (Q09925) RecName: Full=Serine palmitoyltransferase 2; S... 439 e-121 CU928179_376(CU928179|pid:none) Zygosaccharomyces rouxii strain ... 438 e-121 AY235574_1(AY235574|pid:none) Leishmania major serine palmitoylt... 438 e-121 AM502253_41(AM502253|pid:none) Leishmania infantum chromosome 35. 437 e-121 CP000500_30(CP000500|pid:none) Pichia stipitis CBS 6054 chromoso... 432 e-119 (Q8BG54) RecName: Full=Serine palmitoyltransferase 3; E... 430 e-119 JC5182(JC5182) serine C-palmitoyltransferase (EC 2.3.1.50) Lcb2 ... 429 e-118 AE017343_708(AE017343|pid:none) Cryptococcus neoformans var. neo... 425 e-117 CR382138_1078(CR382138|pid:none) Debaryomyces hansenii strain CB... 419 e-115 AF053456_1(AF053456|pid:none) Pichia ciferrii serine palmitoyl C... 412 e-113 Z81127_8(Z81127|pid:none) Caenorhabditis elegans Cosmid T22G5, c... 404 e-111 CR954203_504(CR954203|pid:none) Ostreococcus tauri strain OTTH05... 397 e-109 T25126(T25126)serine C-palmitoyltransferase (EC 2.3.1.50) T22G5.... 396 e-108 CP000581_268(CP000581|pid:none) Ostreococcus lucimarinus CCE9901... 390 e-107 I38873(I38873;PC4253) serine C-palmitoyltransferase (EC 2.3.1.50... 370 e-101 AM902524_1(AM902524|pid:none) Nicotiana benthamiana partial mRNA... 360 1e-97 BC094496_1(BC094496|pid:none) Mus musculus serine palmitoyltrans... 312 2e-83 AK229667_1(AK229667|pid:none) Arabidopsis thaliana mRNA for seri... 277 7e-73 EF690289_1(EF690289|pid:none) Gossypium hirsutum serine C-palmit... 269 2e-70 CP001185_1463(CP001185|pid:none) Thermosipho africanus TCF52B, c... 247 8e-64 CP000771_1281(CP000771|pid:none) Fervidobacterium nodosum Rt17-B... 243 2e-62 CP000923_759(CP000923|pid:none) Thermoanaerobacter sp. X514, com... 237 8e-61 CP000924_283(CP000924|pid:none) Thermoanaerobacter pseudethanoli... 236 2e-60 CP000879_1501(CP000879|pid:none) Petrotoga mobilis SJ95, complet... 235 3e-60 CP000393_1694(CP000393|pid:none) Trichodesmium erythraeum IMS101... 235 3e-60 AE017226_2178(AE017226|pid:none) Treponema denticola ATCC 35405,... 233 1e-59 CP000853_886(CP000853|pid:none) Alkaliphilus oremlandii OhILAs, ... 232 3e-59 AP006840_1872(AP006840|pid:none) Symbiobacterium thermophilum IA... 228 7e-58 AP006841_2377(AP006841|pid:none) Bacteroides fragilis YCH46 DNA,... 225 3e-57 CR626927_2380(CR626927|pid:none) Bacteroides fragilis NCTC 9343,... 225 3e-57 AL939125_142(AL939125|pid:none) Streptomyces coelicolor A3(2) co... 224 6e-57 BT048263_1(BT048263|pid:none) Salmo salar clone ssal-sjb-013-045... 224 7e-57 AB469822_9(AB469822|pid:none) Streptomyces griseoviridis DNA, in... 218 4e-55 CP001472_1830(CP001472|pid:none) Acidobacterium capsulatum ATCC ... 215 4e-54 AJ248288_134(AJ248288|pid:none) Pyrococcus abyssi complete genom... 213 2e-53 AL445066_256(AL445066|pid:none) Thermoplasma acidophilum complet... 212 4e-53 CP000560_1599(CP000560|pid:none) Bacillus amyloliquefaciens FZB4... 212 4e-53 CP000140_1817(CP000140|pid:none) Parabacteroides distasonis ATCC... 211 5e-53 (O31777) RecName: Full=2-amino-3-ketobutyrate coenzyme A ligase;... 211 5e-53 AP006878_2218(AP006878|pid:none) Thermococcus kodakarensis KOD1 ... 211 5e-53 GM016639_8(GM016639|pid:none) Sequence 1469 from Patent EP1923464. 211 5e-53 AP008934_2205(AP008934|pid:none) Staphylococcus saprophyticus su... 211 5e-53 AE009950_265(AE009950|pid:none) Pyrococcus furiosus DSM 3638, co... 211 6e-53 CP000855_1422(CP000855|pid:none) Thermococcus onnurineus NA1, co... 211 6e-53 CP000764_2673(CP000764|pid:none) Bacillus cereus subsp. cytotoxi... 211 6e-53 AP011115_7009(AP011115|pid:none) Rhodococcus opacus B4 DNA, comp... 209 2e-52 AE015928_870(AE015928|pid:none) Bacteroides thetaiotaomicron VPI... 209 3e-52 AB066587_2(AB066587|pid:none) Thermus thermophilus genes for hyp... 208 4e-52 CP000679_1163(CP000679|pid:none) Caldicellulosiruptor saccharoly... 208 5e-52 CP001146_533(CP001146|pid:none) Dictyoglomus thermophilum H-6-12... 207 9e-52 CP000360_3914(CP000360|pid:none) Acidobacteria bacterium Ellin34... 207 1e-51 AE017308_580(AE017308|pid:none) Mycoplasma mobile 163K complete ... 206 3e-51 CT573072_426(CT573072|pid:none) Kuenenia stuttgartiensis genome ... 204 6e-51 CP001022_1025(CP001022|pid:none) Exiguobacterium sibiricum 255-1... 203 2e-50 CP000813_1586(CP000813|pid:none) Bacillus pumilus SAFR-032, comp... 202 2e-50 AP006716_2457(AP006716|pid:none) Staphylococcus haemolyticus JCS... 202 3e-50 BA000030_101(BA000030|pid:none) Streptomyces avermitilis MA-4680... 201 5e-50 CP001615_421(CP001615|pid:none) Exiguobacterium sp. AT1b, comple... 201 7e-50 CP001016_1094(CP001016|pid:none) Beijerinckia indica subsp. indi... 201 7e-50 CP000568_22(CP000568|pid:none) Clostridium thermocellum ATCC 274... 201 9e-50 FN317158_1(FN317158|pid:none) Schistosoma japonicum isolate Anhu... 199 2e-49 AP006841_1959(AP006841|pid:none) Bacteroides fragilis YCH46 DNA,... 198 4e-49 AY882435_3(AY882435|pid:none) Sinorhizobium fredii strain HH103 ... 