| Contig-U14945-1 |
| Contig ID |
Contig-U14945-1 |
| Contig update |
2004. 6.11 |
| Contig sequence |
 |
| Gap |
no gap |
| Contig length |
1753 |
| Chromosome number (1..6, M) |
2 |
| Chromosome length |
8467578 |
| Start point |
7465875 |
| End point |
7464123 |
| Strand (PLUS/MINUS) |
MINUS |
| Number of clones |
56 |
| Number of EST |
62 |
| Link to clone list |
U14945 |
| List of clone(s) |
est1=SLI892F,1,273
est2=SFI552F,4,610
est3=VFC505F,10,524
est4=CFJ561F,17,568
est5=VFM711F,70,718
est6=AFB509F,110,720
est7=AFJ127F,119,739
est8=CHA790F,171,738
est9=VFA189Z,367,963
est10=VFB761Z,393,969
est11=CHC204Z,396,981
est12=VFH313F,424,999
est13=VFL708Z,441,975
est14=CFE376Z,478,967
est15=VFG267F,578,1153
est16=VFA104Z,621,1161
est17=VFE503F,699,1104
est18=SFB381F,706,910
est19=AFG811Z,924,1536
est20=AFF294Z,926,1524
est21=CFG295Z,945,1560
est22=SFF145Z,956,1583
est23=SFI238Z,957,1531
est24=VFJ414Z,965,1552
est25=SFI262Z,971,1559
est26=VFM711Z,972,1698
est27=SFI552Z,973,1703
est28=CHB202Z,975,1573
est29=SSA555E,989,1705
est30=VFJ340Z,989,1548
est31=SFI338Z,990,1572
est32=AFD786Z,997,1547
est33=CFA806Z,998,1450
est34=CHG304Z,1009,1576
est35=CFG786Z,1010,1548
est36=SFJ543Z,1010,1559
est37=VSJ531E,1012,1704
est38=SFG162Z,1013,1576
est39=VFB841Z,1016,1542
est40=CFJ561Z,1026,1705
est41=AFD242Z,1032,1536
est42=AFF555Z,1037,1565
est43=CHG586Z,1053,1556
est44=VSG481F,1061,1463
est45=CFA220Z,1063,1548
est46=AFH405Z,1067,1527
est47=CHD644Z,1068,1565
est48=CFA285Z,1070,1584
est49=VFC505Z,1070,1705
est50=CHA390Z,1071,1706
est51=VFL803Z,1073,1556
est52=AFD353Z,1075,1535
est53=AFJ573Z,1091,1572
est54=SFB801Z,1093,1521
est55=AFF824Z,1111,1561
est56=AFH150Z,1158,1547
est57=VFH313Z,1160,1671
est58=CFF317Z,1170,1270
est59=CFJ758Z,1193,1672
est60=SLI892Z,1267,1707
est61=SFI314Z,1319,1552
est62=VSD231F,1342,1753
|
| Translated Amino Acid sequence |
|
| Translated Amino Acid sequence (All Frames) |
|
| own update |
2004. 6.23 |
| Homology vs CSM-cDNA |
|
| dna update |
2009. 1. 6 |
| Homology vs DNA |
Query= Contig-U14945-1 (Contig-U14945-1Q) /CSM_Contig/Contig-U14945-1Q.Seq.d
(1753 letters)
Database: ddbj_A
92,845,959 sequences; 95,242,211,685 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value N
(AC117075) Dictyostelium discoideum chromosome 2 map 5201047... 3291 0.0 1
(BJ435097) Dictyostelium discoideum cDNA clone:ddv26f03, 3' ... 1405 0.0 1
(BJ402884) Dictyostelium discoideum cDNA clone:dds18g13, 3' ... 1402 0.0 1
(BJ375943) Dictyostelium discoideum cDNA clone:ddc20i15, 3' ... 1289 0.0 1
(BJ416639) Dictyostelium discoideum cDNA clone:ddv26f03, 5' ... 1287 0.0 1
(BJ327133) Dictyostelium discoideum cDNA clone:dda19e07, 5' ... 1229 0.0 1
(BJ398182) Dictyostelium discoideum cDNA clone:dds11i11, 3' ... 1223 0.0 1
(BJ372741) Dictyostelium discoideum cDNA clone:ddc13m24, 3' ... 1217 0.0 1
(BJ342455) Dictyostelium discoideum cDNA clone:dda14f04, 3' ... 1213 0.0 1
(BJ430104) Dictyostelium discoideum cDNA clone:ddv6i01, 3' e... 1211 0.0 1
(BJ340158) Dictyostelium discoideum cDNA clone:dda11k24, 3' ... 1187 0.0 1
(BJ377550) Dictyostelium discoideum cDNA clone:ddc24c02, 3' ... 1185 0.0 1
(BJ428925) Dictyostelium discoideum cDNA clone:ddv1a23, 3' e... 1181 0.0 1
(BJ389387) Dictyostelium discoideum cDNA clone:dds18g13, 5' ... 1172 0.0 1
(BJ432596) Dictyostelium discoideum cDNA clone:ddv19l04, 3' ... 1164 0.0 1
(BJ402666) Dictyostelium discoideum cDNA clone:dds17k16, 3' ... 1154 0.0 1
(BJ377155) Dictyostelium discoideum cDNA clone:ddc22d23, 3' ... 1148 0.0 1
(BJ429708) Dictyostelium discoideum cDNA clone:ddv4j15, 3' e... 1142 0.0 1
(BJ413334) Dictyostelium discoideum cDNA clone:ddv15j03, 5' ... 1140 0.0 1
(BJ412951) Dictyostelium discoideum cDNA clone:ddv13e18, 5' ... 1140 0.0 1
(BJ402581) Dictyostelium discoideum cDNA clone:dds17l09, 3' ... 1140 0.0 1
(BJ402577) Dictyostelium discoideum cDNA clone:dds17k10, 3' ... 1140 0.0 1
(BJ377822) Dictyostelium discoideum cDNA clone:ddc26g02, 3' ... 1128 0.0 1
(BJ362853) Dictyostelium discoideum cDNA clone:ddc23d23, 5' ... 1118 0.0 1
(BJ432696) Dictyostelium discoideum cDNA clone:ddv19p09, 3' ... 1110 0.0 1
(BJ379199) Dictyostelium discoideum cDNA clone:ddc34h01, 3' ... 1104 0.0 1
(BJ341953) Dictyostelium discoideum cDNA clone:dda8l21, 3' e... 1092 0.0 1
(BJ400528) Dictyostelium discoideum cDNA clone:dds13k15, 3' ... 1088 0.0 1
(BJ362173) Dictyostelium discoideum cDNA clone:ddc20i15, 5' ... 1088 0.0 1
(BJ402053) Dictyostelium discoideum cDNA clone:dds20e11, 3' ... 1080 0.0 1
(BJ347705) Dictyostelium discoideum cDNA clone:dda27l22, 3' ... 1068 0.0 1
(BJ372907) Dictyostelium discoideum cDNA clone:ddc14l21, 3' ... 1066 0.0 1
(BJ434553) Dictyostelium discoideum cDNA clone:ddv24p01, 3' ... 1051 0.0 1
(BJ429623) Dictyostelium discoideum cDNA clone:ddv4b12, 3' e... 1045 0.0 1
(BJ340339) Dictyostelium discoideum cDNA clone:dda12m13, 3' ... 1031 0.0 1
(BJ323937) Dictyostelium discoideum cDNA clone:dda4a03, 5' e... 916 0.0 3
(BJ373187) Dictyostelium discoideum cDNA clone:ddc1i22, 3' e... 1009 0.0 1
(AU270064) Dictyostelium discoideum vegetative cDNA clone:VS... 1005 0.0 1
(BJ428741) Dictyostelium discoideum cDNA clone:ddv1g01, 3' e... 747 0.0 2
(BJ411860) Dictyostelium discoideum cDNA clone:ddv6i01, 5' e... 1001 0.0 1
(BJ341579) Dictyostelium discoideum cDNA clone:dda7c12, 3' e... 999 0.0 1
(BJ379755) Dictyostelium discoideum cDNA clone:ddc35k21, 3' ... 993 0.0 1
(BJ376635) Dictyostelium discoideum cDNA clone:ddc29g12, 3' ... 985 0.0 1
(BJ434499) Dictyostelium discoideum cDNA clone:ddv24f02, 3' ... 955 0.0 1
(BJ371688) Dictyostelium discoideum cDNA clone:ddc1g06, 3' e... 954 0.0 1
(BJ431691) Dictyostelium discoideum cDNA clone:ddv15j03, 3' ... 950 0.0 1
(BJ344856) Dictyostelium discoideum cDNA clone:dda20a19, 3' ... 942 0.0 1
(BJ374682) Dictyostelium discoideum cDNA clone:ddc9h19, 3' e... 934 0.0 1
(BJ342847) Dictyostelium discoideum cDNA clone:dda15j02, 3' ... 914 0.0 1
(BJ341658) Dictyostelium discoideum cDNA clone:dda7j13, 3' e... 914 0.0 1
(C83906) Dictyostelium discoideum slug cDNA, clone SSA555. 910 0.0 1
(BJ340231) Dictyostelium discoideum cDNA clone:dda12p06, 3' ... 894 0.0 1
(AU270063) Dictyostelium discoideum vegetative cDNA clone:VS... 868 0.0 1
(BJ399077) Dictyostelium discoideum cDNA clone:dds4b02, 3' e... 842 0.0 1
(BJ373392) Dictyostelium discoideum cDNA clone:ddc2l02, 3' e... 728 0.0 3
(AU053552) Dictyostelium discoideum slug cDNA, clone SLI892. 819 0.0 1
(BJ409793) Dictyostelium discoideum cDNA clone:ddv10e01, 5' ... 803 0.0 1
(AU266554) Dictyostelium discoideum vegetative cDNA clone:VS... 799 0.0 1
(BJ375917) Dictyostelium discoideum cDNA clone:ddc20d15, 3' ... 392 0.0 4
(BJ342940) Dictyostelium discoideum cDNA clone:dda15c13, 3' ... 773 0.0 1
(AU263691) Dictyostelium discoideum vegetative cDNA clone:VS... 672 0.0 1
(AU062282) Dictyostelium discoideum slug cDNA, clone SLI892. 504 e-138 1
(BJ387618) Dictyostelium discoideum cDNA clone:dds3b21, 5' e... 387 e-102 1
(BJ402504) Dictyostelium discoideum cDNA clone:dds17l03, 3' ... 353 1e-92 1
(BJ372034) Dictyostelium discoideum cDNA clone:ddc11b05, 3' ... 157 2e-33 1
(EF410988) Synthetic construct Bacillus anthracis clone FLH2... 62 2e-27 6
(Y09252) B.cereus pur9 gene, partial. 62 3e-16 3
(ER339440) 1092344333143 Global-Ocean-Sampling_GS-34-01-01-1... 58 7e-16 4
