| Contig-U14936-1 |
| Contig ID |
Contig-U14936-1 |
| Contig update |
2004. 6.11 |
| Contig sequence |
 |
| Gap |
no gap |
| Contig length |
1461 |
| Chromosome number (1..6, M) |
4 |
| Chromosome length |
5430582 |
| Start point |
2093959 |
| End point |
2095412 |
| Strand (PLUS/MINUS) |
PLUS |
| Number of clones |
20 |
| Number of EST |
36 |
| Link to clone list |
U14936 |
| List of clone(s) |
est1=SFH896F,-14,553
est2=SFG752F,-1,592
est3=AFD486F,1,652
est4=AFF873F,1,567
est5=AFJ409F,1,534
est6=AFN612F,1,624
est7=SFJ688F,1,592
est8=VFA243F,1,627
est9=AFF540F,4,593
est10=VFM122F,4,593
est11=AFD621F,7,663
est12=AFF137F,7,601
est13=AFF518F,7,593
est14=AFI581F,7,590
est15=SFC417F,7,565
est16=AFE753F,25,612
est17=FCL-AA21F,43,562
est18=AFA725F,172,402
est19=AFJ409Z,606,1326
est20=AFI581Z,611,1368
est21=AFD486Z,617,1369
est22=AFN612Z,631,1368
est23=VFA243Z,649,1325
est24=SFC417Z,707,1380
est25=AFF137Z,708,1350
est26=SFG752Z,712,1350
est27=AFE753Z,713,1382
est28=VFM122Z,717,1367
est29=SFJ688Z,868,1410
est30=AFD621Z,869,1356
est31=AFF873Z,878,1425
est32=AFF518Z,1004,1353
est33=AFF540Z,1053,1367
est34=SFH896Z,1067,1368
est35=SLF232E,1073,1418
est36=FCL-AA21Z,1107,1461
|
| Translated Amino Acid sequence |
|
| Translated Amino Acid sequence (All Frames) |
|
| own update |
2004. 6.23 |
| Homology vs CSM-cDNA |
|
| dna update |
2009. 1. 5 |
| Homology vs DNA |
Query= Contig-U14936-1 (Contig-U14936-1Q) /CSM_Contig/Contig-U14936-1Q.Seq.d
(1461 letters)
Database: ddbj_A
92,845,959 sequences; 95,242,211,685 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value N
(BJ344360) Dictyostelium discoideum cDNA clone:dda19b04, 3' ... 1364 0.0 1
(BJ344195) Dictyostelium discoideum cDNA clone:dda18a21, 3' ... 1354 0.0 1
(BJ341721) Dictyostelium discoideum cDNA clone:dda7l22, 3' e... 1334 0.0 1
(BJ345561) Dictyostelium discoideum cDNA clone:dda28g04, 3' ... 1314 0.0 1
(BJ428804) Dictyostelium discoideum cDNA clone:ddv1e12, 3' e... 1277 0.0 1
(BJ399238) Dictyostelium discoideum cDNA clone:dds5b06, 3' e... 1162 0.0 1
(BJ340026) Dictyostelium discoideum cDNA clone:dda11i09, 3' ... 1154 0.0 1
(BJ400741) Dictyostelium discoideum cDNA clone:dds14h13, 3' ... 1152 0.0 1
(BJ339842) Dictyostelium discoideum cDNA clone:dda10j13, 3' ... 1144 0.0 1
(BJ434843) Dictyostelium discoideum cDNA clone:ddv25k05, 3' ... 1142 0.0 1
(BJ324805) Dictyostelium discoideum cDNA clone:dda8i06, 5' e... 821 0.0 2
(BJ324767) Dictyostelium discoideum cDNA clone:dda7l22, 5' e... 799 0.0 3
(BJ328412) Dictyostelium discoideum cDNA clone:dda28g04, 5' ... 743 0.0 3
(BJ410639) Dictyostelium discoideum cDNA clone:ddv1e12, 5' e... 743 0.0 3
(BJ323444) Dictyostelium discoideum cDNA clone:dda10j13, 5' ... 720 0.0 2
(BJ323602) Dictyostelium discoideum cDNA clone:dda11i09, 5' ... 690 0.0 2
(BJ416158) Dictyostelium discoideum cDNA clone:ddv25k05, 5' ... 684 0.0 2
(BJ390034) Dictyostelium discoideum cDNA clone:dds20o22, 5' ... 678 0.0 3
(BJ391000) Dictyostelium discoideum cDNA clone:dds14h13, 5' ... 678 0.0 3
(BJ323828) Dictyostelium discoideum cDNA clone:dda12o09, 5' ... 682 0.0 2
(BJ323736) Dictyostelium discoideum cDNA clone:dda12c05, 5' ... 682 0.0 2
(BJ326981) Dictyostelium discoideum cDNA clone:dda18a21, 5' ... 613 0.0 3
(BJ323891) Dictyostelium discoideum cDNA clone:dda12b20, 5' ... 630 0.0 3
(C23814) Dictyostelium discoideum gamete cDNA, clone FCL-AA21. 622 0.0 2
(BJ402244) Dictyostelium discoideum cDNA clone:dds20o22, 3' ... 765 0.0 1
(BJ387788) Dictyostelium discoideum cDNA clone:dds5b06, 5' e... 531 0.0 3
(BJ388975) Dictyostelium discoideum cDNA clone:dds16p24, 5' ... 593 0.0 3
(BJ341774) Dictyostelium discoideum cDNA clone:dda8i06, 3' e... 741 0.0 1
(BJ340359) Dictyostelium discoideum cDNA clone:dda12b20, 3' ... 733 0.0 1
(BJ327064) Dictyostelium discoideum cDNA clone:dda19b04, 5' ... 567 0.0 3
(BJ340186) Dictyostelium discoideum cDNA clone:dda12c05, 3' ... 575 e-159 1
(AU052866) Dictyostelium discoideum slug cDNA, clone SLF232. 436 e-117 1
(C23813) Dictyostelium discoideum gamete cDNA, clone FCL-AA21. 351 2e-92 2
(BJ325780) Dictyostelium discoideum cDNA clone:dda2b07, 5' e... 236 8e-84 3
(BJ340285) Dictyostelium discoideum cDNA clone:dda12o09, 3' ... 321 4e-83 1
(EH431783) NPE00000958 Neocallimastix patriciarum ZAP II cDN... 153 2e-69 6
(BJ402450) Dictyostelium discoideum cDNA clone:dds16p24, 3' ... 240 1e-58 1
(CZ530974) SRAA-aac70c02.b1 Strongyloides ratti whole genome... 62 4e-54 9
(CV830036) ID0ACC14BF09RM1 ID0ACC Acyrthosiphon pisum cDNA c... 176 1e-53 3