198 6e-49 CU466930_1108(CU466930|pid:none) Candidatus Cloacamonas acidamin... 197 7e-49 AK300184_1(AK300184|pid:none) Homo sapiens cDNA FLJ52240 complet... 197 7e-49 AL591688_577(AL591688|pid:none) Sinorhizobium meliloti 1021 comp... 196 2e-48 CP000473_5103(CP000473|pid:none) Solibacter usitatus Ellin6076, ... 196 2e-48 CP001068_1123(CP001068|pid:none) Ralstonia pickettii 12J chromos... 196 2e-48 CP000148_834(CP000148|pid:none) Geobacter metallireducens GS-15,... 196 2e-48 AB259215_1(AB259215|pid:none) Sphingobacterium spiritivorum spt ... 196 3e-48 AE017180_2614(AE017180|pid:none) Geobacter sulfurreducens PCA, c... 195 4e-48 AE017194_685(AE017194|pid:none) Bacillus cereus ATCC 10987, comp... 195 4e-48 CP001389_204(CP001389|pid:none) Rhizobium sp. NGR234, complete g... 195 4e-48 AP009153_656(AP009153|pid:none) Gemmatimonas aurantiaca T-27 DNA... 194 6e-48 CP001186_535(CP001186|pid:none) Bacillus cereus G9842, complete ... 194 8e-48 CP000712_3867(CP000712|pid:none) Pseudomonas putida F1, complete... 194 1e-47 (P60120) RecName: Full=2-amino-3-ketobutyrate coenzyme A ligase;... 194 1e-47 AP009324_548(AP009324|pid:none) Staphylococcus aureus subsp. aur... 194 1e-47 CP000951_1948(CP000951|pid:none) Synechococcus sp. PCC 7002, com... 193 1e-47 CP000903_531(CP000903|pid:none) Bacillus weihenstephanensis KBAB... 193 1e-47 CP000764_507(CP000764|pid:none) Bacillus cereus subsp. cytotoxis... 193 1e-47 AP009484_1859(AP009484|pid:none) Macrococcus caseolyticus JCSC54... 193 1e-47 CP000116_669(CP000116|pid:none) Thiobacillus denitrificans ATCC ... 193 1e-47 AE016879_4000(AE016879|pid:none) Bacillus anthracis str. Ames, c... 193 2e-47 AJ938182_501(AJ938182|pid:none) Staphylococcus aureus RF122 comp... 193 2e-47 AE017194_4152(AE017194|pid:none) Bacillus cereus ATCC 10987, com... 192 2e-47 CP000159_502(CP000159|pid:none) Salinibacter ruber DSM 13855, co... 192 2e-47 AP009385_627(AP009385|pid:none) Burkholderia multivorans ATCC 17... 192 2e-47 (O66875) RecName: Full=8-amino-7-oxononanoate synthase; ... 192 3e-47 CP000485_525(CP000485|pid:none) Bacillus thuringiensis str. Al H... 192 3e-47 AE017355_517(AE017355|pid:none) Bacillus thuringiensis serovar k... 192 3e-47 AP008955_5461(AP008955|pid:none) Brevibacillus brevis NBRC 10059... 192 3e-47 AM778909_31(AM778909|pid:none) Microcystis aeruginosa PCC 7806 g... 192 3e-47 (Q81V80) RecName: Full=2-amino-3-ketobutyrate coenzyme A ligase;... 192 4e-47 CP000001_3834(CP000001|pid:none) Bacillus cereus E33L, complete ... 192 4e-47 (Q6GJB8) RecName: Full=2-amino-3-ketobutyrate coenzyme A ligase;... 191 5e-47 CP000485_3540(CP000485|pid:none) Bacillus thuringiensis str. Al ... 191 5e-47 CP000390_442(CP000390|pid:none) Mesorhizobium sp. BNC1, complete... 191 7e-47 CP000482_2060(CP000482|pid:none) Pelobacter propionicus DSM 2379... 191 9e-47 AP008955_2595(AP008955|pid:none) Brevibacillus brevis NBRC 10059... 191 9e-47 CP000140_2864(CP000140|pid:none) Parabacteroides distasonis ATCC... 191 9e-47 AB045875_1(AB045875|pid:none) Kurthia sp. 538-KA26 bioFII, bioHI... 190 1e-46 CR628337_742(CR628337|pid:none) Legionella pneumophila str. Lens... 190 2e-46 CP000227_3806(CP000227|pid:none) Bacillus cereus Q1, complete ge... 189 2e-46 (Q81I05) RecName: Full=2-amino-3-ketobutyrate coenzyme A ligase;... 189 2e-46 CP000875_2286(CP000875|pid:none) Herpetosiphon aurantiacus ATCC ... 189 3e-46 CP001280_1333(CP001280|pid:none) Methylocella silvestris BL2, co... 189 3e-46 CP001114_2509(CP001114|pid:none) Deinococcus deserti VCD115, com... 189 3e-46 CP000769_2910(CP000769|pid:none) Anaeromyxobacter sp. Fw109-5, c... 188 4e-46 CP000151_691(CP000151|pid:none) Burkholderia sp. 383 chromosome ... 188 4e-46 CP001390_2061(CP001390|pid:none) Geobacter sp. FRC-32, complete ... 188 4e-46 AB259216_1(AB259216|pid:none) Bacteriovorax stolpii spt gene for... 188 6e-46 CP000086_1330(CP000086|pid:none) Burkholderia thailandensis E264... 188 6e-46 CP000738_2197(CP000738|pid:none) Sinorhizobium medicae WSM419, c... 188 6e-46 FM954973_428(FM954973|pid:none) Vibrio splendidus LGP32 chromoso... 187 7e-46 AM902716_2322(AM902716|pid:none) Bordetella petrii strain DSM 12... 187 7e-46 AJ938182_1880(AJ938182|pid:none) Staphylococcus aureus RF122 com... 187 1e-45 AM420293_4220(AM420293|pid:none) Saccharopolyspora erythraea NRR... 187 1e-45 CP001001_934(CP001001|pid:none) Methylobacterium radiotolerans J... 187 1e-45 CP000010_1988(CP000010|pid:none) Burkholderia mallei ATCC 23344 ... 186 2e-45 CP000628_2350(CP000628|pid:none) Agrobacterium radiobacter K84 c... 186 2e-45 CP001071_75(CP001071|pid:none) Akkermansia muciniphila ATCC BAA-... 186 2e-45 AE005673_1158(AE005673|pid:none) Caulobacter crescentus CB15, co... 186 3e-45 CP000698_3189(CP000698|pid:none) Geobacter uraniireducens Rf4, c... 186 3e-45 CP000251_2086(CP000251|pid:none) Anaeromyxobacter dehalogenans 2... 