(EJ365650) 1092963705218 Global-Ocean-Sampling_GS-28-01-01-1... 52 5e-13 4
(AE006056) Pasteurella multocida subsp. multocida str. Pm70 ... 44 8e-12 6
(EK186594) 1095458155303 Global-Ocean-Sampling_GS-31-01-01-1... 62 3e-11 4
(ER374718) 1093030526913 Global-Ocean-Sampling_GS-34-01-01-1... 50 1e-10 3
(EJ394872) 1093011992588 Global-Ocean-Sampling_GS-28-01-01-1... 42 4e-10 5
(EJ187257) 1092344160574 Global-Ocean-Sampling_GS-27-01-01-1... 48 5e-10 3
(EJ018822) 1095439024754 Global-Ocean-Sampling_GS-26-01-01-1... 44 9e-10 4
(EJ117757) 1092343359732 Global-Ocean-Sampling_GS-27-01-01-1... 62 1e-09 3
(EJ074188) 1095458107157 Global-Ocean-Sampling_GS-26-01-01-1... 42 1e-09 4
(EJ205900) 1092344345996 Global-Ocean-Sampling_GS-27-01-01-1... 48 2e-09 3
(EK233886) 1095460191758 Global-Ocean-Sampling_GS-31-01-01-1... 58 4e-09 2
(EJ153064) 1092343782317 Global-Ocean-Sampling_GS-27-01-01-1... 70 4e-09 2
(EK562482) 1095521016184 Global-Ocean-Sampling_GS-32-01-01-1... 56 5e-09 2
(EJ534098) 1092955249104 Global-Ocean-Sampling_GS-29-01-01-1... 52 5e-09 4
(AE016879) Bacillus anthracis str. Ames, complete genome. 62 2e-08 2
(AE017334) Bacillus anthracis str. 'Ames Ancestor', complete... 62 2e-08 2
(AE017225) Bacillus anthracis str. Sterne, complete genome. 62 2e-08 2
(AE017355) Bacillus thuringiensis serovar konkukian str. 97-... 62 2e-08 2
(CP000485) Bacillus thuringiensis str. Al Hakam, complete ge... 62 2e-08 2
(AE017262) Listeria monocytogenes str. 4b F2365, complete ge... 58 2e-08 2
(AX416673) Sequence 3664 from Patent WO0228891. 58 2e-08 2
(AX414804) Sequence 1795 from Patent WO0228891. 58 2e-08 2
(EL737531) Osmo01666 F. cylindrus osmotic stress library Fra... 44 5e-08 3
(EL737502) Osmo01637 F. cylindrus osmotic stress library Fra... 44 5e-08 3
(EJ920000) 1093018597831 Global-Ocean-Sampling_GS-30-02-01-1... 42 6e-08 4
(DI145175) GENOME SEQUENCE OF ZYMONAS MOBILIS ZM4 AND NOVEL ... 46 7e-08 3
(EJ298945) 1095388065496 Global-Ocean-Sampling_GS-27-01-01-1... 50 8e-08 3
(EK516712) 1095515502031 Global-Ocean-Sampling_GS-32-01-01-1... 46 1e-07 3
(AE013028) Thermoanaerobacter tengcongensis MB4, section 55 ... 48 2e-07 4
(AX142553) Sequence 1275 from Patent WO0134809. 42 2e-07 4
(AR484219) Sequence 1275 from patent US 6703492. 42 2e-07 4
(EJ657949) 1092955013188 Global-Ocean-Sampling_GS-30-02-01-1... 62 2e-07 2
>(AC117075) Dictyostelium discoideum chromosome 2 map 5201047-5455781
strain AX4, complete sequence.
Length = 254733
Score = 3291 bits (1660), Expect = 0.0
Identities = 1660/1660 (100%)
Strand = Plus / Minus
Query: 20 gaatgcaagcattattaagtgtttataataaaagtggtattgttgaattttcaaagattc 79
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 187565 gaatgcaagcattattaagtgtttataataaaagtggtattgttgaattttcaaagattc 187506
Query: 80 tttcaagtaaaggatttaatttaatttcaacaggtggtacagcaaaatcattggttgata 139
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 187505 tttcaagtaaaggatttaatttaatttcaacaggtggtacagcaaaatcattggttgata 187446
Query: 140 atggattaaaagttcaacaagtttcagatgttacagagtatccagagatgttagatggta 199
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 187445 atggattaaaagttcaacaagtttcagatgttacagagtatccagagatgttagatggta 187386
Query: 200 gagtgaaaactttacatccaaagattcatggtggtttattagcacgtccagagttggcac 259
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 187385 gagtgaaaactttacatccaaagattcatggtggtttattagcacgtccagagttggcac 187326
Query: 260 atcatcaagccgatttaaataaatataacattaaaccaatttcaatcgtagttgtaaatt 319
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 187325 atcatcaagccgatttaaataaatataacattaaaccaatttcaatcgtagttgtaaatt 187266
Query: 320 tatatccattcgtagagacagtatcaaaagaatcaacaacattagaggaagcaattgaaa 379
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 187265 tatatccattcgtagagacagtatcaaaagaatcaacaacattagaggaagcaattgaaa 187206
Query: 380 atattgatattggcggacacacattaattagagcatcatcaaagaattttcaaaatgttt 439
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 187205 atattgatattggcggacacacattaattagagcatcatcaaagaattttcaaaatgttt 187146
Query: 440 taatcattgtcgatccatcagattataaatggattggtgagcgtatacaatcatcaactg 499
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 187145 taatcattgtcgatccatcagattataaatggattggtgagcgtatacaatcatcaactg 187086
Query: 500 attccaccaatgttttaagctcaatcacattggaagagagaaagaaattggcattaaaag 559
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 187085 attccaccaatgttttaagctcaatcacattggaagagagaaagaaattggcattaaaag 187026
Query: 560 cattccaacatggatgttcatatgatgcagccgtttcacaatatctttcaaaggttgaat 619
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 187025 cattccaacatggatgttcatatgatgcagccgtttcacaatatctttcaaaggttgaat 186966
Query: 620 taacaaatgcaactaccattcaaggtgttaaaggcacagattcagcatctgtcaatgtag 679
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 186965 taacaaatgcaactaccattcaaggtgttaaaggcacagattcagcatctgtcaatgtag 186906
Query: 680 aattcccacaaacatttttaccattatatgaaaagaagaatgatttacgttatggtgaga 739
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 186905 aattcccacaaacatttttaccattatatgaaaagaagaatgatttacgttatggtgaga 186846
Query: 740 atccacatcaaaaagcagcactttatcaatgtccaggtacaggtggtattgcaaatgcac 799
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 186845 atccacatcaaaaagcagcactttatcaatgtccaggtacaggtggtattgcaaatgcac 186786
Query: 800 aattattacatggtccagctttatcttataataatattttagatggtgatgctgcattga 859
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 186785 aattattacatggtccagctttatcttataataatattttagatggtgatgctgcattga 186726
Query: 860 aagcagtcagagagtttgatagatgtgcatgtgttgtcattaaacataccaatccatgcg 919
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 186725 aagcagtcagagagtttgatagatgtgcatgtgttgtcattaaacataccaatccatgcg 186666
Query: 920 gtctttcagtgggtgttaatgatagtgaacaagctgaggtctataaacgtgccttcaatg 979
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 186665 gtctttcagtgggtgttaatgatagtgaacaagctgaggtctataaacgtgccttcaatg 186606
Query: 980 gtgacccaaaatctgcctatggtggtatcttgggtttcaatagaactttaacattagaga 1039
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 186605 gtgacccaaaatctgcctatggtggtatcttgggtttcaatagaactttaacattagaga 186546
Query: 1040 ctgcaactgcattgaaaagtgttttctatgaagttatcatcgcaccagattacaccgaag 1099
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 186545 ctgcaactgcattgaaaagtgttttctatgaagttatcatcgcaccagattacaccgaag 186486
Query: 1100 atgcattagcattgttaagtaaaaaagagaaattacgtattcttcgtataccagaggccg 1159
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 186485 atgcattagcattgttaagtaaaaaagagaaattacgtattcttcgtataccagaggccg 186426
Query: 1160 ccaatcaaattcaattcactcaacctgatattcgtaccatcactggtggtgctttacttc 1219
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 186425 ccaatcaaattcaattcactcaacctgatattcgtaccatcactggtggtgctttacttc 186366
Query: 1220 aatctccaaatccaatcatcagaggtgaccttgctgaagctacaaagaattggaaggtcg 1279
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 186365 aatctccaaatccaatcatcagaggtgaccttgctgaagctacaaagaattggaaggtcg 186306
Query: 1280 tcactgaaaataaaccaactgaacaacaaatgaaagatctcttattcgcttggagagttt 1339
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 186305 tcactgaaaataaaccaactgaacaacaaatgaaagatctcttattcgcttggagagttt 186246
Query: 1340 caaaacatgttaaatcaaatgctatcgttttatcaaaggatgaaactatcgttgccattg 1399
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 186245 caaaacatgttaaatcaaatgctatcgttttatcaaaggatgaaactatcgttgccattg 186186