(FD464959) LARW880TF Haematobia irritans 1st Instar Larvae H... 121 3e-53 7
(CZ529861) SRAA-aac63e07.b1 Strongyloides ratti whole genome... 62 3e-52 8
(CN754800) ID0AAA14AC02RM1 ApMS Acyrthosiphon pisum cDNA clo... 170 6e-52 3
(AK230924) Sus scrofa mRNA, clone:AMP010065E12, expressed in... 82 2e-49 10
(EH431611) NPE00000611 Neocallimastix patriciarum ZAP II cDN... 133 2e-49 5
(AY609771) Sus scrofa clone Clu_3050.scr.msk.p1.Contig3, mRN... 82 2e-48 10
(AJ808091) Antirrhinum majus EST, clone 018_6_08_k11. 100 3e-47 6
(FC814299) Sr_pASP6_017h01_SP6 S. ratti mixed stage pAMP Str... 58 5e-47 8
(AK230783) Sus scrofa mRNA, clone:AMP010042G01, expressed in... 54 1e-46 10
(FC742575) CBBI13162.rev CBBI Lottia gigantea 26h,37h,61h La... 94 1e-46 6
(FC707298) CAXY4611.rev CAXY Lottia gigantea from male gonad... 94 2e-46 6
(ES731865) Nad03b_35_F03_C005.g1 Nuphar advena flower bud li... 90 3e-46 4
(FE232861) CAPG1976.rev CAPG Naegleria gruberi amoeba stage ... 115 5e-46 5
(ES598978) F06E17 Bee Brain Normalized Library, BB16 Apis me... 82 7e-46 7
(ES598988) W07E16 Bee Brain Normalized Library, BB16 Apis me... 82 7e-46 7
(EE264113) E10_E10gf4k19_pDNRf_505856 Myzus persicae, line G... 98 3e-45 3
(EL369068) CCES5147.b1_F15.ab1 CCE(LMS) endive Cichorium end... 74 4e-45 6
(FC749321) CBBI4451.rev CBBI Lottia gigantea 26h,37h,61h Lar... 94 6e-45 6
(FC733139) CBBG7692.rev CBBG Lottia gigantea 12,15,18h embry... 94 6e-45 6
(FD466163) LARWG44TF Haematobia irritans 1st Instar Larvae H... 121 2e-44 7
(BT007531) Synthetic construct Homo sapiens proteasome (pros... 64 2e-44 11
(AY892558) Synthetic construct Homo sapiens clone FLH013619.... 64 2e-44 11
(AY890076) Synthetic construct Homo sapiens clone FLH013623.... 64 2e-44 11
(AY890075) Synthetic construct Homo sapiens clone FLH013622.... 64 2e-44 11
(CR456709) Homo sapiens full open reading frame cDNA clone R... 64 2e-44 11
(BT006843) Homo sapiens proteasome (prosome, macropain) 26S ... 64 2e-44 11
(AK313670) Homo sapiens cDNA, FLJ94253, Homo sapiens proteas... 64 3e-44 11
(DQ893704) Synthetic construct Homo sapiens clone IMAGE:1000... 64 3e-44 11
(AY814317) Schistosoma japonicum SJCHGC06030 protein mRNA, p... 100 6e-44 7
(FC750953) CBBI5457.rev CBBI Lottia gigantea 26h,37h,61h Lar... 94 8e-44 6
(CR611308) full-length cDNA clone CS0DE005YE03 of Placenta o... 64 2e-43 11
(CR622035) full-length cDNA clone CS0DA002YJ02 of Neuroblast... 64 2e-43 11
(CR595318) full-length cDNA clone CS0DI061YK22 of Placenta C... 64 3e-43 11
(CR624028) full-length cDNA clone CS0DE008YC13 of Placenta o... 64 3e-43 11
(CR615895) full-length cDNA clone CS0DI024YJ06 of Placenta C... 64 3e-43 11
(CR623246) full-length cDNA clone CS0DI074YH03 of Placenta C... 64 3e-43 11
(CR602871) full-length cDNA clone CS0DI005YB20 of Placenta C... 64 3e-43 11
(CR590720) full-length cDNA clone CS0DI025YI08 of Placenta C... 64 3e-43 11
(CR608774) full-length cDNA clone CS0DI016YM01 of Placenta C... 64 3e-43 11
(DQ051216) Homo sapiens HC19260 gene, VIRTUAL TRANSCRIPT, pa... 64 3e-43 11
(CR621047) full-length cDNA clone CS0DI018YK19 of Placenta C... 64 3e-43 11
(AF006305) Homo sapiens 26S proteasome regulatory subunit (S... 64 4e-43 11
(DJ033368) BIOMARKERS OF CYCLIN-DEPENDENT KINASE MODULATION. 64 4e-43 11
(BC005390) Homo sapiens proteasome (prosome, macropain) 26S ... 64 4e-43 11
(CR617697) full-length cDNA clone CS0DL004YH06 of B cells (R... 64 6e-43 11
(EW555030) rsin07_o21.y1 sin Sus scrofa cDNA 5', mRNA sequence. 82 1e-42 8
(EW664724) rtra30_n7r1.y1 tra Sus scrofa cDNA 5', mRNA seque... 82 1e-42 8
(FC815134) Sr_pAMT7_02c14_T7 S. ratti mixed stage pAMP Stron... 62 3e-42 7
(E14360) Human mRNA for p42 protein involved in 26S proteaso... 64 4e-42 11
(DD363481) Human gene. 64 4e-42 11
(DD029102) A method of treating prostate cancer. 64 4e-42 11
(CQ840919) Sequence 14 from Patent EP1439230. 64 4e-42 11
(BD137523) Human gene. 64 4e-42 11
(AR367816) Sequence 14 from patent US 6376189. 64 4e-42 11
(AR317295) Sequence 14 from patent US 6562947. 64 4e-42 11
(AR096087) Sequence 14 from patent US 6005088. 64 4e-42 11
(AR052514) Sequence 14 from patent US 5831058. 64 4e-42 11
(CQ729537) Sequence 15471 from Patent WO02068579. 64 4e-42 11
(CU353019) Aphanomyces euteiches cDNA. 151 1e-41 3
(EV843529) TT1EV03TV Tetrahymena thermophila SB210 cDNA libr... 86 2e-41 5
(EW328200) rpliv0115_p18.y1 liv Sus scrofa cDNA 5', mRNA seq... 82 3e-41 7
>(BJ344360) Dictyostelium discoideum cDNA clone:dda19b04, 3' end,
single read.