186 3e-45 CP001614_431(CP001614|pid:none) Teredinibacter turnerae T7901, c... 185 5e-45 AM236080_3406(AM236080|pid:none) Rhizobium leguminosarum bv. vic... 185 5e-45 CP000510_1758(CP000510|pid:none) Psychromonas ingrahamii 37, com... 185 5e-45 AK172965_1(AK172965|pid:none) Mus musculus mRNA for mKIAA0526 pr... 184 6e-45 BA000032_1510(BA000032|pid:none) Vibrio parahaemolyticus RIMD 22... 184 8e-45 CP001133_458(CP001133|pid:none) Vibrio fischeri MJ11 chromosome ... 184 1e-44 AE016877_3926(AE016877|pid:none) Bacillus cereus ATCC 14579, com... 183 1e-44 CP000378_297(CP000378|pid:none) Burkholderia cenocepacia AU 1054... 183 2e-44 CP000958_750(CP000958|pid:none) Burkholderia cenocepacia MC0-3 c... 183 2e-44 CP000975_1448(CP000975|pid:none) Methylacidiphilum infernorum V4... 182 2e-44 CR378668_190(CR378668|pid:none) Photobacterium profundum SS9; se... 182 2e-44 CP000133_2912(CP000133|pid:none) Rhizobium etli CFN 42, complete... 182 3e-44 CP001359_1844(CP001359|pid:none) Anaeromyxobacter dehalogenans 2... 182 3e-44 AL591688_2325(AL591688|pid:none) Sinorhizobium meliloti 1021 com... 181 5e-44 CP000159_369(CP000159|pid:none) Salinibacter ruber DSM 13855, co... 181 5e-44 CP000151_1804(CP000151|pid:none) Burkholderia sp. 383 chromosome... 181 7e-44 X64131_7(X64131|pid:none) R.meliloti DNA for fix23 ORF1, ORF2, O... 181 7e-44 CP000036_3371(CP000036|pid:none) Shigella boydii Sb227, complete... 181 9e-44 BA000012_6527(BA000012|pid:none) Mesorhizobium loti MAFF303099 D... 181 9e-44 AM420293_6205(AM420293|pid:none) Saccharopolyspora erythraea NRR... 181 9e-44 CP000922_1155(CP000922|pid:none) Anoxybacillus flavithermus WK1,... 181 9e-44 CP000964_133(CP000964|pid:none) Klebsiella pneumoniae 342, compl... 180 1e-43 CP000749_3748(CP000749|pid:none) Marinomonas sp. MWYL1, complete... 180 1e-43 AE016828_104(AE016828|pid:none) Coxiella burnetii RSA 493, compl... 180 1e-43 AP009384_37(AP009384|pid:none) Azorhizobium caulinodans ORS 571 ... 180 1e-43 AY590466_3(AY590466|pid:none) Uncultured bacterium hypothetical ... 180 2e-43 CP001287_66(CP001287|pid:none) Cyanothece sp. PCC 8801, complete... 180 2e-43 AE017340_269(AE017340|pid:none) Idiomarina loihiensis L2TR, comp... 180 2e-43 EF063590_7(EF063590|pid:none) Janthinobacterium lividum strain B... 179 2e-43 CP000613_726(CP000613|pid:none) Rhodospirillum centenum SW, comp... 179 2e-43 AP009510_561(AP009510|pid:none) Uncultured Termite group 1 bacte... 179 2e-43 AM920689_3451(AM920689|pid:none) Xanthomonas campestris pv. camp... 178 5e-43 CP000482_2725(CP000482|pid:none) Pelobacter propionicus DSM 2379... 178 5e-43 CP000113_1229(CP000113|pid:none) Myxococcus xanthus DK 1622, com... 178 5e-43 CP001124_821(CP001124|pid:none) Geobacter bemidjiensis Bem, comp... 178 5e-43 BC067149_1(BC067149|pid:none) Danio rerio aminolevulinate, delta... 178 6e-43 AM889285_2397(AM889285|pid:none) Gluconacetobacter diazotrophicu... 178 6e-43 (Q9YHT4) RecName: Full=5-aminolevulinate synthase, erythroid-spe... 178 6e-43 CP000615_469(CP000615|pid:none) Burkholderia vietnamiensis G4 ch... 178 6e-43 AE014296_2161(AE014296|pid:none) Drosophila melanogaster chromos... 178 6e-43 AP009386_5(AP009386|pid:none) Burkholderia multivorans ATCC 1761... 177 8e-43 CP001020_1719(CP001020|pid:none) Coxiella burnetii CbuK_Q154, co... 177 8e-43 CP001157_584(CP001157|pid:none) Azotobacter vinelandii DJ, compl... 177 8e-43 CP000668_3763(CP000668|pid:none) Yersinia pestis Pestoides F, co... 177 8e-43 (P0AB77) RecName: Full=2-amino-3-ketobutyrate coenzyme A ligase;... 177 8e-43 CP000929_134(CP000929|pid:none) Caulobacter sp. K31 plasmid pCAU... 177 1e-42 CP000152_3172(CP000152|pid:none) Burkholderia sp. 383 chromosome... 177 1e-42 CP000607_315(CP000607|pid:none) Chlorobium phaeovibrioides DSM 2... 177 1e-42 AJ833002_9(AJ833002|pid:none) Serratia marcescens prodigiosin bi... 177 1e-42 CP001089_1639(CP001089|pid:none) Geobacter lovleyi SZ, complete ... 177 1e-42 CP000653_118(CP000653|pid:none) Enterobacter sp. 638, complete g... 177 1e-42 AE013598_3620(AE013598|pid:none) Xanthomonas oryzae pv. oryzae K... 177 1e-42 CP000720_68(CP000720|pid:none) Yersinia pseudotuberculosis IP 31... 177 1e-42 AP008229_3486(AP008229|pid:none) Xanthomonas oryzae pv. oryzae M... 177 1e-42 CP001130_533(CP001130|pid:none) Hydrogenobaculum sp. Y04AAS1, co... 177 1e-42 CP000034_3733(CP000034|pid:none) Shigella dysenteriae Sd197, com... 176 2e-42 AM286415_70(AM286415|pid:none) Yersinia enterocolitica subsp. en... 176 2e-42 CP000302_3593(CP000302|pid:none) Shewanella denitrificans OS217,... 176 2e-42 BA000013_159(BA000013|pid:none) Mesorhizobium loti MAFF303099 pM... 176 2e-42 CP000462_4074(CP000462|pid:none) Aeromonas hydrophila subsp. hyd... 176 2e-42 CP000038_3533(CP000038|pid:none) Shigella sonnei Ss046, complete... 176 2e-42 AE014299_4546(AE014299|pid:none) Shewanella oneidensis MR-1, com... 176 2e-42 (P37419) RecName: Full=2-amino-3-ketobutyrate coenzyme A ligase;... 