Query: 1400 gtgctggtcaaccaaatcgttcacaatctgttgacatttgtatgaaagttggtggtgata 1459
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 186185 gtgctggtcaaccaaatcgttcacaatctgttgacatttgtatgaaagttggtggtgata 186126
Query: 1460 aagttaaaggaagtgttttggcttctgatgctttcttcccattcgccgattcaatcgatt 1519
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 186125 aagttaaaggaagtgttttggcttctgatgctttcttcccattcgccgattcaatcgatt 186066
Query: 1520 tagctcatcaaggtaatatcgcttgtatcgttcaaccaggtggtagtattcgtgatcaag 1579
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 186065 tagctcatcaaggtaatatcgcttgtatcgttcaaccaggtggtagtattcgtgatcaag 186006
Query: 1580 aagtaattgatgctgcaaataaatatggtattccaatggtttttactggcaatagaaatt 1639
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 186005 aagtaattgatgctgcaaataaatatggtattccaatggtttttactggcaatagaaatt 185946
Query: 1640 tcttacactaaaactaatttaaattttttcatatattcat 1679
||||||||||||||||||||||||||||||||||||||||
Sbjct: 185945 tcttacactaaaactaatttaaattttttcatatattcat 185906
Lambda K H
1.37 0.711 1.31
Matrix: blastn matrix:1 -3
Number of Sequences: 92845959
Number of Hits to DB: 1,981,304,953
Number of extensions: 118980179
Number of successful extensions: 9906859
Number of sequences better than 10.0: 544
Length of query: 1753
Length of database: 95,242,211,685
Length adjustment: 24
Effective length of query: 1729
Effective length of database: 97,308,875,965
Effective search space: 168247046543485
Effective search space used: 168247046543485
X1: 11 (21.8 bits)
S2: 22 (44.1 bits)
|
| protein update |
2009. 7.13 |
| Homology vs Protein |
Query= Contig-U14945-1 (Contig-U14945-1Q) /CSM_Contig/Contig-U14945-1Q.Seq.d
(1753 letters)
Database: nrp_B
3,236,559 sequences; 1,051,180,864 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AJ965256_1146(AJ965256|pid:none) Dehalococcoides sp. CBDB1 compl... 509 e-142
CP000027_1370(CP000027|pid:none) Dehalococcoides ethenogenes 195... 507 e-142
CP000924_1673(CP000924|pid:none) Thermoanaerobacter pseudethanol... 474 e-132
(Q8RC55) RecName: Full=Bifunctional purine biosynthesis protein ... 472 e-131
(A4XKZ2) RecName: Full=Bifunctional purine biosynthesis protein ... 470 e-131
CP000557_244(CP000557|pid:none) Geobacillus thermodenitrificans ... 467 e-130
CP000817_203(CP000817|pid:none) Lysinibacillus sphaericus C3-41,... 467 e-130
BA000043_267(BA000043|pid:none) Geobacillus kaustophilus HTA426 ... 466 e-130
(B7GFU2) RecName: Full=Bifunctional purine biosynthesis protein ... 466 e-129
(Q9KF53) RecName: Full=Bifunctional purine biosynthesis protein ... 465 e-129
CP000813_598(CP000813|pid:none) Bacillus pumilus SAFR-032, compl... 463 e-129
(Q71YQ3) RecName: Full=Bifunctional purine biosynthesis protein ... 463 e-128
AP008955_606(AP008955|pid:none) Brevibacillus brevis NBRC 100599... 462 e-128
CP001393_1377(CP001393|pid:none) Anaerocellum thermophilum DSM 6... 461 e-128
CP000103_133(CP000103|pid:none) Nitrosospira multiformis ATCC 25... 461 e-128
AL009126_683(AL009126|pid:none) Bacillus subtilis subsp. subtili... 460 e-128
(A7MXG0) RecName: Full=Bifunctional purine biosynthesis protein ... 459 e-127
CP001638_250(CP001638|pid:none) Geobacillus sp. WCH70, complete ... 459 e-127
(Q8Y6C5) RecName: Full=Bifunctional purine biosynthesis protein ... 459 e-127
(B7H4U0) RecName: Full=Bifunctional purine biosynthesis protein ... 459 e-127
(B7HS36) RecName: Full=Bifunctional purine biosynthesis protein ... 459 e-127
(Q5E257) RecName: Full=Bifunctional purine biosynthesis protein ... 459 e-127
(P12048) RecName: Full=Bifunctional purine biosynthesis protein ... 459 e-127
(B7JM89) RecName: Full=Bifunctional purine biosynthesis protein ... 458 e-127
(Q7MGT5) RecName: Full=Bifunctional purine biosynthesis protein ... 457 e-127
(Q81IP9) RecName: Full=Bifunctional purine biosynthesis protein ... 457 e-127
CP000227_293(CP000227|pid:none) Bacillus cereus Q1, complete gen... 456 e-127
CP001407_280(CP001407|pid:none) Bacillus cereus 03BB102, complet... 456 e-127
(B7IUV7) RecName: Full=Bifunctional purine biosynthesis protein ... 456 e-127
(A0R900) RecName: Full=Bifunctional purine biosynthesis protein ... 456 e-126
(A8AKS0) RecName: Full=Bifunctional purine biosynthesis protein ... 456 e-126
(Q9KV80) RecName: Full=Bifunctional purine biosynthesis protein ... 456 e-126
(A5F3U8) RecName: Full=Bifunctional purine biosynthesis protein ... 456 e-126
(Q5PKA9) RecName: Full=Bifunctional purine biosynthesis protein ... 455 e-126
(Q6HPA0) RecName: Full=Bifunctional purine biosynthesis protein ... 455 e-126
CP001144_4137(CP001144|pid:none) Salmonella enterica subsp. ente... 455 e-126
(Q6DAL2) RecName: Full=Bifunctional purine biosynthesis protein ... 454 e-126
CP001616_540(CP001616|pid:none) Tolumonas auensis DSM 9187, comp... 454 e-126
(Q63GS9) RecName: Full=Bifunctional purine biosynthesis protein ... 454 e-126
(P26978) RecName: Full=Bifunctional purine biosynthesis protein ... 454 e-126
CP001138_4105(CP001138|pid:none) Salmonella enterica subsp. ente... 452 e-125
CP000612_2320(CP000612|pid:none) Desulfotomaculum reducens MI-1,... 452 e-125
CP001154_3190(CP001154|pid:none) Laribacter hongkongensis HLHK9,... 452 e-125
CP001080_1033(CP001080|pid:none) Sulfurihydrogenibium sp. YO3AOP... 452 e-125
CP001022_451(CP001022|pid:none) Exiguobacterium sibiricum 255-15... 452 e-125
(Q5FIV5) RecName: Full=Bifunctional purine biosynthesis protein ... 452 e-125
(Q8Z335) RecName: Full=Bifunctional purine biosynthesis protein ... 452 e-125
(Q489F4) RecName: Full=Bifunctional purine biosynthesis protein ... 451 e-125
(B6ENA8) RecName: Full=Bifunctional purine biosynthesis protein ... 451 e-125
(A9N0L8) RecName: Full=Bifunctional purine biosynthesis protein ... 451 e-125
(B7NRT9) RecName: Full=Bifunctional purine biosynthesis protein ... 451 e-125
(Q66FN5) RecName: Full=Bifunctional purine biosynthesis protein ... 451 e-125
(Q8CXK7) RecName: Full=Bifunctional purine biosynthesis protein ... 451 e-125
AP008937_131(AP008937|pid:none) Lactobacillus fermentum IFO 3956... 451 e-125
CP001127_4068(CP001127|pid:none) Salmonella enterica subsp. ente... 450 e-125
AP006725_226(AP006725|pid:none) Klebsiella pneumoniae NTUH-K2044... 449 e-124
(Q13UC4) RecName: Full=Bifunctional purine biosynthesis protein ... 449 e-124
(B8CTW4) RecName: Full=Bifunctional purine biosynthesis protein ... 449 e-124
CP001281_1399(CP001281|pid:none) Thauera sp. MZ1T, complete geno... 449 e-124
(A1AIH7) RecName: Full=Bifunctional purine biosynthesis protein ... 449 e-124
(A3QII0) RecName: Full=Bifunctional purine biosynthesis protein ... 449 e-124
(B5YLE5) RecName: Full=Bifunctional purine biosynthesis protein ... 449 e-124
(A4TS14) RecName: Full=Bifunctional purine biosynthesis protein ... 449 e-124
AE009952_495(AE009952|pid:none) Yersinia pestis KIM, complete ge... 449 e-124
CP000857_3879(CP000857|pid:none) Salmonella enterica subsp. ente... 449 e-124
(A6TGR3) RecName: Full=Bifunctional purine biosynthesis protein ... 449 e-124
CR378674_29(CR378674|pid:none) Photobacterium profundum SS9; seg... 449 e-124
CP000653_216(CP000653|pid:none) Enterobacter sp. 638, complete g... 449 e-124
AP009389_2541(AP009389|pid:none) Pelotomaculum thermopropionicum... 449 e-124
(B7LUJ6) RecName: Full=Bifunctional purine biosynthesis protein ... 449 e-124
(A5VHU2) RecName: Full=Bifunctional purine biosynthesis protein ... 448 e-124