Length = 721
Score = 1364 bits (688), Expect = 0.0
Identities = 688/688 (100%)
Strand = Plus / Minus
Query: 605 cgtgttggtattaaagcaccaaagggtgtattattgtatggtccaccaggtactggtaag 664
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 721 cgtgttggtattaaagcaccaaagggtgtattattgtatggtccaccaggtactggtaag 662
Query: 665 acattgttagctcgtgctatcgcatcaaatttagaggcaaatttcttaaaggttgtttca 724
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 661 acattgttagctcgtgctatcgcatcaaatttagaggcaaatttcttaaaggttgtttca 602
Query: 725 tctgcaatcgttgataaatacattggtgagagtgctcgtgtaattcgtgagatgtttggt 784
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 601 tctgcaatcgttgataaatacattggtgagagtgctcgtgtaattcgtgagatgtttggt 542
Query: 785 tatgctcgtgatcatcaaccatgtgtgatctttatggatgaaatcgatgcaattggtggt 844
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 541 tatgctcgtgatcatcaaccatgtgtgatctttatggatgaaatcgatgcaattggtggt 482
Query: 845 agacgtttctcagagggtacttctgcagatcgtgaaattcaaagaacactcatggaatta 904
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 481 agacgtttctcagagggtacttctgcagatcgtgaaattcaaagaacactcatggaatta 422
Query: 905 ttaaatcaaatggatggtttcgatactctctcaaaggttaaaatcatcatggctacaaat 964
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 421 ttaaatcaaatggatggtttcgatactctctcaaaggttaaaatcatcatggctacaaat 362
Query: 965 cgtcctgatgttttagatcctgccctccttcgtccaggtcgtttagatagaaaaatagaa 1024
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 361 cgtcctgatgttttagatcctgccctccttcgtccaggtcgtttagatagaaaaatagaa 302
Query: 1025 attcctttaccaaatgaagctggtcgtgtcgatgttcttaaaattcatgctgcaaatatc 1084
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 301 attcctttaccaaatgaagctggtcgtgtcgatgttcttaaaattcatgctgcaaatatc 242
Query: 1085 accaaacatggtgatgtagattatgaagctatcgctaaattagctgatggtttcaatgct 1144
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 241 accaaacatggtgatgtagattatgaagctatcgctaaattagctgatggtttcaatgct 182
Query: 1145 gctgatttacgtaatgtatgtactgaagctggtatgtttgcaattagagctgaaagagat 1204
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 181 gctgatttacgtaatgtatgtactgaagctggtatgtttgcaattagagctgaaagagat 122
Query: 1205 tatgtaatggaagaagactttatgaaagctgttagaaaatgtcaagaagcaaagaaatta 1264
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 121 tatgtaatggaagaagactttatgaaagctgttagaaaatgtcaagaagcaaagaaatta 62
Query: 1265 gaaggtaaactcgattatcaaaaagttt 1292
||||||||||||||||||||||||||||
Sbjct: 61 gaaggtaaactcgattatcaaaaagttt 34
Lambda K H
1.37 0.711 1.31
Matrix: blastn matrix:1 -3
Number of Sequences: 92845959
Number of Hits to DB: 1,288,658,917
Number of extensions: 71997915
Number of successful extensions: 5530288
Number of sequences better than 10.0: 5160
Length of query: 1461
Length of database: 95,242,211,685
Length adjustment: 24
Effective length of query: 1437
Effective length of database: 97,308,875,965
Effective search space: 139832854761705
Effective search space used: 139832854761705
X1: 11 (21.8 bits)
S2: 22 (44.1 bits)
|
| protein update |
2009. 7.13 |
| Homology vs Protein |
Query= Contig-U14936-1 (Contig-U14936-1Q) /CSM_Contig/Contig-U14936-1Q.Seq.d
(1461 letters)
Database: nrp_B
3,236,559 sequences; 1,051,180,864 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
EF676776_1(EF676776|pid:none) Picea sitchensis clone WS02751_M22... 552 e-155
FB781814_1(FB781814|pid:none) Sequence 1087 from Patent WO200803... 551 e-155
FB781812_1(FB781812|pid:none) Sequence 1085 from Patent WO200803... 550 e-155
EF146866_1(EF146866|pid:none) Populus trichocarpa clone WS0121_F... 550 e-155
BC064227_1(BC064227|pid:none) Xenopus tropicalis proteasome (pro... 550 e-155
AY241962_1(AY241962|pid:none) Dermacentor variabilis 26S proteas... 549 e-155
AM424422_1(AM424422|pid:none) Vitis vinifera contig VV78X256011.... 549 e-155
BT077925_1(BT077925|pid:none) Lepeophtheirus salmonis Pacific fo... 549 e-155
BT067445_1(BT067445|pid:none) Zea mays full-length cDNA clone ZM... 549 e-155
BT040547_1(BT040547|pid:none) Zea mays full-length cDNA clone ZM... 548 e-154
AY892558_1(AY892558|pid:none) Synthetic construct Homo sapiens c... 548 e-154
BC057997_1(BC057997|pid:none) Mus musculus proteasome (prosome, ... 548 e-154
BC073644_1(BC073644|pid:none) Xenopus laevis similar to proteaso... 548 e-154
AB033536_1(AB033536|pid:none) Oryza sativa Japonica Group OsRPT4... 548 e-154
DQ440423_1(DQ440423|pid:none) Aedes aegypti clone AET-5666 26S p... 547 e-154
BT080753_1(BT080753|pid:none) Caligus clemensi clone ccle-evs-52... 546 e-154
BC097594_1(BC097594|pid:none) Xenopus laevis hypothetical protei... 546 e-154
CQ840920_1(CQ840920|pid:none) Sequence 15 from Patent EP1439230.... 546 e-154
BC107950_1(BC107950|pid:none) Rattus norvegicus proteasome (pros... 546 e-154
AC007915_8(AC007915|pid:none) Genomic sequence for Arabidopsis t... 546 e-154
BT083190_1(BT083190|pid:none) Anoplopoma fimbria clone afim-evh-... 545 e-153
FB781856_1(FB781856|pid:none) Sequence 1129 from Patent WO200803... 543 e-153
AK014354_1(AK014354|pid:none) Mus musculus 17 days embryo head c... 543 e-153
AK063158_1(AK063158|pid:none) Oryza sativa Japonica Group cDNA c... 543 e-153
BT043940_1(BT043940|pid:none) Salmo salar clone HM4_1948 proteas... 543 e-153
AE014298_899(AE014298|pid:none) Drosophila melanogaster chromoso... 542 e-152