176 2e-42 EU556495_1(EU556495|pid:none) Vibrio orientalis strain ATCC 3393... 176 2e-42 CP000854_773(CP000854|pid:none) Mycobacterium marinum M, complet... 176 2e-42 CP000439_608(CP000439|pid:none) Francisella tularensis subsp. no... 176 3e-42 CP000943_301(CP000943|pid:none) Methylobacterium sp. 4-46, compl... 176 3e-42 CP001026_12(CP001026|pid:none) Burkholderia ambifaria MC40-6 chr... 176 3e-42 CP000685_695(CP000685|pid:none) Flavobacterium johnsoniae UW101,... 176 3e-42 AE014613_3547(AE014613|pid:none) Salmonella enterica subsp. ente... 176 3e-42 CP000155_1566(CP000155|pid:none) Hahella chejuensis KCTC 2396, c... 176 3e-42 CP000608_1226(CP000608|pid:none) Francisella tularensis subsp. t... 176 3e-42 CP001600_71(CP001600|pid:none) Edwardsiella ictaluri 93-146, com... 175 4e-42 AM747721_12(AM747721|pid:none) Burkholderia cenocepacia J2315 ch... 175 4e-42 CP000441_1747(CP000441|pid:none) Burkholderia ambifaria AMMD chr... 175 4e-42 CP000915_1087(CP000915|pid:none) Francisella tularensis subsp. m... 175 4e-42 AM743169_905(AM743169|pid:none) Stenotrophomonas maltophilia K27... 175 4e-42 AE014075_4349(AE014075|pid:none) Escherichia coli CFT073, comple... 175 4e-42 AP009493_1443(AP009493|pid:none) Streptomyces griseus subsp. gri... 175 4e-42 AL939129_89(AL939129|pid:none) Streptomyces coelicolor A3(2) com... 175 4e-42 CU928164_4106(CU928164|pid:none) Escherichia coli IAI39 chromoso... 175 5e-42 CP000812_1990(CP000812|pid:none) Thermotoga lettingae TMO, compl... 175 5e-42 (Q3MHG1) RecName: Full=Serine palmitoyltransferase 1; E... 175 5e-42 CP000802_3634(CP000802|pid:none) Escherichia coli HS, complete g... 175 5e-42 CP000243_4081(CP000243|pid:none) Escherichia coli UTI89, complet... 175 5e-42 CP000379_2151(CP000379|pid:none) Burkholderia cenocepacia AU 105... 175 5e-42 CP001032_2647(CP001032|pid:none) Opitutus terrae PB90-1, complet... 174 7e-42 CP000927_1676(CP000927|pid:none) Caulobacter sp. K31, complete g... 174 7e-42 CP000158_2026(CP000158|pid:none) Hyphomonas neptunium ATCC 15444... 174 7e-42 AL954747_1656(AL954747|pid:none) Nitrosomonas europaea ATCC 1971... 174 7e-42 CP001281_499(CP001281|pid:none) Thauera sp. MZ1T, complete genome. 174 7e-42 CP000468_3600(CP000468|pid:none) Escherichia coli APEC O1, compl... 174 7e-42 CP001053_2918(CP001053|pid:none) Burkholderia phytofirmans PsJN ... 174 9e-42 AP006618_4339(AP006618|pid:none) Nocardia farcinica IFM 10152 DN... 174 9e-42 (Q60HD1) RecName: Full=Serine palmitoyltransferase 1; E... 173 1e-41 CP000125_1508(CP000125|pid:none) Burkholderia pseudomallei 1710b... 173 1e-41 CP000316_4288(CP000316|pid:none) Polaromonas sp. JS666, complete... 173 2e-41 (Q5R9T5) RecName: Full=Serine palmitoyltransferase 1; E... 173 2e-41 CP001280_2665(CP001280|pid:none) Methylocella silvestris BL2, co... 173 2e-41 CP000937_209(CP000937|pid:none) Francisella philomiragia subsp. ... 173 2e-41 AB169195_1(AB169195|pid:none) Macaca fascicularis testis cDNA, c... 172 2e-41 CP000507_98(CP000507|pid:none) Shewanella amazonensis SB2B, comp... 172 2e-41 CP000781_3770(CP000781|pid:none) Xanthobacter autotrophicus Py2,... 172 2e-41 CR860225_1(CR860225|pid:none) Pongo abelii mRNA; cDNA DKFZp469J0... 172 3e-41 (Q5R557) RecName: Full=5-aminolevulinate synthase, erythroid-spe... 172 3e-41 BX908798_811(BX908798|pid:none) Parachlamydia-related symbiont U... 172 3e-41 CP000573_5(CP000573|pid:none) Burkholderia pseudomallei 1106a ch... 172 3e-41 CP001230_1205(CP001230|pid:none) Persephonella marina EX-H1, com... 172 3e-41 AK291589_1(AK291589|pid:none) Homo sapiens cDNA FLJ77319 complet... 172 3e-41 BX571966_5(BX571966|pid:none) Burkholderia pseudomallei strain K... 172 3e-41 BC047258_1(BC047258|pid:none) Xenopus laevis glycine C-acetyltra... 172 3e-41 CP000802_2991(CP000802|pid:none) Escherichia coli HS, complete g... 172 3e-41 CU928163_3391(CU928163|pid:none) Escherichia coli UMN026 chromos... 172 4e-41 CR761814_1(CR761814|pid:none) Xenopus tropicalis finished cDNA, ... 172 4e-41 CP000075_4685(CP000075|pid:none) Pseudomonas syringae pv. syring... 172 4e-41 CU928164_3452(CU928164|pid:none) Escherichia coli IAI39 chromoso... 172 4e-41 AK053207_1(AK053207|pid:none) Mus musculus 0 day neonate lung cD... 172 4e-41 AK089030_1(AK089030|pid:none) Mus musculus 2 days neonate thymus... 172 4e-41 AK165257_1(AK165257|pid:none) Mus musculus 6 days neonate spleen... 171 6e-41 CP000108_225(CP000108|pid:none) Chlorobium chlorochromatii CaD3,... 171 6e-41 (P08680) RecName: Full=5-aminolevulinate synthase, erythroid-spe... 171 6e-41 CP000908_1916(CP000908|pid:none) Methylobacterium extorquens PA1... 171 6e-41 M15268_1(M15268|pid:none) Mouse 5-aminolevulinic acid synthase m... 171 6e-41 AF003823_1(AF003823|pid:none) Mus musculus serine palmitoyltrans... 171 6e-41 AK002642_1(AK002642|pid:none) Mus musculus adult male kidney cDN... 171 6e-41 AK161140_1(AK161140|pid:none) Mus musculus 10 days neonate skin ... 