AM490553_1(AM490553|pid:none) Herbaspirillum seropedicae purH ge... 448 e-124
CP000687_923(CP000687|pid:none) Actinobacillus pleuropneumoniae ... 448 e-124
CP001113_4196(CP001113|pid:none) Salmonella enterica subsp. ente... 447 e-124
CU468135_180(CU468135|pid:none) Erwinia tasmaniensis strain ET1/... 447 e-124
CP000970_4274(CP000970|pid:none) Escherichia coli SMS-3-5, compl... 447 e-124
(Q32AH9) RecName: Full=Bifunctional purine biosynthesis protein ... 447 e-124
(Q088G0) RecName: Full=Bifunctional purine biosynthesis protein ... 447 e-124
(B6I5L8) RecName: Full=Bifunctional purine biosynthesis protein ... 447 e-124
CP001091_1011(CP001091|pid:none) Actinobacillus pleuropneumoniae... 447 e-124
(B7NFU7) RecName: Full=Bifunctional purine biosynthesis protein ... 447 e-124
CP001132_1866(CP001132|pid:none) Acidithiobacillus ferrooxidans ... 447 e-124
CP001219_2143(CP001219|pid:none) Acidithiobacillus ferrooxidans ... 447 e-124
(B5Z0A3) RecName: Full=Bifunctional purine biosynthesis protein ... 447 e-124
(A0AJL9) RecName: Full=Bifunctional purine biosynthesis protein ... 446 e-123
(Q12IP4) RecName: Full=Bifunctional purine biosynthesis protein ... 446 e-123
(Q1BZ33) RecName: Full=Bifunctional purine biosynthesis protein ... 446 e-123
CP001098_2191(CP001098|pid:none) Halothermothrix orenii H 168, c... 446 e-123
(B0TR91) RecName: Full=Bifunctional purine biosynthesis protein ... 445 e-123
(Q92AP3) RecName: Full=Bifunctional purine biosynthesis protein ... 444 e-123
(Q8FB68) RecName: Full=Bifunctional purine biosynthesis protein ... 444 e-123
(A4SR98) RecName: Full=Bifunctional purine biosynthesis protein ... 444 e-123
CP000155_5742(CP000155|pid:none) Hahella chejuensis KCTC 2396, c... 444 e-123
CP001600_170(CP001600|pid:none) Edwardsiella ictaluri 93-146, co... 444 e-123
(B1IUP1) RecName: Full=Bifunctional purine biosynthesis protein ... 444 e-123
(A1S2J9) RecName: Full=Bifunctional purine biosynthesis protein ... 444 e-123
(Q049M1) RecName: Full=Bifunctional purine biosynthesis protein ... 444 e-123
(Q39JI8) RecName: Full=Bifunctional purine biosynthesis protein ... 443 e-123
(A1V068) RecName: Full=Bifunctional purine biosynthesis protein ... 443 e-123
(Q2SZ52) RecName: Full=Bifunctional purine biosynthesis protein ... 443 e-123
(O67775) RecName: Full=Bifunctional purine biosynthesis protein ... 443 e-122
(Q0BI80) RecName: Full=Bifunctional purine biosynthesis protein ... 443 e-122
(Q2NWQ7) RecName: Full=Bifunctional purine biosynthesis protein ... 442 e-122
(A4JBL5) RecName: Full=Bifunctional purine biosynthesis protein ... 442 e-122
(A1JIJ7) RecName: Full=Bifunctional purine biosynthesis protein ... 442 e-122
(Q3JNS8) RecName: Full=Bifunctional purine biosynthesis protein ... 442 e-122
CP001010_1327(CP001010|pid:none) Polynucleobacter necessarius su... 442 e-122
(A9MHC3) RecName: Full=Bifunctional purine biosynthesis protein ... 442 e-122
(A8MLI9) RecName: Full=Bifunctional purine biosynthesis protein ... 442 e-122
CP001339_354(CP001339|pid:none) Thioalkalivibrio sp. HL-EbGR7, c... 442 e-122
CP000360_4465(CP000360|pid:none) Acidobacteria bacterium Ellin34... 441 e-122
(Q31II8) RecName: Full=Bifunctional purine biosynthesis protein ... 440 e-122
CP000388_267(CP000388|pid:none) Pseudoalteromonas atlantica T6c,... 440 e-122
(Q1H4G7) RecName: Full=Bifunctional purine biosynthesis protein ... 440 e-122
CP000503_540(CP000503|pid:none) Shewanella sp. W3-18-1, complete... 439 e-121
(Q74FJ9) RecName: Full=Bifunctional purine biosynthesis protein ... 438 e-121
CP001013_531(CP001013|pid:none) Leptothrix cholodnii SP-6, compl... 437 e-121
CP000863_2389(CP000863|pid:none) Acinetobacter baumannii ACICU, ... 437 e-121
AM942759_2744(AM942759|pid:none) Proteus mirabilis strain HI4320... 437 e-121
CP000875_2732(CP000875|pid:none) Herpetosiphon aurantiacus ATCC ... 437 e-121
(Q8YSJ2) RecName: Full=Bifunctional purine biosynthesis protein ... 436 e-120
DTEBPH(S18488) purH bifunctional enzyme - Salmonella typhimurium... 436 e-120
CP000469_439(CP000469|pid:none) Shewanella sp. ANA-3, complete g... 435 e-120
CP000444_3558(CP000444|pid:none) Shewanella sp. MR-7, complete g... 435 e-120
FP236842_270(FP236842|pid:none) Erwinia pyrifoliae strain Ep1/96... 435 e-120
CP001068_371(CP001068|pid:none) Ralstonia pickettii 12J chromoso... 435 e-120
(Q1QA75) RecName: Full=Bifunctional purine biosynthesis protein ... 434 e-120
(Q475R4) RecName: Full=Bifunctional purine biosynthesis protein ... 434 e-120
(Q1LRB3) RecName: Full=Bifunctional purine biosynthesis protein ... 434 e-120
AM167904_2774(AM167904|pid:none) Bordetella avium 197N complete ... 434 e-120
(Q0I557) RecName: Full=Bifunctional purine biosynthesis protein ... 434 e-120
(Q8EJM1) RecName: Full=Bifunctional purine biosynthesis protein ... 434 e-120
(Q833Z3) RecName: Full=Bifunctional purine biosynthesis protein ... 434 e-120
CP000891_4014(CP000891|pid:none) Shewanella baltica OS195, compl... 434 e-120
(B0UWT1) RecName: Full=Bifunctional purine biosynthesis protein ... 434 e-120
(Q8DWK8) RecName: Full=Bifunctional purine biosynthesis protein ... 433 e-120
CP000563_415(CP000563|pid:none) Shewanella baltica OS155, comple... 433 e-120
AE014133_33(AE014133|pid:none) Streptococcus mutans UA159, compl... 433 e-120
AL954747_877(AL954747|pid:none) Nitrosomonas europaea ATCC 19718... 433 e-120
CP000753_3864(CP000753|pid:none) Shewanella baltica OS185, compl... 433 e-120
CP001252_3774(CP001252|pid:none) Shewanella baltica OS223, compl... 433 e-120
CP001037_5786(CP001037|pid:none) Nostoc punctiforme PCC 73102, c... 433 e-119
CP001124_3418(CP001124|pid:none) Geobacter bemidjiensis Bem, com... 433 e-119
(Q3M6G3) RecName: Full=Bifunctional purine biosynthesis protein ... 433 e-119
CP000512_876(CP000512|pid:none) Acidovorax citrulli AAC00-1, com... 433 e-119
CT573071_1133(CT573071|pid:none) Kuenenia stuttgartiensis genome... 432 e-119
(Q3A2D6) RecName: Full=Bifunctional purine biosynthesis protein ... 432 e-119
CP000671_1331(CP000671|pid:none) Haemophilus influenzae PittEE, ... 432 e-119
AE016827_1297(AE016827|pid:none) Mannheimia succiniciproducens M... 432 e-119
AY458646_15(AY458646|pid:none) Uncultured marine bacterium 578 c... 431 e-119
(Q46HA8) RecName: Full=Bifunctional purine biosynthesis protein ... 431 e-119
(Q3K3Z7) RecName: Full=Bifunctional purine biosynthesis protein ... 431 e-119
CP000542_2965(CP000542|pid:none) Verminephrobacter eiseniae EF01... 431 e-119
CP000930_2982(CP000930|pid:none) Heliobacterium modesticaldum Ic... 431 e-119
CU861906_500(CU861906|pid:none) Ralstonia solanacearum strain Mo... 431 e-119
CP000094_613(CP000094|pid:none) Pseudomonas fluorescens Pf0-1, c... 430 e-119
BX640421_153(BX640421|pid:none) Bordetella pertussis strain Toha... 429 e-118
(Q67KG3) RecName: Full=Bifunctional purine biosynthesis protein ... 429 e-118
CU914168_543(CU914168|pid:none) Ralstonia solanacearum strain IP... 429 e-118
CP001392_2852(CP001392|pid:none) Diaphorobacter sp. TPSY, comple... 429 e-118
(Q1J934) RecName: Full=Bifunctional purine biosynthesis protein ... 429 e-118
(Q8K8Y6) RecName: Full=Bifunctional purine biosynthesis protein ... 428 e-118
BX640449_70(BX640449|pid:none) Bordetella bronchiseptica strain ... 428 e-118
(P67545) RecName: Full=Bifunctional purine biosynthesis protein ... 428 e-118
AM181176_594(AM181176|pid:none) Pseudomonas fluorescens SBW25 co... 428 e-118