BT081387_1(BT081387|pid:none) Drosophila melanogaster LP16188 fu... 542 e-152
BT079180_1(BT079180|pid:none) Esox lucius clone eluc-evq-511-062... 541 e-152
DQ443392_1(DQ443392|pid:none) Bombyx mori 26S proteasome regulat... 539 e-152
AY071182_1(AY071182|pid:none) Drosophila melanogaster RE23388 fu... 539 e-151
BT079937_1(BT079937|pid:none) Esox lucius clone eluc-evq-527-020... 538 e-151
AJ223384_1(AJ223384|pid:none) Manduca sexta mRNA for 26S proteas... 538 e-151
AY814317_1(AY814317|pid:none) Schistosoma japonicum SJCHGC06030 ... 537 e-151
AB070254_1(AB070254|pid:none) Oryza sativa Japonica Group OsRPT4... 536 e-151
CU633899_420(CU633899|pid:none) Podospora anserina genomic DNA c... 533 e-150
CP000583_331(CP000583|pid:none) Ostreococcus lucimarinus CCE9901... 526 e-147
AF024493_9(AF024493|pid:none) Caenorhabditis elegans cosmid F23F... 521 e-146
(O17071) RecName: Full=Probable 26S protease regulatory subunit ... 521 e-146
AE017350_312(AE017350|pid:none) Cryptococcus neoformans var. neo... 518 e-145
CR954203_337(CR954203|pid:none) Ostreococcus tauri strain OTTH05... 517 e-145
(O74445) RecName: Full=Probable 26S protease subunit rpt4; &CU3... 516 e-144
AP007155_52(AP007155|pid:none) Aspergillus oryzae RIB40 genomic ... 511 e-143
AY208828_1(AY208828|pid:none) Rhipicephalus appendiculatus prote... 509 e-143
FM992695_364(FM992695|pid:none) Candida dubliniensis CD36 chromo... 509 e-143
AL844509_63(AL844509|pid:none) Plasmodium falciparum 3D7 chromos... 508 e-142
FN392322_403(FN392322|pid:none) Pichia pastoris GS115 chromosome... 507 e-142
AM910996_49(AM910996|pid:none) Plasmodium knowlesi strain H chro... 505 e-141
CR382138_643(CR382138|pid:none) Debaryomyces hansenii strain CBS... 505 e-141
DQ206974_1(DQ206974|pid:none) Schistosoma mansoni 26S proteasome... 503 e-141
CR380957_379(CR380957|pid:none) Candida glabrata strain CBS138 c... 483 e-135
EZ000460_1(EZ000460|pid:none) TSA: Culex tarsalis Ctar-313 26S p... 482 e-134
AE016814_74(AE016814|pid:none) Ashbya gossypii (= Eremothecium g... 481 e-134
CU928178_509(CU928178|pid:none) Zygosaccharomyces rouxii strain ... 481 e-134
CU928168_500(CU928168|pid:none) Kluyveromyces thermotolerans str... 478 e-133
(P53549) RecName: Full=26S protease subunit RPT4; AltName: Full=... 478 e-133
BC025134_1(BC025134|pid:none) Mus musculus proteasome (prosome, ... 458 e-127
AL590447_19(AL590447|pid:none) chromosome VII of strain GB-M1 of... 451 e-125
AC125735_52(AC125735|pid:none) Leishmania major strain Friedlin ... 449 e-125
AF227502_1(AF227502|pid:none) Trypanosoma brucei proteasome regu... 444 e-123
CR940353_129(CR940353|pid:none) Theileria annulata strain Ankara... 444 e-123
CP000882_30(CP000882|pid:none) Hemiselmis andersenii chromosome ... 368 e-100
AJ010592_72(AJ010592|pid:none) Guillardia theta DNA for complete... 361 3e-98
EF103411_1(EF103411|pid:none) Haliotis discus discus psmc6 prote... 357 6e-97
CP000477_446(CP000477|pid:none) Methanosaeta thermophila PT, com... 335 2e-90
(Q8TX03) RecName: Full=Proteasome-activating nucleotidase; AltNa... 333 7e-90
(Q8U4H3) RecName: Full=Proteasome-activating nucleotidase; AltNa... 333 1e-89
(O57940) RecName: Full=Proteasome-activating nucleotidase; AltNa... 332 3e-89
(Q5JHS5) RecName: Full=Proteasome-activating nucleotidase; AltNa... 329 2e-88
(Q9V287) RecName: Full=Proteasome-activating nucleotidase; AltNa... 328 3e-88
CP000867_1013(CP000867|pid:none) Methanococcus maripaludis C6, c... 328 4e-88
(A4G0S4) RecName: Full=Proteasome-activating nucleotidase; AltNa... 327 9e-88
(Q6LWR0) RecName: Full=Proteasome-activating nucleotidase; AltNa... 326 1e-87
(A6VHR1) RecName: Full=Proteasome-activating nucleotidase; AltNa... 324 6e-87
CP000678_354(CP000678|pid:none) Methanobrevibacter smithii ATCC ... 324 6e-87
(O28303) RecName: Full=Proteasome-activating nucleotidase; AltNa... 323 1e-86
(Q8TI88) RecName: Full=Proteasome-activating nucleotidase; AltNa... 322 2e-86
AE010299_4158(AE010299|pid:none) Methanosarcina acetivorans str.... 322 2e-86
CP000099_606(CP000099|pid:none) Methanosarcina barkeri str. Fusa... 321 5e-86
FN375083_1(FN375083|pid:none) Schistosoma mansoni genome sequenc... 320 8e-86
FN320332_1(FN320332|pid:none) Schistosoma japonicum isolate Anhu... 320 1e-85
(Q8PY58) RecName: Full=Proteasome-activating nucleotidase; AltNa... 318 3e-85
DQ206972_1(DQ206972|pid:none) Schistosoma mansoni 26S proteasome... 318 3e-85
AE008384_1006(AE008384|pid:none) Methanosarcina mazei strain Goe... 318 3e-85
(A6UQT3) RecName: Full=Proteasome-activating nucleotidase; AltNa... 317 7e-85
(O18413) RecName: Full=26S protease regulatory subunit 8; &AE01... 315 3e-84
AB035272_1(AB035272|pid:none) Matricaria chamomilla McTBP1 mRNA ... 315 3e-84
AM494972_460(AM494972|pid:none) Leishmania braziliensis chromoso... 315 3e-84
AL031525_16(AL031525|pid:none) S.pombe chromosome III cosmid c16... 315 3e-84
AB033537_1(AB033537|pid:none) Oryza sativa Japonica Group OsRPT6... 314 6e-84
(Q58576) RecName: Full=Proteasome-activating nucleotidase; AltNa... 314 6e-84
FM992689_795(FM992689|pid:none) Candida dubliniensis CD36 chromo... 314 6e-84
BT054955_1(BT054955|pid:none) Zea mays full-length cDNA clone ZM... 313 8e-84
AB000493_1(AB000493|pid:none) Rattus norvegicus gene for proteas... 313 8e-84