171 6e-41 AL672150_2(AL672150|pid:none) Mouse DNA sequence from clone RP23... 171 6e-41 CP000085_5(CP000085|pid:none) Burkholderia thailandensis E264 ch... 171 7e-41 AK028713_1(AK028713|pid:none) Mus musculus 10 days neonate skin ... 171 7e-41 AP009240_3263(AP009240|pid:none) Escherichia coli SE11 DNA, comp... 171 7e-41 CP000109_1976(CP000109|pid:none) Thiomicrospira crunogena XCL-2,... 171 7e-41 CP000304_3780(CP000304|pid:none) Pseudomonas stutzeri A1501, com... 171 7e-41 AJ617685_101(AJ617685|pid:none) Escherichia coli pathogenicity i... 171 7e-41 (P53556) RecName: Full=8-amino-7-oxononanoate synthase; ... 171 9e-41 AE014187_152(AE014187|pid:none) Plasmodium falciparum 3D7 chromo... 171 9e-41 (Q9XT75) RecName: Full=5-aminolevulinate synthase, erythroid-spe... 171 9e-41 CP001037_3160(CP001037|pid:none) Nostoc punctiforme PCC 73102, c... 170 1e-40 (O15269) RecName: Full=Serine palmitoyltransferase 1; E... 170 1e-40 CP000800_3273(CP000800|pid:none) Escherichia coli E24377A, compl... 170 1e-40 CP000058_4509(CP000058|pid:none) Pseudomonas syringae pv. phaseo... 170 1e-40 BT047538_1(BT047538|pid:none) Salmo salar clone ssal-evf-523-077... 170 1e-40 AE014075_3629(AE014075|pid:none) Escherichia coli CFT073, comple... 170 1e-40 CP000083_106(CP000083|pid:none) Colwellia psychrerythraea 34H, c... 170 1e-40 CP000712_385(CP000712|pid:none) Pseudomonas putida F1, complete ... 170 2e-40 X56352_1(X56352|pid:none) Human ALAS2 (ALASE) mRNA for delta-ami... 170 2e-40 AM420293_4391(AM420293|pid:none) Saccharopolyspora erythraea NRR... 170 2e-40 CP000142_1791(CP000142|pid:none) Pelobacter carbinolicus DSM 238... 170 2e-40 CP001069_1055(CP001069|pid:none) Ralstonia pickettii 12J chromos... 170 2e-40 BC081857_1(BC081857|pid:none) Rattus norvegicus aminolevulinate,... 169 2e-40 CP000453_2416(CP000453|pid:none) Alkalilimnicola ehrlichii MLHE-... 169 2e-40 (Q63147) RecName: Full=5-aminolevulinate synthase, erythroid-spe... 169 2e-40 CP000926_388(CP000926|pid:none) Pseudomonas putida GB-1, complet... 169 3e-40 CP001339_131(CP001339|pid:none) Thioalkalivibrio sp. HL-EbGR7, c... 169 3e-40 AE016825_1650(AE016825|pid:none) Chromobacterium violaceum ATCC ... 169 3e-40 CP001032_2911(CP001032|pid:none) Opitutus terrae PB90-1, complet... 169 4e-40 BA000022_2497(BA000022|pid:none) Synechocystis sp. PCC 6803 DNA,... 169 4e-40 AB169255_1(AB169255|pid:none) Macaca fascicularis testis cDNA, c... 169 4e-40 CU207366_3324(CU207366|pid:none) Gramella forsetii KT0803 comple... 169 4e-40 FM180568_3265(FM180568|pid:none) Escherichia coli 0127:H6 E2348/... 168 5e-40 CP000271_8(CP000271|pid:none) Burkholderia xenovorans LB400 chro... 168 6e-40 CP000155_5762(CP000155|pid:none) Hahella chejuensis KCTC 2396, c... 168 6e-40 CP001080_310(CP001080|pid:none) Sulfurihydrogenibium sp. YO3AOP1... 167 8e-40 (P13196) RecName: Full=5-aminolevulinate synthase, nonspecific, ... 167 8e-40 AF073341_1(AF073341|pid:none) Myxine glutinosa blood 5-aminolevu... 167 8e-40 AY805123_1(AY805123|pid:none) Zea mays clone 5Zm6R7 putative ser... 167 1e-39 CP000127_2006(CP000127|pid:none) Nitrosococcus oceani ATCC 19707... 167 1e-39 AK300993_1(AK300993|pid:none) Homo sapiens cDNA FLJ56039 complet... 167 1e-39 CP000806_4147(CP000806|pid:none) Cyanothece sp. ATCC 51142 circu... 167 1e-39 AM910996_626(AM910996|pid:none) Plasmodium knowlesi strain H chr... 167 1e-39 BT058917_1(BT058917|pid:none) Salmo salar clone ssal-rgf-513-073... 167 1e-39 (O54695) RecName: Full=Serine palmitoyltransferase 1; E... 167 1e-39 Z70311_3(Z70311|pid:none) Caenorhabditis elegans Cosmid T25B9, c... 167 1e-39 AP009380_938(AP009380|pid:none) Porphyromonas gingivalis ATCC 33... 167 1e-39 AE015924_417(AE015924|pid:none) Porphyromonas gingivalis W83, co... 166 2e-39 CP000851_107(CP000851|pid:none) Shewanella pealeana ATCC 700345,... 166 2e-39 CP000454_1304(CP000454|pid:none) Arthrobacter sp. FB24, complete... 166 2e-39 AB045873_5(AB045873|pid:none) Kurthia sp. 538-KA26 biotin biosyn... 166 2e-39 J04044_1(J04044|pid:none) Rat delta-aminolevulinate synthase mRN... 166 2e-39 CP000478_2213(CP000478|pid:none) Syntrophobacter fumaroxidans MP... 166 2e-39 CP000577_1027(CP000577|pid:none) Rhodobacter sphaeroides ATCC 17... 166 3e-39 AE017283_389(AE017283|pid:none) Propionibacterium acnes KPA17120... 166 3e-39 JX0278(JX0278)5-aminolevulinate synthase (EC 2.3.1.37) precursor... 166 3e-39 (A6QLI6) RecName: Full=5-aminolevulinate synthase, nonspecific, ... 165 4e-39 CP000473_5379(CP000473|pid:none) Solibacter usitatus Ellin6076, ... 165 4e-39 BC095705_1(BC095705|pid:none) Danio rerio zgc:112247, mRNA (cDNA... 165 4e-39 CU928162_3538(CU928162|pid:none) Escherichia coli ED1a chromosom... 165 4e-39 BC024575_1(BC024575|pid:none) Mus musculus aminolevulinic acid s... 165 4e-39 BC067644_1(BC067644|pid:none) Danio rerio glycine C-acetyltransf... 165 4e-39 AP009380_1489(AP009380|pid:none) Porphyromonas gingivalis ATCC 3... 