AE007317_51(AE007317|pid:none) Streptococcus pneumoniae R6, comp... 428 e-118
(Q5XEF2) RecName: Full=Bifunctional purine biosynthesis protein ... 427 e-118
CP001359_1470(CP001359|pid:none) Anaeromyxobacter dehalogenans 2... 427 e-118
CP001131_1379(CP001131|pid:none) Anaeromyxobacter sp. K, complet... 427 e-118
(Q5WJ82) RecName: Full=Bifunctional purine biosynthesis protein ... 426 e-117
(Q9PC10) RecName: Full=Bifunctional purine biosynthesis protein ... 426 e-117
(Q03Y85) RecName: Full=Bifunctional purine biosynthesis protein ... 426 e-117
CP000860_1562(CP000860|pid:none) Candidatus Desulforudis audaxvi... 426 e-117
(Q39RK1) RecName: Full=Bifunctional purine biosynthesis protein ... 426 e-117
AE008692_27(AE008692|pid:none) Zymomonas mobilis subsp. mobilis ... 426 e-117
CP000941_912(CP000941|pid:none) Xylella fastidiosa M12, complete... 426 e-117
(Q87D58) RecName: Full=Bifunctional purine biosynthesis protein ... 426 e-117
(A8AUA2) RecName: Full=Bifunctional purine biosynthesis protein ... 426 e-117
AE017221_561(AE017221|pid:none) Thermus thermophilus HB27, compl... 426 e-117
CP000473_6339(CP000473|pid:none) Solibacter usitatus Ellin6076, ... 426 e-117
CP000539_3440(CP000539|pid:none) Acidovorax sp. JS42, complete g... 425 e-117
CP001196_332(CP001196|pid:none) Oligotropha carboxidovorans OM5 ... 425 e-117
CP000023_35(CP000023|pid:none) Streptococcus thermophilus LMG 18... 425 e-117
CP001111_3656(CP001111|pid:none) Stenotrophomonas maltophilia R5... 425 e-117
(A9M4I2) RecName: Full=Bifunctional purine biosynthesis protein ... 425 e-117
(Q03E83) RecName: Full=Bifunctional purine biosynthesis protein ... 424 e-117
CP000746_1130(CP000746|pid:none) Actinobacillus succinogenes 130... 424 e-117
(A4VPK9) RecName: Full=Bifunctional purine biosynthesis protein ... 424 e-117
(Q03MZ6) RecName: Full=Bifunctional purine biosynthesis protein ... 424 e-117
CP000058_4253(CP000058|pid:none) Pseudomonas syringae pv. phaseo... 424 e-117
CP000089_3637(CP000089|pid:none) Dechloromonas aromatica RCB, co... 424 e-117
CP000075_4405(CP000075|pid:none) Pseudomonas syringae pv. syring... 424 e-117
(A5FUH4) RecName: Full=Bifunctional purine biosynthesis protein ... 424 e-117
CP000319_194(CP000319|pid:none) Nitrobacter hamburgensis X14, co... 424 e-117
CP000283_717(CP000283|pid:none) Rhodopseudomonas palustris BisB5... 424 e-117
(Q5F6T1) RecName: Full=Bifunctional purine biosynthesis protein ... 423 e-117
(Q8DIN5) RecName: Full=Bifunctional purine biosynthesis protein ... 423 e-116
AK102764_1(AK102764|pid:none) Oryza sativa Japonica Group cDNA c... 423 e-116
CP000267_1552(CP000267|pid:none) Rhodoferax ferrireducens T118, ... 423 e-116
CP000951_1662(CP000951|pid:none) Synechococcus sp. PCC 7002, com... 422 e-116
BX572593_28(BX572593|pid:none) Rhodopseudomonas palustris CGA009... 422 e-116
AY281355_7(AY281355|pid:none) Uncultured Acidobacteria bacterium... 422 e-116
CP000918_110(CP000918|pid:none) Streptococcus pneumoniae 70585, ... 422 e-116
CP000463_26(CP000463|pid:none) Rhodopseudomonas palustris BisA53... 422 e-116
(A5G879) RecName: Full=Bifunctional purine biosynthesis protein ... 422 e-116
(B0RN27) RecName: Full=Bifunctional purine biosynthesis protein ... 422 e-116
CP000919_75(CP000919|pid:none) Streptococcus pneumoniae JJA, com... 422 e-116
CP000285_2274(CP000285|pid:none) Chromohalobacter salexigens DSM... 422 e-116
(Q9JZM7) RecName: Full=Bifunctional purine biosynthesis protein ... 421 e-116
CP000885_639(CP000885|pid:none) Clostridium phytofermentans ISDg... 421 e-116
CP000494_310(CP000494|pid:none) Bradyrhizobium sp. BTAi1, comple... 421 e-116
CP000920_104(CP000920|pid:none) Streptococcus pneumoniae P1031, ... 421 e-116
(A5W9K7) RecName: Full=Bifunctional purine biosynthesis protein ... 421 e-116
(Q97T99) RecName: Full=Bifunctional purine biosynthesis protein ... 421 e-116
CP001033_52(CP001033|pid:none) Streptococcus pneumoniae CGSP14, ... 421 e-116
CP000936_145(CP000936|pid:none) Streptococcus pneumoniae Hungary... 421 e-116
(Q9F1T4) RecName: Full=Bifunctional purine biosynthesis protein ... 421 e-116
(B7K3N8) RecName: Full=Bifunctional purine biosynthesis protein ... 419 e-115
CP000562_1061(CP000562|pid:none) Methanoculleus marisnigri JR1, ... 419 e-115
(B0KJZ6) RecName: Full=Bifunctional purine biosynthesis protein ... 419 e-115
(Q02Y66) RecName: Full=Bifunctional purine biosynthesis protein ... 418 e-115
(Q1I4C1) RecName: Full=Bifunctional purine biosynthesis protein ... 418 e-115
EU255917_2(EU255917|pid:none) Lactococcus lactis subsp. lactis c... 418 e-115
(A2RJY0) RecName: Full=Bifunctional purine biosynthesis protein ... 417 e-115
(A6LSB3) RecName: Full=Bifunctional purine biosynthesis protein ... 417 e-115
CP000387_32(CP000387|pid:none) Streptococcus sanguinis SK36, com... 417 e-115
AM946015_30(AM946015|pid:none) Streptococcus uberis 0140J comple... 417 e-115
CP001614_2709(CP001614|pid:none) Teredinibacter turnerae T7901, ... 417 e-115
CT978603_2316(CT978603|pid:none) Synechococcus sp. RCC307 genomi... 416 e-114
(B7KGS0) RecName: Full=Bifunctional purine biosynthesis protein ... 416 e-114
(Q116T4) RecName: Full=Bifunctional purine biosynthesis protein ... 416 e-114
AP009153_1279(AP009153|pid:none) Gemmatimonas aurantiaca T-27 DN... 416 e-114
(A9BIX9) RecName: Full=Bifunctional purine biosynthesis protein ... 415 e-114
(Q5H5H7) RecName: Full=Bifunctional purine biosynthesis protein ... 415 e-114
AP009384_4696(AP009384|pid:none) Azorhizobium caulinodans ORS 57... 415 e-114
AF321497_1(AF321497|pid:none) Nicotiana tabacum phosphoribosylam... 415 e-114
AP009247_837(AP009247|pid:none) Candidatus Vesicomyosocius okuta... 415 e-114
CP001581_3084(CP001581|pid:none) Clostridium botulinum A2 str. K... 414 e-114
(Q1D898) RecName: Full=Bifunctional purine biosynthesis protein ... 414 e-114
FM204884_30(FM204884|pid:none) Streptococcus equi subsp. zooepid... 414 e-114
(A5I5V9) RecName: Full=Bifunctional purine biosynthesis protein ... 414 e-114
CP000254_2938(CP000254|pid:none) Methanospirillum hungatei JF-1,... 414 e-114
CU234118_321(CU234118|pid:none) Bradyrhizobium sp. ORS278,comple... 413 e-114
FM177140_1912(FM177140|pid:none) Lactobacillus casei BL23 comple... 413 e-114
CP000488_873(CP000488|pid:none) Candidatus Ruthia magnifica str.... 413 e-114
(B1IL57) RecName: Full=Bifunctional purine biosynthesis protein ... 413 e-114
(A7HA60) RecName: Full=Bifunctional purine biosynthesis protein ... 413 e-113
(Q2P866) RecName: Full=Bifunctional purine biosynthesis protein ... 413 e-113
CP000250_84(CP000250|pid:none) Rhodopseudomonas palustris HaA2, ... 412 e-113
(Q0SV48) RecName: Full=Bifunctional purine biosynthesis protein ... 412 e-113
CP001364_2170(CP001364|pid:none) Chloroflexus sp. Y-400-fl, comp... 412 e-113
(Q8XMK2) RecName: Full=Bifunctional purine biosynthesis protein ... 412 e-113
(Q3BY85) RecName: Full=Bifunctional purine biosynthesis protein ... 412 e-113
CP000962_2863(CP000962|pid:none) Clostridium botulinum A3 str. L... 411 e-113
(A7GH96) RecName: Full=Bifunctional purine biosynthesis protein ... 411 e-113
(Q037V3) RecName: Full=Bifunctional purine biosynthesis protein ... 411 e-113
CP001078_972(CP001078|pid:none) Clostridium botulinum E3 str. Al... 411 e-113
AY193836_1(AY193836|pid:none) Vigna unguiculata aminoimidazoleca... 410 e-112