(P62194) RecName: Full=26S protease regulatory subunit 8; AltNam... 313 8e-84
BT019726_1(BT019726|pid:none) Synthetic construct Homo sapiens p... 313 8e-84
AM502254_679(AM502254|pid:none) Leishmania infantum chromosome 36. 313 1e-83
BC078375_1(BC078375|pid:none) Danio rerio proteasome (prosome, m... 313 1e-83
U97538_1(U97538|pid:none) Drosophila melanogaster DUG mRNA, comp... 313 1e-83
EU162611_6(EU162611|pid:none) Capsella rubella clone contig46 BA... 312 2e-83
T27048(T27048) hypothetical protein Y49E10.1 - Caenorhabditis el... 312 2e-83
BT078547_1(BT078547|pid:none) Lepeophtheirus salmonis Pacific fo... 312 2e-83
AY011124_1(AY011124|pid:none) Dactylis glomerata 26S proteasome ... 312 2e-83
D44467_1(D44467|pid:none) Homo sapiens mRNA for 26S proteasome s... 312 2e-83
BT075406_1(BT075406|pid:none) Osmerus mordax clone omor-eva-504-... 311 3e-83
AB171905_1(AB171905|pid:none) Macaca fascicularis brain cDNA clo... 311 4e-83
CR859252_1(CR859252|pid:none) Pongo abelii mRNA; cDNA DKFZp469N2... 311 4e-83
AK226206_1(AK226206|pid:none) Arabidopsis thaliana mRNA for 26S ... 311 5e-83
CR382135_420(CR382135|pid:none) Debaryomyces hansenii strain CBS... 311 5e-83
FB781822_1(FB781822|pid:none) Sequence 1095 from Patent WO200803... 311 5e-83
AF123395_1(AF123395|pid:none) Arabidopsis thaliana 26S proteasom... 311 5e-83
AK010505_1(AK010505|pid:none) Mus musculus ES cells cDNA, RIKEN ... 311 5e-83
CP000743_1018(CP000743|pid:none) Methanococcus aeolicus Nankai-3... 310 9e-83
(Q0W257) RecName: Full=Proteasome-activating nucleotidase; AltNa... 309 1e-82
AE013599_464(AE013599|pid:none) Drosophila melanogaster chromoso... 309 1e-82
FM992688_493(FM992688|pid:none) Candida dubliniensis CD36 chromo... 309 2e-82
BT042644_1(BT042644|pid:none) Zea mays full-length cDNA clone ZM... 309 2e-82
AE017347_370(AE017347|pid:none) Cryptococcus neoformans var. neo... 308 2e-82
AK065619_1(AK065619|pid:none) Oryza sativa Japonica Group cDNA c... 308 2e-82
AB171188_1(AB171188|pid:none) Macaca fascicularis brain cDNA clo... 308 3e-82
L38810_1(L38810|pid:none) Homo sapiens thyroid receptor interact... 308 3e-82
EF676518_1(EF676518|pid:none) Picea sitchensis clone WS02740_E13... 307 7e-82
BC041186_1(BC041186|pid:none) Xenopus laevis proteasome 26S ATPa... 306 9e-82
FN357312_3(FN357312|pid:none) Schistosoma mansoni genome sequenc... 306 9e-82
(Q25544) RecName: Full=26S protease regulatory subunit 8 homolog... 306 9e-82
BT075118_1(BT075118|pid:none) Osmerus mordax clone omor-rgc-504-... 306 9e-82
BC053187_1(BC053187|pid:none) Danio rerio proteasome (prosome, m... 306 9e-82
AJ719466_1(AJ719466|pid:none) Gallus gallus mRNA for hypothetica... 306 9e-82
(P35998) RecName: Full=26S protease regulatory subunit 7; AltNam... 306 9e-82
AY243360_1(AY243360|pid:none) Lactuca sativa clone 2 26S proteas... 306 9e-82
EU446703_1(EU446703|pid:none) Synthetic construct Homo sapiens c... 306 9e-82
AY814884_1(AY814884|pid:none) Schistosoma japonicum SJCHGC09284 ... 306 9e-82
AC093701_1(AC093701|pid:none) Homo sapiens BAC clone RP11-1252L1... 306 9e-82
AB075520_1(AB075520|pid:none) Homo sapiens neuroblastoma cDNA, c... 306 9e-82
CP001140_1265(CP001140|pid:none) Desulfurococcus kamchatkensis 1... 306 2e-81
(O64982) RecName: Full=26S protease regulatory subunit 7; AltNam... 306 2e-81
AK298821_1(AK298821|pid:none) Homo sapiens cDNA FLJ52353 complet... 306 2e-81
CR382130_688(CR382130|pid:none) Yarrowia lipolytica strain CLIB1... 305 2e-81
(Q63347) RecName: Full=26S protease regulatory subunit 7; AltNam... 305 2e-81
BC061542_1(BC061542|pid:none) Rattus norvegicus proteasome (pros... 305 2e-81
CU633898_26(CU633898|pid:none) Podospora anserina genomic DNA ch... 305 3e-81
FN314957_1(FN314957|pid:none) Schistosoma japonicum isolate Anhu... 305 3e-81
CR382137_302(CR382137|pid:none) Debaryomyces hansenii strain CBS... 305 4e-81
AF099922_3(AF099922|pid:none) Caenorhabditis elegans cosmid F56F... 305 4e-81
AF099922_2(AF099922|pid:none) Caenorhabditis elegans cosmid F56F... 305 4e-81
CP000575_899(CP000575|pid:none) Staphylothermus marinus F1, comp... 305 4e-81
DQ202365_1(DQ202365|pid:none) Schistosoma mansoni 26S proteasome... 304 5e-81
AP007172_18(AP007172|pid:none) Aspergillus oryzae RIB40 genomic ... 304 5e-81
FN314955_1(FN314955|pid:none) Schistosoma japonicum isolate Anhu... 304 5e-81
AY750867_1(AY750867|pid:none) Toxoptera citricida 26S protease r... 304 5e-81
BC080137_1(BC080137|pid:none) Xenopus tropicalis 26S protease re... 303 8e-81
AE014297_4820(AE014297|pid:none) Drosophila melanogaster chromos... 303 8e-81
AP007167_353(AP007167|pid:none) Aspergillus oryzae RIB40 genomic... 303 1e-80
AM270035_12(AM270035|pid:none) Aspergillus niger contig An02c041... 303 1e-80
CP001399_1810(CP001399|pid:none) Sulfolobus islandicus L.S.2.15,... 303 1e-80
AE017350_96(AE017350|pid:none) Cryptococcus neoformans var. neof... 302 2e-80
T49507(T49507)probable 26S proteasome regulatory particle chain ... 302 2e-80
T39558(T39558)26S proteinase regulatory subunit 7 - fission yeas... 302 2e-80
AL590451_186(AL590451|pid:none) chromosome IX of strain GB-M1 of... 302 2e-80
CR382130_469(CR382130|pid:none) Yarrowia lipolytica strain CLIB1... 301 4e-80
BX538350_38(BX538350|pid:none) Cryptosporidium parvum chromosome... 301 5e-80