165 4e-39 CP001157_4277(CP001157|pid:none) Azotobacter vinelandii DJ, comp... 165 4e-39 CP000139_945(CP000139|pid:none) Bacteroides vulgatus ATCC 8482, ... 165 5e-39 CP001097_2342(CP001097|pid:none) Chlorobium limicola DSM 245, co... 165 5e-39 (Q9I617) RecName: Full=8-amino-7-oxononanoate synthase; ... 165 5e-39 CP001108_1913(CP001108|pid:none) Prosthecochloris aestuarii DSM ... 165 5e-39 BC080348_1(BC080348|pid:none) Xenopus tropicalis hypothetical pr... 164 7e-39 AF073338_1(AF073338|pid:none) Glycera dibranchiata blood 5-amino... 164 7e-39 CP001344_283(CP001344|pid:none) Cyanothece sp. PCC 7425, complet... 164 9e-39 (Q8VC19) RecName: Full=5-aminolevulinate synthase, nonspecific, ... 164 9e-39 CP001132_411(CP001132|pid:none) Acidithiobacillus ferrooxidans A... 164 1e-38 CP000032_192(CP000032|pid:none) Ruegeria pomeroyi DSS-3 plasmid ... 164 1e-38 BC092591_1(BC092591|pid:none) Rattus norvegicus glycine C-acetyl... 164 1e-38 CP000758_411(CP000758|pid:none) Ochrobactrum anthropi ATCC 49188... 164 1e-38 (Q3ZC31) RecName: Full=5-aminolevulinate synthase, erythroid-spe... 164 1e-38 BC076921_1(BC076921|pid:none) Xenopus tropicalis aminolevulinate... 163 2e-38 AP006841_2987(AP006841|pid:none) Bacteroides fragilis YCH46 DNA,... 163 2e-38 CP000356_1196(CP000356|pid:none) Sphingopyxis alaskensis RB2256,... 163 2e-38 CT573326_4752(CT573326|pid:none) Pseudomonas entomophila str. L4... 163 2e-38 CP001001_3458(CP001001|pid:none) Methylobacterium radiotolerans ... 163 2e-38 CP000096_253(CP000096|pid:none) Pelodictyon luteolum DSM 273, co... 163 2e-38 CP000494_817(CP000494|pid:none) Bradyrhizobium sp. BTAi1, comple... 163 2e-38 BC056328_1(BC056328|pid:none) Danio rerio glycine C-acetyltransf... 163 2e-38 AM889285_2928(AM889285|pid:none) Gluconacetobacter diazotrophicu... 163 2e-38 CU928173_421(CU928173|pid:none) Zygosaccharomyces rouxii strain ... 162 3e-38 AY084198_1(AY084198|pid:none) Drosophila melanogaster SD01515 fu... 162 3e-38 (O88986) RecName: Full=2-amino-3-ketobutyrate coenzyme A ligase,... 162 3e-38 AY389894_1(AY389894|pid:none) Protopterus dolloi aminolevulinic ... 162 3e-38 X02827_1(X02827|pid:none) Chicken mRNA for mitochondrial 5-amino... 162 3e-38 CP000009_1993(CP000009|pid:none) Gluconobacter oxydans 621H, com... 162 4e-38 AB071862_1(AB071862|pid:none) Gibberella fujikuroi mRNA for 5-am... 162 4e-38 CP000157_2815(CP000157|pid:none) Erythrobacter litoralis HTCC259... 162 4e-38 CP001133_860(CP001133|pid:none) Vibrio fischeri MJ11 chromosome ... 161 6e-38 CP000103_1124(CP000103|pid:none) Nitrosospira multiformis ATCC 2... 161 6e-38 CP001612_978(CP001612|pid:none) Rickettsia africae ESF-5, comple... 161 6e-38 CP000644_73(CP000644|pid:none) Aeromonas salmonicida subsp. salm... 161 6e-38 BT059403_1(BT059403|pid:none) Salmo salar clone ssal-rgf-506-192... 161 7e-38 BC059988_1(BC059988|pid:none) Xenopus laevis hypothetical protei... 161 7e-38 CU914166_847(CU914166|pid:none) Ralstonia solanacearum strain IP... 161 7e-38 CU695240_421(CU695240|pid:none) Ralstonia solanacearum strain Mo... 161 7e-38 CP001227_620(CP001227|pid:none) Rickettsia peacockii str. Rustic... 160 1e-37 AE015928_1371(AE015928|pid:none) Bacteroides thetaiotaomicron VP... 160 1e-37 AE015924_1029(AE015924|pid:none) Porphyromonas gingivalis W83, c... 160 1e-37 AK013138_1(AK013138|pid:none) Mus musculus 10, 11 days embryo wh... 160 1e-37 CP000910_1279(CP000910|pid:none) Renibacterium salmoninarum ATCC... 160 1e-37 (Q9ZCB8) RecName: Full=5-aminolevulinate synthase; EC=2... 160 2e-37 AB088066_3(AB088066|pid:none) Bacillus subtilis biotin operon (b... 160 2e-37 CP001101_2119(CP001101|pid:none) Chlorobium phaeobacteroides BS1... 160 2e-37 BX950229_1574(BX950229|pid:none) Methanococcus maripaludis strai... 160 2e-37 M63245_1(M63245|pid:none) Mus musculus amino levulinate synthase... 160 2e-37 AE008917_1603(AE008917|pid:none) Brucella melitensis 16M chromos... 160 2e-37 CP000872_311(CP000872|pid:none) Brucella canis ATCC 23365 chromo... 159 3e-37 AM238664_1130(AM238664|pid:none) Streptomyces ambofaciens ATCC 2... 159 3e-37 (O59682) RecName: Full=Serine palmitoyltransferase 1; S... 159 3e-37 AE008692_1198(AE008692|pid:none) Zymomonas mobilis subsp. mobili... 159 3e-37 CP000644_2671(CP000644|pid:none) Aeromonas salmonicida subsp. sa... 159 3e-37 AY489557_1(AY489557|pid:none) Rhodopseudomonas palustris 5-amino... 159 4e-37 (O75600) RecName: Full=2-amino-3-ketobutyrate coenzyme A ligase,... 159 4e-37 CP000708_308(CP000708|pid:none) Brucella ovis ATCC 25840 chromos... 159 4e-37 AE017196_1154(AE017196|pid:none) Wolbachia endosymbiont of Droso... 158 5e-37 CP000462_1446(CP000462|pid:none) Aeromonas hydrophila subsp. hyd... 158 5e-37 CP000383_1288(CP000383|pid:none) Cytophaga hutchinsonii ATCC 334... 158 5e-37 CP000911_329(CP000911|pid:none) Brucella suis ATCC 23445 chromos... 