(Q1LU51) RecName: Full=Bifunctional purine biosynthesis protein ... 409 e-112
CP000605_459(CP000605|pid:none) Bifidobacterium longum DJO10A, c... 409 e-112
AY091122_1(AY091122|pid:none) Arabidopsis thaliana putative phos... 408 e-112
AC004238_26(AC004238|pid:none) Arabidopsis thaliana chromosome 2... 408 e-112
CP001510_2340(CP001510|pid:none) Methylobacterium extorquens AM1... 408 e-112
(Q31R91) RecName: Full=Bifunctional purine biosynthesis protein ... 407 e-112
CP001298_2658(CP001298|pid:none) Methylobacterium chloromethanic... 407 e-112
AP009256_811(AP009256|pid:none) Bifidobacterium adolescentis ATC... 406 e-111
CP000157_2508(CP000157|pid:none) Erythrobacter litoralis HTCC259... 406 e-111
AP006618_5006(AP006618|pid:none) Nocardia farcinica IFM 10152 DN... 406 e-111
CP000316_1117(CP000316|pid:none) Polaromonas sp. JS666, complete... 406 e-111
CP000453_606(CP000453|pid:none) Alkalilimnicola ehrlichii MLHE-1... 406 e-111
AM778947_19(AM778947|pid:none) Microcystis aeruginosa PCC 7806 g... 405 e-111
(Q9KY50) RecName: Full=Bifunctional purine biosynthesis protein ... 405 e-111
CP001020_481(CP001020|pid:none) Coxiella burnetii CbuK_Q154, com... 405 e-111
CP000544_1969(CP000544|pid:none) Halorhodospira halophila SL1, c... 405 e-111
(B0JL55) RecName: Full=Bifunctional purine biosynthesis protein ... 405 e-111
CP000009_412(CP000009|pid:none) Gluconobacter oxydans 621H, comp... 404 e-111
AM942444_534(AM942444|pid:none) Corynebacterium urealyticum DSM ... 404 e-111
AM420293_6475(AM420293|pid:none) Saccharopolyspora erythraea NRR... 404 e-111
CP001129_28(CP001129|pid:none) Streptococcus equi subsp. zooepid... 403 e-111
CP000890_383(CP000890|pid:none) Coxiella burnetii RSA 331, compl... 402 e-110
CP001213_1314(CP001213|pid:none) Bifidobacterium animalis subsp.... 402 e-110
CP000781_1718(CP000781|pid:none) Xanthobacter autotrophicus Py2,... 402 e-110
CP001620_452(CP001620|pid:none) Corynebacterium kroppenstedtii D... 402 e-110
CP001032_3170(CP001032|pid:none) Opitutus terrae PB90-1, complet... 401 e-110
CP001618_2990(CP001618|pid:none) Beutenbergia cavernae DSM 12333... 400 e-110
(Q1GKJ2) RecName: Full=Bifunctional purine biosynthesis protein ... 400 e-109
AE017354_449(AE017354|pid:none) Legionella pneumophila subsp. pn... 400 e-109
CR628336_526(CR628336|pid:none) Legionella pneumophila str. Pari... 399 e-109
CP000559_933(CP000559|pid:none) Methanocorpusculum labreanum Z, ... 399 e-109
CP000628_3726(CP000628|pid:none) Agrobacterium radiobacter K84 c... 399 e-109
AP009484_696(AP009484|pid:none) Macrococcus caseolyticus JCSC540... 399 e-109
(A5N0Q0) RecName: Full=Bifunctional purine biosynthesis protein ... 399 e-109
(Q9Z5H5) RecName: Full=Bifunctional purine biosynthesis protein ... 399 e-109
CP001391_698(CP001391|pid:none) Wolbachia sp. wRi, complete geno... 399 e-109
CP001095_1118(CP001095|pid:none) Bifidobacterium longum subsp. i... 398 e-109
CP000480_5329(CP000480|pid:none) Mycobacterium smegmatis str. MC... 398 e-109
(Q7UKJ8) RecName: Full=Bifunctional purine biosynthesis protein ... 397 e-109
CR628337_502(CR628337|pid:none) Legionella pneumophila str. Lens... 397 e-109
(A9GIT1) RecName: Full=Bifunctional purine biosynthesis protein ... 397 e-109
CP001001_5511(CP001001|pid:none) Methylobacterium radiotolerans ... 396 e-108
CR767821_856(CR767821|pid:none) Ehrlichia ruminantium strain Wel... 396 e-108
CP001275_832(CP001275|pid:none) Thermomicrobium roseum DSM 5159,... 396 e-108
CP000016_536(CP000016|pid:none) Candidatus Blochmannia pennsylva... 395 e-108
CP000975_1121(CP000975|pid:none) Methylacidiphilum infernorum V4... 395 e-108
(Q8REV6) RecName: Full=Bifunctional purine biosynthesis protein ... 395 e-108
CP001074_4338(CP001074|pid:none) Rhizobium etli CIAT 652, comple... 395 e-108
(A7HSQ6) RecName: Full=Bifunctional purine biosynthesis protein ... 395 e-108
(Q31CR6) RecName: Full=Bifunctional purine biosynthesis protein ... 394 e-108
(Q5LN38) RecName: Full=Bifunctional purine biosynthesis protein ... 394 e-108
(A2BUP7) RecName: Full=Bifunctional purine biosynthesis protein ... 394 e-108
BA000011_16(BA000011|pid:none) Thermoplasma volcanium GSS1 DNA, ... 394 e-108
CP001277_1827(CP001277|pid:none) Candidatus Hamiltonella defensa... 394 e-108
(A1B5K8) RecName: Full=Bifunctional purine biosynthesis protein ... 393 e-107
CP000613_2300(CP000613|pid:none) Rhodospirillum centenum SW, com... 393 e-107
CP001251_787(CP001251|pid:none) Dictyoglomus turgidum DSM 6724, ... 393 e-107
(Q9ABY4) RecName: Full=Bifunctional purine biosynthesis protein ... 393 e-107
(Q6A6Y8) RecName: Full=Bifunctional purine biosynthesis protein ... 393 e-107
(Q8KA70) RecName: Full=Bifunctional purine biosynthesis protein ... 393 e-107
(A8G2S6) RecName: Full=Bifunctional purine biosynthesis protein ... 393 e-107
CP001101_1805(CP001101|pid:none) Chlorobium phaeobacteroides BS1... 393 e-107
CP000937_644(CP000937|pid:none) Francisella philomiragia subsp. ... 392 e-107
(A3PAY7) RecName: Full=Bifunctional purine biosynthesis protein ... 392 e-107
CP001146_675(CP001146|pid:none) Dictyoglomus thermophilum H-6-12... 392 e-107
AP008957_4423(AP008957|pid:none) Rhodococcus erythropolis PR4 DN... 392 e-107
BA000030_3451(BA000030|pid:none) Streptomyces avermitilis MA-468... 392 e-107
CP001099_1679(CP001099|pid:none) Chlorobaculum parvum NCIB 8327,... 391 e-107
BA000033_956(BA000033|pid:none) Staphylococcus aureus subsp. aur... 391 e-107
(B5ZV31) RecName: Full=Bifunctional purine biosynthesis protein ... 391 e-107
AM295250_691(AM295250|pid:none) Staphylococcus carnosus subsp. c... 391 e-107
(Q2FZI6) RecName: Full=Bifunctional purine biosynthesis protein ... 391 e-107
AP009493_2717(AP009493|pid:none) Streptomyces griseus subsp. gri... 391 e-107
(Q6GI11) RecName: Full=Bifunctional purine biosynthesis protein ... 391 e-107
CR925677_869(CR925677|pid:none) Ehrlichia ruminantium str. Garde... 391 e-107
AP009324_1066(AP009324|pid:none) Staphylococcus aureus subsp. au... 391 e-107
(A5IRW0) RecName: Full=Bifunctional purine biosynthesis protein ... 391 e-107
CP000699_442(CP000699|pid:none) Sphingomonas wittichii RW1, comp... 390 e-107
(Q8UBM8) RecName: Full=Bifunctional purine biosynthesis protein ... 390 e-106
CP001071_1184(CP001071|pid:none) Akkermansia muciniphila ATCC BA... 390 e-106
(A2BP65) RecName: Full=Bifunctional purine biosynthesis protein ... 389 e-106
CP001161_28(CP001161|pid:none) Buchnera aphidicola str. 5A (Acyr... 389 e-106
(A6QFT1) RecName: Full=Bifunctional purine biosynthesis protein ... 389 e-106
(Q0IDE8) RecName: Full=Bifunctional purine biosynthesis protein ... 388 e-106
CP000240_2772(CP000240|pid:none) Synechococcus sp. JA-2-3B'a(2-1... 388 e-106
(A6WXV3) RecName: Full=Bifunctional purine biosynthesis protein ... 388 e-106
CP000239_2673(CP000239|pid:none) Synechococcus sp. JA-3-3Ab, com... 387 e-106
CP001110_2095(CP001110|pid:none) Pelodictyon phaeoclathratiforme... 387 e-106
(Q6AD62) RecName: Full=Bifunctional purine biosynthesis protein ... 386 e-105
(Q2YLH0) RecName: Full=Bifunctional purine biosynthesis protein ... 386 e-105
CP001341_1155(CP001341|pid:none) Arthrobacter chlorophenolicus A... 386 e-105
AE010299_3908(AE010299|pid:none) Methanosarcina acetivorans str.... 386 e-105
CP000820_5849(CP000820|pid:none) Frankia sp. EAN1pec, complete g... 385 e-105