CR380951_271(CR380951|pid:none) Candida glabrata strain CBS138 c... 300 7e-80
(Q9YAC7) RecName: Full=Proteasome-activating nucleotidase; AltNa... 300 7e-80
(Q86JA1) RecName: Full=26S protease regulatory subunit 7; AltNam... 300 7e-80
CP000300_1963(CP000300|pid:none) Methanococcoides burtonii DSM 6... 300 1e-79
CP000102_1167(CP000102|pid:none) Methanosphaera stadtmanae DSM 3... 299 2e-79
BX538352_118(BX538352|pid:none) Cryptosporidium parvum chromosom... 299 2e-79
AY229998_1(AY229998|pid:none) Sulfolobus acidocaldarius strain D... 298 3e-79
CR954203_112(CR954203|pid:none) Ostreococcus tauri strain OTTH05... 298 3e-79
(Q975U2) RecName: Full=Proteasome-activating nucleotidase; AltNa... 298 3e-79
(Q01939) RecName: Full=26S protease regulatory subunit 8 homolog... 297 6e-79
(P34124) RecName: Full=26S protease regulatory subunit 8; AltNam... 297 6e-79
BT077020_1(BT077020|pid:none) Caligus rogercresseyi clone crog-e... 297 7e-79
CP001325_312(CP001325|pid:none) Micromonas sp. RCC299 chromosome... 297 7e-79
X66400_1(X66400|pid:none) S.cerevisiae SUG1 gene. 296 1e-78
EF678275_1(EF678275|pid:none) Picea sitchensis clone WS02911_P12... 295 2e-78
(Q2FQ56) RecName: Full=Proteasome-activating nucleotidase; AltNa... 295 2e-78
DQ864866_1(DQ864866|pid:none) Pfiesteria piscicida clone ppi-5p-... 295 3e-78
CP000816_585(CP000816|pid:none) Ignicoccus hospitalis KIN4/I, co... 294 5e-78
AE014185_79(AE014185|pid:none) Plasmodium falciparum 3D7 chromos... 294 6e-78
BT075424_1(BT075424|pid:none) Osmerus mordax clone omor-eva-511-... 294 6e-78
CU928179_930(CU928179|pid:none) Zygosaccharomyces rouxii strain ... 293 8e-78
BC060362_1(BC060362|pid:none) Xenopus laevis proteasome 26S ATPa... 293 8e-78
CP000493_1096(CP000493|pid:none) Hyperthermus butylicus DSM 5456... 293 1e-77
(P46502) RecName: Full=Probable 26S protease regulatory subunit ... 293 1e-77
AL844509_114(AL844509|pid:none) Plasmodium falciparum 3D7 chromo... 293 1e-77
AJ010592_143(AJ010592|pid:none) Guillardia theta DNA for complet... 292 2e-77
AC006081_7(AC006081|pid:none) Arabidopsis thaliana chromosome 2 ... 292 2e-77
AF123391_1(AF123391|pid:none) Arabidopsis thaliana 26S proteasom... 292 2e-77
AC159413_35(AC159413|pid:none) Trypanosoma brucei chromosome 7 c... 292 2e-77
AB161192_1(AB161192|pid:none) Arabidopsis thaliana HLR mRNA for ... 292 2e-77
AM502240_55(AM502240|pid:none) Leishmania infantum chromosome 22. 292 2e-77
CT005261_55(CT005261|pid:none) Leishmania major strain Friedlin,... 292 2e-77
(P62191) RecName: Full=26S protease regulatory subunit 4; AltNam... 291 3e-77
AK222668_1(AK222668|pid:none) Homo sapiens mRNA for proteasome 2... 291 3e-77
AM494959_52(AM494959|pid:none) Leishmania braziliensis chromosom... 291 3e-77
BT020983_1(BT020983|pid:none) Bos taurus proteasome (prosome, ma... 291 3e-77
DQ443126_1(DQ443126|pid:none) Bombyx mori 26S protease regulator... 291 3e-77
A44468(A44468;B44468)26S proteasome regulatory chain 4 [validate... 291 3e-77
AL954724_8(AL954724|pid:none) Zebrafish DNA sequence from clone ... 291 4e-77
EF147477_1(EF147477|pid:none) Populus trichocarpa clone WS01231_... 291 4e-77
(Q90732) RecName: Full=26S protease regulatory subunit 4; AltNam... 291 4e-77
AF035309_1(AF035309|pid:none) Homo sapiens clone 23598 mRNA, com... 291 4e-77
(P46507) RecName: Full=26S protease regulatory subunit 6B; AltNa... 291 4e-77
AB037154_1(AB037154|pid:none) Oryza sativa Japonica Group OsRPT2... 291 5e-77
FB781850_1(FB781850|pid:none) Sequence 1123 from Patent WO200803... 290 7e-77
AY891401_1(AY891401|pid:none) Synthetic construct Homo sapiens c... 290 7e-77
AE014298_1620(AE014298|pid:none) Drosophila melanogaster chromos... 290 7e-77
BC067741_1(BC067741|pid:none) Homo sapiens proteasome (prosome, ... 290 7e-77
AC150776_3(AC150776|pid:none) Medicago truncatula chromosome 7 c... 290 9e-77
AL049728_1(AL049728|pid:none) S.pombe chromosome III cosmid c306... 290 9e-77
(P43686) RecName: Full=26S protease regulatory subunit 6B; AltNa... 290 9e-77
(Q63570) RecName: Full=26S protease regulatory subunit 6B; AltNa... 290 9e-77
AY087584_1(AY087584|pid:none) Arabidopsis thaliana clone 36815 m... 290 1e-76
CP000682_2236(CP000682|pid:none) Metallosphaera sedula DSM 5348,... 290 1e-76
AL935145_2(AL935145|pid:none) Zebrafish DNA sequence from clone ... 290 1e-76
BT054998_1(BT054998|pid:none) Zea mays full-length cDNA clone ZM... 290 1e-76
BT062241_1(BT062241|pid:none) Zea mays full-length cDNA clone ZM... 290 1e-76
BT078140_1(BT078140|pid:none) Lepeophtheirus salmonis Pacific fo... 290 1e-76
AK050677_1(AK050677|pid:none) Mus musculus 9 days embryo whole b... 290 1e-76
BC080888_1(BC080888|pid:none) Xenopus tropicalis proteasome (pro... 289 2e-76
AB070253_1(AB070253|pid:none) Oryza sativa Japonica Group OsRPT3... 289 2e-76
AK071476_1(AK071476|pid:none) Oryza sativa Japonica Group cDNA c... 289 2e-76
D17789_1(D17789|pid:none) Oryza sativa Japonica Group mRNA for h... 289 2e-76
(P46466) RecName: Full=26S protease regulatory subunit 4 homolog... 289 2e-76
EF148658_1(EF148658|pid:none) Populus trichocarpa x Populus delt... 288 3e-76
BC055215_1(BC055215|pid:none) Danio rerio proteasome (prosome, m... 288 3e-76
FN357538_19(FN357538|pid:none) Schistosoma mansoni genome sequen... 288 3e-76