158 5e-37 CP000283_3705(CP000283|pid:none) Rhodopseudomonas palustris BisB... 158 5e-37 AB170924_1(AB170924|pid:none) Macaca fascicularis brain cDNA clo... 158 5e-37 CP001032_3991(CP001032|pid:none) Opitutus terrae PB90-1, complet... 158 6e-37 CP000848_1275(CP000848|pid:none) Rickettsia rickettsii str. 'She... 158 6e-37 CP000091_1330(CP000091|pid:none) Ralstonia eutropha JMP134 chrom... 157 8e-37 BC022110_1(BC022110|pid:none) Mus musculus aminolevulinic acid s... 157 8e-37 AM494475_349(AM494475|pid:none) Orientia tsutsugamushi Boryong c... 157 8e-37 CP000356_2154(CP000356|pid:none) Sphingopyxis alaskensis RB2256,... 157 1e-36 CP000943_2494(CP000943|pid:none) Methylobacterium sp. 4-46, comp... 157 1e-36 AK290093_1(AK290093|pid:none) Homo sapiens cDNA FLJ77874 complet... 157 1e-36 AP008208_2873(AP008208|pid:none) Oryza sativa (japonica cultivar... 157 1e-36 BC074129_1(BC074129|pid:none) Xenopus laevis MGC81838 protein, m... 157 1e-36 CP001142_443(CP001142|pid:none) Phaeodactylum tricornutum CCAP 1... 157 1e-36 AE005673_1348(AE005673|pid:none) Caulobacter crescentus CB15, co... 156 2e-36 (P08262) RecName: Full=5-aminolevulinate synthase; EC=2... 156 2e-36 CP000301_1308(CP000301|pid:none) Rhodopseudomonas palustris BisB... 156 2e-36 CP000494_3784(CP000494|pid:none) Bradyrhizobium sp. BTAi1, compl... 156 2e-36 CP000377_860(CP000377|pid:none) Silicibacter sp. TM1040, complet... 156 2e-36 DQ002568_1(DQ002568|pid:none) Sphingomonas chungbukensis serine ... 156 2e-36 CP000474_1401(CP000474|pid:none) Arthrobacter aurescens TC1, com... 156 2e-36 AP009153_2840(AP009153|pid:none) Gemmatimonas aurantiaca T-27 DN... 156 2e-36 CP001096_1707(CP001096|pid:none) Rhodopseudomonas palustris TIE-... 155 3e-36 CP001349_4737(CP001349|pid:none) Methylobacterium nodulans ORS 2... 155 3e-36 BA000012_5179(BA000012|pid:none) Mesorhizobium loti MAFF303099 D... 155 3e-36 AY389893_1(AY389893|pid:none) Latimeria chalumnae aminolevulinic... 155 3e-36 AP008216_266(AP008216|pid:none) Oryza sativa (japonica cultivar-... 155 3e-36 CP001349_2040(CP001349|pid:none) Methylobacterium nodulans ORS 2... 155 3e-36 CU234118_1556(CU234118|pid:none) Bradyrhizobium sp. ORS278,compl... 155 3e-36 BA000012_4414(BA000012|pid:none) Mesorhizobium loti MAFF303099 D... 155 3e-36 CP000769_3522(CP000769|pid:none) Anaeromyxobacter sp. Fw109-5, c... 155 4e-36 CP000964_3706(CP000964|pid:none) Klebsiella pneumoniae 342, comp... 155 4e-36 CU914168_1354(CU914168|pid:none) Ralstonia solanacearum strain I... 155 4e-36 CU695238_378(CU695238|pid:none) Ralstonia solanacearum strain Mo... 155 4e-36 (Q9XS79) RecName: Full=5-aminolevulinate synthase, nonspecific, ... 155 4e-36 CU459003_2230(CU459003|pid:none) Magnetospirillum gryphiswaldens... 155 5e-36 CR522870_2547(CR522870|pid:none) Desulfotalea psychrophila LSv54... 155 5e-36 CP000830_1175(CP000830|pid:none) Dinoroseobacter shibae DFL 12, ... 155 5e-36 CP000362_186(CP000362|pid:none) Roseobacter denitrificans OCh 11... 155 5e-36 AM270389_1(AM270389|pid:none) Aspergillus niger contig An17c0070... 154 7e-36 CP000237_793(CP000237|pid:none) Neorickettsia sennetsu strain Mi... 154 7e-36 CP001101_2362(CP001101|pid:none) Chlorobium phaeobacteroides BS1... 154 7e-36 CP000388_2539(CP000388|pid:none) Pseudoalteromonas atlantica T6c... 154 1e-35 CP000857_770(CP000857|pid:none) Salmonella enterica subsp. enter... 153 2e-35 AB015491_1(AB015491|pid:none) Rhodopseudomonas palustris hemA ge... 153 2e-35 (Q55FL5) RecName: Full=Serine palmitoyltransferase 1; E... 153 2e-35 CP000653_1258(CP000653|pid:none) Enterobacter sp. 638, complete ... 153 2e-35 CP000774_39(CP000774|pid:none) Parvibaculum lavamentivorans DS-1... 153 2e-35 AE016825_4380(AE016825|pid:none) Chromobacterium violaceum ATCC ... 153 2e-35 CP000449_1536(CP000449|pid:none) Maricaulis maris MCS10, complet... 153 2e-35 CP000362_2623(CP000362|pid:none) Roseobacter denitrificans OCh 1... 153 2e-35 AE017220_793(AE017220|pid:none) Salmonella enterica subsp. enter... 153 2e-35 (Q58694) RecName: Full=8-amino-7-oxononanoate synthase; ... 153 2e-35 AF073336_1(AF073336|pid:none) Limulus polyphemus hepatopancreas ... 153 2e-35 CP001138_772(CP001138|pid:none) Salmonella enterica subsp. enter... 152 3e-35 CU928169_440(CU928169|pid:none) Kluyveromyces thermotolerans str... 152 3e-35 CP000089_2868(CP000089|pid:none) Dechloromonas aromatica RCB, co... 152 3e-35 M63244_1(M63244|pid:none) Mus musculus amino levulinate synthase... 152 3e-35 AE017321_132(AE017321|pid:none) Wolbachia endosymbiont strain TR... 152 3e-35 CP000251_3441(CP000251|pid:none) Anaeromyxobacter dehalogenans 2... 152 3e-35 S31846(S31846;S22189) 5-aminolevulinate synthase (EC 2.3.1.37) p... 152 5e-35 CP000886_2658(CP000886|pid:none) Salmonella enterica subsp. ente... 151 6e-35 CP001359_3571(CP001359|pid:none) Anaeromyxobacter dehalogenans 2... 151 6e-35 AP006725_1565(AP006725|pid:none) Klebsiella pneumoniae NTUH-K204... 151 6e-35 CP000248_3097(CP000248|pid:none) Novosphingobium aromaticivorans... 