(A4WWQ0) RecName: Full=Bifunctional purine biosynthesis protein ... 385 e-105
CP001280_1536(CP001280|pid:none) Methylocella silvestris BL2, co... 385 e-105
(B2KCF7) RecName: Full=Bifunctional purine biosynthesis protein ... 385 e-105
AF232750_1(AF232750|pid:none) Mycobacterium avium subsp. paratub... 385 e-105
(Q11CT4) RecName: Full=Bifunctional purine biosynthesis protein ... 384 e-105
(A3PNE9) RecName: Full=Bifunctional purine biosynthesis protein ... 384 e-105
(Q72RT5) RecName: Full=Bifunctional purine biosynthesis protein ... 384 e-105
DQ351275_2(DQ351275|pid:none) Streptomyces sp. NRRL 30748 merida... 383 e-104
AE016958_903(AE016958|pid:none) Mycobacterium avium subsp. parat... 383 e-104
(Q9RAJ5) RecName: Full=Bifunctional purine biosynthesis protein ... 383 e-104
CP001114_1768(CP001114|pid:none) Deinococcus deserti VCD115, com... 382 e-104
CP000850_4042(CP000850|pid:none) Salinispora arenicola CNS-205, ... 382 e-104
(A2CCK6) RecName: Full=Bifunctional purine biosynthesis protein ... 382 e-104
(Q7TTX6) RecName: Full=Bifunctional purine biosynthesis protein ... 382 e-104
CP000633_3150(CP000633|pid:none) Agrobacterium vitis S4 chromoso... 382 e-104
CP000249_646(CP000249|pid:none) Frankia sp. CcI3, complete genome. 381 e-104
(Q8NS21) RecName: Full=Bifunctional purine biosynthesis protein ... 381 e-104
(A4SDE6) RecName: Full=Bifunctional purine biosynthesis protein ... 380 e-103
CP001338_2238(CP001338|pid:none) Candidatus Methanosphaerula pal... 379 e-103
(Q3B5R1) RecName: Full=Bifunctional purine biosynthesis protein ... 379 e-103
CP001108_1652(CP001108|pid:none) Prosthecochloris aestuarii DSM ... 379 e-103
(A1UL88) RecName: Full=Bifunctional purine biosynthesis protein ... 379 e-103
(Q89B23) RecName: Full=Bifunctional purine biosynthesis protein ... 379 e-103
(Q7TUM7) RecName: Full=Bifunctional purine biosynthesis protein ... 378 e-103
(Q9RHX6) RecName: Full=Bifunctional purine biosynthesis protein ... 378 e-103
CP001601_808(CP001601|pid:none) Corynebacterium aurimucosum ATCC... 378 e-103
CP000656_1859(CP000656|pid:none) Mycobacterium gilvum PYR-GCK, c... 377 e-103
CP000910_237(CP000910|pid:none) Renibacterium salmoninarum ATCC ... 377 e-103
AP009510_425(AP009510|pid:none) Uncultured Termite group 1 bacte... 377 e-103
CP001389_3254(CP001389|pid:none) Rhizobium sp. NGR234, complete ... 377 e-103
(Q92KX6) RecName: Full=Bifunctional purine biosynthesis protein ... 377 e-103
CP000511_4778(CP000511|pid:none) Mycobacterium vanbaalenii PYR-1... 376 e-102
CP000107_846(CP000107|pid:none) Ehrlichia canis str. Jake, compl... 375 e-102
CP000158_3311(CP000158|pid:none) Hyphomonas neptunium ATCC 15444... 375 e-102
(Q28K03) RecName: Full=Bifunctional purine biosynthesis protein ... 373 e-101
AE008384_898(AE008384|pid:none) Methanosarcina mazei strain Goe1... 372 e-101
(B2A5W1) RecName: Full=Bifunctional purine biosynthesis protein ... 372 e-101
(A6UED3) RecName: Full=Bifunctional purine biosynthesis protein ... 371 e-101
CP000030_766(CP000030|pid:none) Anaplasma marginale str. St. Mar... 371 e-101
(Q04T56) RecName: Full=Bifunctional purine biosynthesis protein ... 370 e-101
AE000513_853(AE000513|pid:none) Deinococcus radiodurans R1 chrom... 370 e-101
BX248583_521(BX248583|pid:none) Blochmannia floridanus complete ... 370 e-100
CP001562_1666(CP001562|pid:none) Bartonella grahamii as4aup, com... 369 e-100
CP000777_1383(CP000777|pid:none) Leptospira biflexa serovar Pato... 369 e-100
AP009178_948(AP009178|pid:none) Nitratiruptor sp. SB155-2 genomi... 367 e-99
(A9IZD0) RecName: Full=Bifunctional purine biosynthesis protein ... 367 e-99
CU466930_1807(CU466930|pid:none) Candidatus Cloacamonas acidamin... 366 1e-99
(A7GYY6) RecName: Full=Bifunctional purine biosynthesis protein ... 365 4e-99
AP008971_1360(AP008971|pid:none) Finegoldia magna ATCC 29328 DNA... 363 1e-98
CP000300_1785(CP000300|pid:none) Methanococcoides burtonii DSM 6... 360 7e-98
CP000776_629(CP000776|pid:none) Campylobacter hominis ATCC BAA-3... 359 2e-97
(A1VZU4) RecName: Full=Bifunctional purine biosynthesis protein ... 354 5e-96
BX571662_34(BX571662|pid:none) Wolinella succinogenes, complete ... 350 9e-95
CP000487_538(CP000487|pid:none) Campylobacter fetus subsp. fetus... 348 3e-94
(A7H375) RecName: Full=Bifunctional purine biosynthesis protein ... 345 2e-93
DQ780160_1(DQ780160|pid:none) Endoriftia persephone 'Hot96_1+Hot... 345 3e-93
CP000153_548(CP000153|pid:none) Sulfurimonas denitrificans DSM 1... 344 5e-93
(A7ZCZ7) RecName: Full=Bifunctional purine biosynthesis protein ... 342 3e-92
AP006841_4094(AP006841|pid:none) Bacteroides fragilis YCH46 DNA,... 339 2e-91
CP000084_318(CP000084|pid:none) Candidatus Pelagibacter ubique H... 330 1e-88
AM398681_2351(AM398681|pid:none) Flavobacterium psychrophilum JI... 329 2e-88
AE015924_1199(AE015924|pid:none) Porphyromonas gingivalis W83, c... 324 7e-87
AP009380_865(AP009380|pid:none) Porphyromonas gingivalis ATCC 33... 324 7e-87
AP010656_523(AP010656|pid:none) Candidatus Azobacteroides pseudo... 318 4e-85
Y09252_1(Y09252|pid:none) B.cereus pur9 gene, partial. 316 2e-84
BX842654_120(BX842654|pid:none) Bdellovibrio bacteriovorus compl... 312 2e-83
AE017125_483(AE017125|pid:none) Helicobacter hepaticus ATCC 5144... 304 8e-81
DQ021277_1(DQ021277|pid:none) Vibrio cholerae isolate 928-93 pho... 294 6e-78
DQ021272_1(DQ021272|pid:none) Vibrio cholerae isolate M4287/77 p... 288 3e-76
L24177_2(L24177|pid:none) Myxococcus xanthus DNA-binding protein... 283 1e-74
EU138753_1(EU138753|pid:none) Bacillus subtilis strain NRRL B-23... 282 2e-74
EU138777_1(EU138777|pid:none) Bacillus subtilis strain NRRL BD-5... 281 4e-74
EU138728_1(EU138728|pid:none) Bacillus subtilis strain NRRL B-36... 281 5e-74
EU138730_1(EU138730|pid:none) Bacillus subtilis strain NRRL B-42... 281 7e-74
EU138755_1(EU138755|pid:none) Bacillus subtilis strain NRRL B-23... 281 7e-74
EU138768_1(EU138768|pid:none) Bacillus subtilis strain NRRL BD-5... 281 7e-74
EU138744_1(EU138744|pid:none) Bacillus subtilis subsp. spizizeni... 279 2e-73
EU138740_1(EU138740|pid:none) Bacillus subtilis subsp. spizizeni... 279 2e-73
EU138761_1(EU138761|pid:none) Bacillus mojavensis strain NRRL B-... 279 3e-73
EU138736_1(EU138736|pid:none) Bacillus mojavensis strain NRRL B-... 278 3e-73
EU138746_1(EU138746|pid:none) Bacillus inaquosus strain NRRL B-2... 278 3e-73
EU138766_1(EU138766|pid:none) Bacillus subtilis strain NRRL BD-5... 278 5e-73
EU138773_1(EU138773|pid:none) Bacillus subtilis subsp. spizizeni... 277 1e-72
EU138735_1(EU138735|pid:none) Bacillus inaquosus strain NRRL B-1... 276 1e-72
EU138793_1(EU138793|pid:none) Bacillus pumilus strain NRRL NRS-2... 276 1e-72
EU138739_1(EU138739|pid:none) Bacillus vallismortis strain NRRL ... 274 9e-72
U58747_1(U58747|pid:none) Caenorhabditis elegans cosmid C55F2, c... 273 2e-71
EU138749_1(EU138749|pid:none) Bacillus sonorensis strain NRRL B-... 271 7e-71
EU138788_1(EU138788|pid:none) Bacillus velezensis strain NRRL BD... 270 9e-71
EU138750_1(EU138750|pid:none) Bacillus velezensis strain NRRL B-... 270 9e-71
EU138764_1(EU138764|pid:none) Bacillus velezensis strain NRRL BD... 269 2e-70
EU138732_1(EU138732|pid:none) Bacillus velezensis strain NRRL B-... 268 5e-70
AY616096_1(AY616096|pid:none) Prototheca wickerhamii plastid pho... 267 8e-70
CR762428_2(CR762428|pid:none) Zebrafish DNA sequence from clone ... 260 1e-67