(Q8SQI9) RecName: Full=26S protease regulatory subunit 6B homolo... 288 5e-76
CP000883_64(CP000883|pid:none) Hemiselmis andersenii chromosome ... 288 5e-76
AK160644_1(AK160644|pid:none) Mus musculus 10, 11 days embryo wh... 288 5e-76
AM920437_1474(AM920437|pid:none) Penicillium chrysogenum Wiscons... 288 5e-76
FB781798_1(FB781798|pid:none) Sequence 1071 from Patent WO200803... 287 8e-76
(P54778) RecName: Full=26S protease regulatory subunit 6B homolo... 287 8e-76
BT043952_1(BT043952|pid:none) Salmo salar clone HM4_3128 proteas... 287 8e-76
AB169562_1(AB169562|pid:none) Macaca fascicularis brain cDNA, cl... 286 1e-75
AF020736_1(AF020736|pid:none) Homo sapiens ATPase homolog mRNA, ... 286 1e-75
EU959285_1(EU959285|pid:none) Zea mays clone 214269 26S protease... 286 1e-75
BT016035_1(BT016035|pid:none) Drosophila melanogaster RE01104 fu... 286 1e-75
BC154336_1(BC154336|pid:none) Danio rerio proteasome (prosome, m... 286 1e-75
BC049471_1(BC049471|pid:none) Danio rerio proteasome (prosome, m... 286 1e-75
AF432345_1(AF432345|pid:none) Tortula ruralis 26S proteasome reg... 286 2e-75
DQ440313_1(DQ440313|pid:none) Aedes aegypti clone AET-397 26S pr... 286 2e-75
FN318152_1(FN318152|pid:none) Schistosoma japonicum isolate Anhu... 285 2e-75
BT076124_1(BT076124|pid:none) Caligus rogercresseyi clone crog-e... 285 2e-75
BC054287_1(BC054287|pid:none) Xenopus laevis protease (prosome, ... 285 2e-75
AE017342_397(AE017342|pid:none) Cryptococcus neoformans var. neo... 285 2e-75
AF227504_1(AF227504|pid:none) Trypanosoma brucei proteasome regu... 285 3e-75
CP001325_99(CP001325|pid:none) Micromonas sp. RCC299 chromosome ... 285 4e-75
CP000559_1165(CP000559|pid:none) Methanocorpusculum labreanum Z,... 285 4e-75
(P48601) RecName: Full=26S protease regulatory subunit 4; AltNam... 284 5e-75
AM270384_3(AM270384|pid:none) Aspergillus niger contig An17c0020... 284 5e-75
(P54775) RecName: Full=26S protease regulatory subunit 6B; AltNa... 283 1e-74
CP001326_453(CP001326|pid:none) Micromonas sp. RCC299 chromosome... 282 2e-74
BT073386_1(BT073386|pid:none) Oncorhynchus mykiss clone omyk-evn... 282 2e-74
FN392322_761(FN392322|pid:none) Pichia pastoris GS115 chromosome... 282 2e-74
CR940353_23(CR940353|pid:none) Theileria annulata strain Ankara ... 282 2e-74
CR382132_107(CR382132|pid:none) Yarrowia lipolytica strain CLIB1... 281 6e-74
AM118080_27(AM118080|pid:none) Ustilago hordei mating type regio... 280 7e-74
AE014297_1050(AE014297|pid:none) Drosophila melanogaster chromos... 280 9e-74
AF083031_110(AF083031|pid:none) Guillardia theta nucleomorph chr... 278 3e-73
CR380955_202(CR380955|pid:none) Candida glabrata strain CBS138 c... 278 4e-73
BX908789_22(BX908789|pid:none) Neurospora crassa DNA linkage gro... 278 5e-73
BT058391_1(BT058391|pid:none) Salmo salar clone Contig273 26S pr... 278 5e-73
CU928173_172(CU928173|pid:none) Zygosaccharomyces rouxii strain ... 277 6e-73
CP000589_215(CP000589|pid:none) Ostreococcus lucimarinus CCE9901... 277 8e-73
AL590449_141(AL590449|pid:none) chromosome X of strain GB-M1 of ... 276 1e-72
AY627303_1(AY627303|pid:none) Haloferax volcanii DS2 proteasome-... 276 1e-72
L17040_1(L17040|pid:none) Saccharomyces cerevisiae ATPase gene, ... 276 1e-72
AC104496_3(AC104496|pid:none) Trypanosoma cruzi strain CL Brener... 276 1e-72
AE016818_336(AE016818|pid:none) Ashbya gossypii (= Eremothecium ... 276 1e-72
AE014297_1051(AE014297|pid:none) Drosophila melanogaster chromos... 276 2e-72
EF085905_1(EF085905|pid:none) Picea sitchensis clone WS0295_I06 ... 276 2e-72
AM910987_174(AM910987|pid:none) Plasmodium knowlesi strain H chr... 275 3e-72
(P36612) RecName: Full=26S protease regulatory subunit 4 homolog... 275 4e-72
T48743(T48743)probable 26S ATP/ubiquitin-dependent proteinase ch... 274 5e-72
BT052149_1(BT052149|pid:none) Medicago truncatula clone MTYF9_FA... 274 5e-72
(O16368) RecName: Full=Probable 26S protease regulatory subunit ... 274 5e-72
AM494950_89(AM494950|pid:none) Leishmania braziliensis chromosom... 274 7e-72
CR382130_485(CR382130|pid:none) Yarrowia lipolytica strain CLIB1... 274 7e-72
CT005251_22(CT005251|pid:none) Leishmania major strain Friedlin,... 273 9e-72
AM502230_19(AM502230|pid:none) Leishmania infantum chromosome 12. 273 9e-72
FB781802_1(FB781802|pid:none) Sequence 1075 from Patent WO200803... 273 9e-72
AC136288_5(AC136288|pid:none) Medicago truncatula clone mth2-13o... 273 9e-72
CU928171_706(CU928171|pid:none) Kluyveromyces thermotolerans str... 273 9e-72
AE014186_295(AE014186|pid:none) Plasmodium falciparum 3D7 chromo... 273 1e-71
AC009606_1(AC009606|pid:none) Arabidopsis thaliana chromosome II... 273 2e-71
AX497296_1(AX497296|pid:none) Sequence 63 from Patent WO0229058. 273 2e-71
AM910991_280(AM910991|pid:none) Plasmodium knowlesi strain H chr... 272 2e-71
CP000496_248(CP000496|pid:none) Pichia stipitis CBS 6054 chromos... 272 2e-71
BT040193_1(BT040193|pid:none) Zea mays full-length cDNA clone ZM... 272 3e-71
CP001575_145(CP001575|pid:none) Micromonas sp. RCC299 chromosome... 272 3e-71
CP000586_397(CP000586|pid:none) Ostreococcus lucimarinus CCE9901... 272 3e-71
AM494949_23(AM494949|pid:none) Leishmania braziliensis chromosom... 272 3e-71
BT052739_1(BT052739|pid:none) Medicago truncatula clone MTYFH_FI... 271 3e-71