151 6e-35 AE014613_1964(AE014613|pid:none) Salmonella enterica subsp. ente... 151 6e-35 (P43091) RecName: Full=5-aminolevulinate synthase, nonspecific, ... 151 8e-35 CP001620_1436(CP001620|pid:none) Corynebacterium kroppenstedtii ... 151 8e-35 CP000463_1350(CP000463|pid:none) Rhodopseudomonas palustris BisA... 151 8e-35 DQ029336_1(DQ029336|pid:none) Toxoplasma gondii delta-aminolevul... 150 1e-34 CP000647_776(CP000647|pid:none) Klebsiella pneumoniae subsp. pne... 150 1e-34 CP000394_239(CP000394|pid:none) Granulibacter bethesdensis CGDNI... 150 1e-34 (Q6FXE3) RecName: Full=5-aminolevulinate synthase, mitochondrial... 150 1e-34 (Q7RVY5) RecName: Full=5-aminolevulinate synthase, mitochondrial... 150 1e-34 AL646052_1479(AL646052|pid:none) Ralstonia solanacearum GMI1000 ... 150 1e-34 CP000661_1842(CP000661|pid:none) Rhodobacter sphaeroides ATCC 17... 150 1e-34 CP001071_1370(CP001071|pid:none) Akkermansia muciniphila ATCC BA... 150 1e-34 FN392320_765(FN392320|pid:none) Pichia pastoris GS115 chromosome... 150 1e-34 AK043064_1(AK043064|pid:none) Mus musculus 7 days neonate cerebe... 150 1e-34 CP000325_3320(CP000325|pid:none) Mycobacterium ulcerans Agy99, c... 150 1e-34 CP001131_3504(CP001131|pid:none) Anaeromyxobacter sp. K, complet... 150 2e-34 FM954972_1933(FM954972|pid:none) Vibrio splendidus LGP32 chromos... 150 2e-34 CP000613_970(CP000613|pid:none) Rhodospirillum centenum SW, comp... 150 2e-34 BX572595_223(BX572595|pid:none) Rhodopseudomonas palustris CGA00... 149 2e-34 CP000108_79(CP000108|pid:none) Chlorobium chlorochromatii CaD3, ... 149 2e-34 CP000031_2536(CP000031|pid:none) Ruegeria pomeroyi DSS-3, comple... 149 3e-34 AM398681_1751(AM398681|pid:none) Flavobacterium psychrophilum JI... 149 3e-34 CP001144_805(CP001144|pid:none) Salmonella enterica subsp. enter... 149 4e-34 AE008692_1270(AE008692|pid:none) Zymomonas mobilis subsp. mobili... 149 4e-34 CU207366_1772(CU207366|pid:none) Gramella forsetii KT0803 comple... 149 4e-34 CP000250_4534(CP000250|pid:none) Rhodopseudomonas palustris HaA2... 149 4e-34
>(Q54EX5) RecName: Full=Serine palmitoyltransferase 2; EC=2.3.1.50; AltName: Full=Serine-palmitoyl-CoA transferase 2; Short=SPT 2; Short=SPT2; AltName: Full=Long chain base biosynthesis protein 2; Short=LCB 2; Length = 490
Score = 962 bits (2487), Expect = 0.0 Identities = 477/477 (100%), Positives = 477/477 (100%) Frame = +2
Query: 83 GYLPILFLYIAYAFIIFNGKLAEFIGKLKGERYLHTPEGYAPLFVEFEYFYQRRMYGRIK 262 GYLPILFLYIAYAFIIFNGKLAEFIGKLKGERYLHTPEGYAPLFVEFEYFYQRRMYGRIK Sbjct: 14 GYLPILFLYIAYAFIIFNGKLAEFIGKLKGERYLHTPEGYAPLFVEFEYFYQRRMYGRIK 73
Query: 263 DAWDRPINSIAGAWIDVMPRASKHYSQRLELTGGKTIKCLNLGSYNYLGFAQNEGPVADK 442 DAWDRPINSIAGAWIDVMPRASKHYSQRLELTGGKTIKCLNLGSYNYLGFAQNEGPVADK Sbjct: 74 DAWDRPINSIAGAWIDVMPRASKHYSQRLELTGGKTIKCLNLGSYNYLGFAQNEGPVADK 133
Query: 443 VIDSIYKYGVYTGSTSAEVGLSEPQRDLENLTARFVGKEDAIVFEMGFATNSGTLPALIG 622 VIDSIYKYGVYTGSTSAEVGLSEPQRDLENLTARFVGKEDAIVFEMGFATNSGTLPALIG Sbjct: 134 VIDSIYKYGVYTGSTSAEVGLSEPQRDLENLTARFVGKEDAIVFEMGFATNSGTLPALIG 193
Query: 623 KGGLIISDSLNHASLATGCKNTGCKVKVFRHNDSKHLEEVIRESIIQGQPRTHRPWTMIL 802 KGGLIISDSLNHASLATGCKNTGCKVKVFRHNDSKHLEEVIRESIIQGQPRTHRPWTMIL Sbjct: 194 KGGLIISDSLNHASLATGCKNTGCKVKVFRHNDSKHLEEVIRESIIQGQPRTHRPWTMIL 253
Query: 803 IIIEGIYSMEGEVANLPEILAIKKKYKCYLYIDEAHSIGALGKTGRGIVDYYGIDPKEID 982 IIIEGIYSMEGEVANLPEILAIKKKYKCYLYIDEAHSIGALGKTGRGIVDYYGIDPKEID Sbjct: 254 IIIEGIYSMEGEVANLPEILAIKKKYKCYLYIDEAHSIGALGKTGRGIVDYYGIDPKEID 313
Query: 983 ILMGTYTKSFGAIGGYVASDKSLIDHLRQSSFSQVYANSMSPVCAVQALEALRVIMGEDG 1162 ILMGTYTKSFGAIGGYVASDKSLIDHLRQSSFSQVYANSMSPVCAVQALEALRVIMGEDG Sbjct: 314 ILMGTYTKSFGAIGGYVASDKSLIDHLRQSSFSQVYANSMSPVCAVQALEALRVIMGEDG 373
Query: 1163 TDTGAKKLKQLHDNSNYFREKIREMGFVILGNKDSPVIPLMLFNPAKLSAFSRLCLEKHI 1342 TDTGAKKLKQLHDNSNYFREKIREMGFVILGNKDSPVIPLMLFNPAKLSAFSRLCLEKHI Sbjct: 374 TDTGAKKLKQLHDNSNYFREKIREMGFVILGNKDSPVIPLMLFNPAKLSAFSRLCLEKHI 433
Query: 1343 AVVVVGYPATPLTEPRTRFCISASHTIEDLDWALRQIDEIGDLITLKFHKGKYLKSK 1513 AVVVVGYPATPLTEPRTRFCISASHTIEDLDWALRQIDEIGDLITLKFHKGKYLKSK Sbjct: 434 AVVVVGYPATPLTEPRTRFCISASHTIEDLDWALRQIDEIGDLITLKFHKGKYLKSK 490
Score = 38.9 bits (89), Expect = 0.56 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -2
Query: 1575 QSDEIGDLITLKFHKGKY 1522 Q DEIGDLITLKFHKGKY Sbjct: 469 QIDEIGDLITLKFHKGKY 486
Lambda K H 0.318 0.134 0.401
Gapped Lambda K H 0.267 0.0410 0.140
Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 3236559 Number of Hits to DB: 2,785,244,740 Number of extensions: 58186604 Number of successful extensions: 155656 Number of sequences better than 10.0: 931 Number of HSP's gapped: 153508 Number of HSP's successfully gapped: 938 Length of query: 550 Length of database: 1,051,180,864 Length adjustment: 134 Effective length of query: 416 Effective length of database: 617,481,958 Effective search space: 256872494528 Effective search space used: 256872494528 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 32 (16.9 bits)
|