BC074584_1(BC074584|pid:none) Xenopus tropicalis 5-aminoimidazol... 257 8e-67
AY357301_1(AY357301|pid:none) Leptinotarsa decemlineata 5-aminoi... 255 3e-66
AY764168_1(AY764168|pid:none) Gallus gallus aminoimidazole-4-car... 255 4e-66
(P31335) RecName: Full=Bifunctional purine biosynthesis protein ... 254 5e-66
AY787802_1(AY787802|pid:none) Gallus gallus clone LWPurH0406 ami... 254 5e-66
AY787801_1(AY787801|pid:none) Gallus gallus clone JNPurH0405 ami... 254 5e-66
EU334506_1(EU334506|pid:none) Gallus gallus aminoimidazole-4-car... 254 5e-66
AY787803_1(AY787803|pid:none) Gallus gallus clone LYPurH0407 ami... 254 7e-66
BT045329_1(BT045329|pid:none) Salmo salar clone ssal-rgf-518-231... 253 1e-65
BT058968_1(BT058968|pid:none) Salmo salar clone ssal-rgf-516-314... 253 2e-65
CP000916_1325(CP000916|pid:none) Thermotoga neapolitana DSM 4359... 251 5e-65
U37436_1(U37436|pid:none) Human AICAR formyltransferase/IMP cycl... 251 6e-65
(P31939) RecName: Full=Bifunctional purine biosynthesis protein ... 250 1e-64
AK290067_1(AK290067|pid:none) Homo sapiens cDNA FLJ75424 complet... 249 2e-64
AK313066_1(AK313066|pid:none) Homo sapiens cDNA, FLJ93545, highl... 247 9e-64
FM992695_373(FM992695|pid:none) Candida dubliniensis CD36 chromo... 247 9e-64
AY939844_191(AY939844|pid:none) Cyanophage P-SSM2, complete geno... 246 1e-63
(Q9CWJ9) RecName: Full=Bifunctional purine biosynthesis protein ... 245 3e-63
(O35567) RecName: Full=Bifunctional purine biosynthesis protein ... 245 4e-63
AM270071_27(AM270071|pid:none) Aspergillus niger contig An04c010... 243 2e-62
D89514_1(D89514|pid:none) Rattus norvegicus mRNA for 5-aminoimid... 242 3e-62
CP000502_207(CP000502|pid:none) Pichia stipitis CBS 6054 chromos... 241 5e-62
CR382130_980(CR382130|pid:none) Yarrowia lipolytica strain CLIB1... 241 8e-62
(O74928) RecName: Full=Bifunctional purine biosynthesis protein ... 238 7e-61
CU928169_372(CU928169|pid:none) Kluyveromyces thermotolerans str... 237 9e-61
AP007157_717(AP007157|pid:none) Aspergillus oryzae RIB40 genomic... 233 1e-59
CP001365_917(CP001365|pid:none) Halorubrum lacusprofundi ATCC 49... 231 5e-59
CU633901_54(CU633901|pid:none) Podospora anserina genomic DNA ch... 231 8e-59
AE014297_3808(AE014297|pid:none) Drosophila melanogaster chromos... 223 2e-56
AE016819_446(AE016819|pid:none) Ashbya gossypii (= Eremothecium ... 218 6e-55
S54424(S54424) phosphoribosylaminoimidazolecarboxamide formyltra... 216 3e-54
AK010449_1(AK010449|pid:none) Mus musculus ES cells cDNA, RIKEN ... 210 2e-52
CP000521_2430(CP000521|pid:none) Acinetobacter baumannii ATCC 17... 208 6e-52
AK298142_1(AK298142|pid:none) Homo sapiens cDNA FLJ57133 complet... 192 3e-47
AF064944_1(AF064944|pid:none) Coxiella burnetii phosphoribosylam... 190 2e-46
CP001185_1837(CP001185|pid:none) Thermosipho africanus TCF52B, c... 187 1e-45
CP001322_3249(CP001322|pid:none) Desulfatibacillum alkenivorans ... 185 4e-45
CP001185_715(CP001185|pid:none) Thermosipho africanus TCF52B, co... 184 7e-45
CP000771_1635(CP000771|pid:none) Fervidobacterium nodosum Rt17-B... 181 1e-43
CP000716_374(CP000716|pid:none) Thermosipho melanesiensis BI429,... 179 3e-43
CR522870_1614(CR522870|pid:none) Desulfotalea psychrophila LSv54... 178 6e-43
CP000716_1508(CP000716|pid:none) Thermosipho melanesiensis BI429... 176 2e-42
CP001087_3257(CP001087|pid:none) Desulfobacterium autotrophicum ... 169 2e-40
CP000859_1510(CP000859|pid:none) Desulfococcus oleovorans Hxd3, ... 167 9e-40
AM180252_200(AM180252|pid:none) Lawsonia intracellularis PHE/MN1... 164 7e-39
CP000112_174(CP000112|pid:none) Desulfovibrio desulfuricans G20,... 164 7e-39
CP001197_1923(CP001197|pid:none) Desulfovibrio vulgaris str. 'Mi... 162 4e-38
AB183832_1(AB183832|pid:none) Streptococcus suis purH, sepS6, pu... 162 5e-38
AB183835_1(AB183835|pid:none) Streptococcus suis purH, sepS10A, ... 161 6e-38
AB058941_1(AB058941|pid:none) Streptococcus suis purH, ssuMA, ss... 161 6e-38
AY939844_192(AY939844|pid:none) Cyanophage P-SSM2, complete geno... 161 6e-38
AB183836_1(AB183836|pid:none) Streptococcus suis purH, purD gene... 161 8e-38
AB183847_1(AB183847|pid:none) Streptococcus suis purH, purD gene... 160 1e-37
AB058945_1(AB058945|pid:none) Streptococcus suis purH, ssuMA, ss... 160 1e-37
AB183846_1(AB183846|pid:none) Streptococcus suis purH, purD gene... 160 1e-37
>AJ965256_1146(AJ965256|pid:none) Dehalococcoides sp. CBDB1 complete
genome.
Length = 513
Score = 509 bits (1311), Expect = e-142
Identities = 277/549 (50%), Positives = 361/549 (65%), Gaps = 7/549 (1%)
Frame = +1
Query: 22 MQALLSVYNKSGIVEFSKILSSKGFNLISTGGTAKSLVDNGLKVQQVSDVTEYPEMLDGR 201
M+A+LSV +K+G++EF++ LS GF++ STGGT KSL + V +SD+T+ PE+LDGR
Sbjct: 1 MRAILSVSDKTGLIEFARGLSELGFDIYSTGGTKKSLQQANVTVHSISDMTDSPEILDGR 60
Query: 202 VKTLHPKIHGGLLARPELAHHQADLNKYNIKPISIVVVNLYPFVETVSKESTTLEEAIEN 381
VKTLHPK+HGG+LAR +L H A+L KYNI+PI +VVVNLYPFV+TVS+ +L +A+EN
Sbjct: 61 VKTLHPKVHGGILARRDLPEHMAELEKYNIQPIDMVVVNLYPFVKTVSRPDVSLTDALEN 120
Query: 382 IDIGGHTLIRASSKNFQNVLIIVDPSDYKWIGERIQSSTDSTNVLSSITLEERKKLALKA 561
IDIGG T+IRAS+KNF +V ++VDP DY + E +++ T ++L+ERKKLA KA
Sbjct: 121 IDIGGPTMIRASAKNFPSVTVVVDPQDYPRVLEHLKTGT--------LSLDERKKLAQKA 172
Query: 562 FQHGCSYDAAVSQYLSKVELTNATTIQGVKGTDSASVNVEFPQTFLPLYEKKNDLRYGEN 741
FQH YD A+SQYL QG +G FP+ K+ DLRYGEN
Sbjct: 173 FQHVAMYDTAISQYL----------WQGEEG---------FPENMTIALSKRYDLRYGEN 213
Query: 742 PHQKAALYQCPGTG-----GIANAQLLHGPALSYNNILDGDAALKAVREFDRCACVVIKH 906
PHQ A Y G GI AQ G LS+NNILD DAA A +F ++KH
Sbjct: 214 PHQPAVFYAENRVGHGQNTGITWAQQAWGKQLSFNNILDADAAWGAATDFSAATVAIVKH 273
Query: 907 TNPCGLSVGVNDSEQAEVYKRAFNGDPKSAYGGILGFNRTLTLETATALKSVFYEVIIAP 1086
TN CGL + + AE YKRAF+GDP SAYGGI+ NR +TL A A+K FYE+IIAP
Sbjct: 274 TNTCGL---CSREDVAEAYKRAFSGDPVSAYGGIVASNRKVTLSMAEAMKGTFYEIIIAP 330
Query: 1087 DYTEDALALLSKKEKLRIL--RIPEAANQIQFTQPDIRTITGGALLQSPNPIIRGDLAEA 1260
+Y +AL L ++ LRIL +P+ N+ + D R + GG L+Q+ + +LAE
Sbjct: 331 EYEPEALEFLKTRKDLRILIAELPK-HNEAETRSLDYRRVKGGLLVQAAD-----ELAEN 384
Query: 1261 TKNWKVVTENKPTEQQMKDLLFAWRVSKHVKSNAIVLSKDETIVAIGAGQPNRSQSVDIC 1440
KVVT+ +PT ++M DL FAWR KH+KSNAIVL+K+ ++ +GAGQPNR SVDI
Sbjct: 385 AVQTKVVTKREPTPEEMSDLKFAWRAVKHIKSNAIVLAKNNVLLGMGAGQPNRVVSVDIA 444
Query: 1441 MKVGGDKVKGSVLASDAFFPFADSIDLAHQGNIACIVQPGGSIRDQEVIDAANKYGIPMV 1620
G+ KGSV+ASDA FPF DS++ A + I+QPGGSIRDQE IDAANK+ I MV
Sbjct: 445 KSKAGEASKGSVMASDAMFPFPDSVEQAAAAGVTAIIQPGGSIRDQESIDAANKHNIAMV 504
Query: 1621 FTGNRNFLH 1647
FTG R+F H
Sbjct: 505 FTGTRHFRH 513
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3236559
Number of Hits to DB: 2,886,347,397
Number of extensions: 60126575
Number of successful extensions: 178897
Number of sequences better than 10.0: 629
Number of HSP's gapped: 175426
Number of HSP's successfully gapped: 690
Length of query: 584
Length of database: 1,051,180,864
Length adjustment: 134
Effective length of query: 450
Effective length of database: 617,481,958
Effective search space: 277866881100
Effective search space used: 277866881100
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 32 (16.9 bits)
|
| PSORT |
|
| VS (DIR, S) |
3 |
| VH (FL, L) |
0 |
| VF (FL, S) |
13 |
| AH (FL, L) |
0 |
| AF (FL, S) |
12 |
| SL (DIR, L) |
1 |
| SS (DIR, S) |
1 |
| SH (FL, L) |
0 |
| SF (FL, S) |
10 |
| CH (FL, L) |
7 |
| CF (FL, S) |
9 |
| FCL (DIR, L) |
0 |
| FC (DIR, S) |
0 |
| FC-IC (SUB) |
0 |