AF517885_1(AF517885|pid:none) Griffithsia japonica isolate Gj112... 271 4e-71
FB781816_1(FB781816|pid:none) Sequence 1089 from Patent WO200803... 271 6e-71
CR382126_636(CR382126|pid:none) Kluyveromyces lactis strain NRRL... 270 7e-71
D17788_1(D17788|pid:none) Oryza sativa Japonica Group mRNA for h... 270 7e-71
AM180088_563(AM180088|pid:none) Haloquadratum walsbyi DSM 16790 ... 270 1e-70
(P54776) RecName: Full=26S protease regulatory subunit 6A homolo... 270 1e-70
AP002854_15(AP002854|pid:none) Oryza sativa Japonica Group genom... 270 1e-70
BT043367_1(BT043367|pid:none) Zea mays full-length cDNA clone ZM... 270 1e-70
BT034485_1(BT034485|pid:none) Zea mays full-length cDNA clone ZM... 270 1e-70
(O04019) RecName: Full=26S protease regulatory subunit 6A homolo... 270 1e-70
CP001365_184(CP001365|pid:none) Halorubrum lacusprofundi ATCC 49... 270 1e-70
AF412095_1(AF412095|pid:none) Arabidopsis thaliana At1g09100/F7G... 270 1e-70
U77918_1(U77918|pid:none) Rattus norvegicus spermatogenic cell/s... 269 2e-70
AL691439_2(AL691439|pid:none) Mouse DNA sequence from clone RP23... 269 2e-70
AK151370_1(AK151370|pid:none) Mus musculus bone marrow macrophag... 269 2e-70
AK167002_1(AK167002|pid:none) Mus musculus blastocyst blastocyst... 269 2e-70
BT080690_1(BT080690|pid:none) Caligus clemensi clone ccle-evs-50... 269 2e-70
(P17980) RecName: Full=26S protease regulatory subunit 6A; AltNa... 269 2e-70
BC103063_1(BC103063|pid:none) Bos taurus proteasome (prosome, ma... 269 2e-70
AY348234_1(AY348234|pid:none) Drosophila crucigera RPT4 (Rpt4) g... 269 2e-70
(Q63569) RecName: Full=26S protease regulatory subunit 6A; AltNa... 269 2e-70
AK168263_1(AK168263|pid:none) Mus musculus TIB-55 BB88 cDNA, RIK... 269 2e-70
AJ720697_1(AJ720697|pid:none) Gallus gallus mRNA for hypothetica... 269 2e-70
BC107804_1(BC107804|pid:none) Homo sapiens proteasome (prosome, ... 269 2e-70
BT025458_1(BT025458|pid:none) Bos taurus proteasome (prosome, ma... 269 2e-70
AB171711_1(AB171711|pid:none) Macaca fascicularis brain cDNA clo... 268 3e-70
CR382130_373(CR382130|pid:none) Yarrowia lipolytica strain CLIB1... 268 4e-70
CP001338_484(CP001338|pid:none) Candidatus Methanosphaerula palu... 268 4e-70
(O42586) RecName: Full=26S protease regulatory subunit 6A-B; Alt... 268 4e-70
BC075596_1(BC075596|pid:none) Xenopus tropicalis proteasome (pro... 268 4e-70
AP007155_599(AP007155|pid:none) Aspergillus oryzae RIB40 genomic... 268 5e-70
AK222485_1(AK222485|pid:none) Homo sapiens mRNA for proteasome 2... 268 5e-70
BT046299_1(BT046299|pid:none) Salmo salar clone ssal-eve-543-152... 268 5e-70
BT077485_1(BT077485|pid:none) Lepeophtheirus salmonis Pacific fo... 268 5e-70
BC054164_1(BC054164|pid:none) Xenopus laevis proteasome (prosome... 267 6e-70
AK167061_1(AK167061|pid:none) Mus musculus blastocyst blastocyst... 267 6e-70
AY540192_1(AY540192|pid:none) Oreochromis mossambicus proteasome... 267 6e-70
AL691439_3(AL691439|pid:none) Mouse DNA sequence from clone RP23... 267 8e-70
AF227500_1(AF227500|pid:none) Trypanosoma brucei proteasome regu... 267 8e-70
AY750868_1(AY750868|pid:none) Toxoptera citricida putative 26S p... 266 1e-69
AF067618_3(AF067618|pid:none) Caenorhabditis elegans cosmid F56H... 266 1e-69
AP005056_24(AP005056|pid:none) Oryza sativa Japonica Group genom... 266 2e-69
CR382135_216(CR382135|pid:none) Debaryomyces hansenii strain CBS... 266 2e-69
CR380947_109(CR380947|pid:none) Candida glabrata strain CBS138 c... 265 2e-69
(Q9HRW6) RecName: Full=Proteasome-activating nucleotidase 2; Alt... 265 3e-69
FM992689_281(FM992689|pid:none) Candida dubliniensis CD36 chromo... 265 3e-69
AM114193_1720(AM114193|pid:none) Uncultured methanogenic archaeo... 265 3e-69
(P33297) RecName: Full=26S protease regulatory subunit 6A; AltNa... 265 3e-69
CR382125_922(CR382125|pid:none) Kluyveromyces lactis strain NRRL... 265 3e-69
CR382123_278(CR382123|pid:none) Kluyveromyces lactis strain NRRL... 265 4e-69
CP000254_1009(CP000254|pid:none) Methanospirillum hungatei JF-1,... 265 4e-69
AB070252_1(AB070252|pid:none) Oryza sativa Japonica Group OsRPT1... 264 5e-69
AB209036_1(AB209036|pid:none) Homo sapiens mRNA for proteasome 2... 263 9e-69
CR936257_759(CR936257|pid:none) Natronomonas pharaonis DSM 2160 ... 263 9e-69
AF227503_1(AF227503|pid:none) Trypanosoma brucei proteasome regu... 263 2e-68
AJ010592_133(AJ010592|pid:none) Guillardia theta DNA for complet... 262 3e-68
EU016618_25(EU016618|pid:none) Uncultured marine microorganism H... 261 3e-68
CU928171_100(CU928171|pid:none) Kluyveromyces thermotolerans str... 261 3e-68
CU928178_417(CU928178|pid:none) Zygosaccharomyces rouxii strain ... 261 5e-68
FN357393_54(FN357393|pid:none) Schistosoma mansoni genome sequen... 260 8e-68
CT005261_60(CT005261|pid:none) Leishmania major strain Friedlin,... 260 1e-67
AM494959_57(AM494959|pid:none) Leishmania braziliensis chromosom... 259 1e-67
AY348236_1(AY348236|pid:none) Drosophila bipolita RPT4 (Rpt4) ge... 259 1e-67
AM502240_60(AM502240|pid:none) Leishmania infantum chromosome 22. 259 1e-67
AE016819_627(AE016819|pid:none) Ashbya gossypii (= Eremothecium ... 258 3e-67
AY596297_3126(AY596297|pid:none) Haloarcula marismortui ATCC 430... 258 3e-67
CU638744_559(CU638744|pid:none) Podospora anserina genomic DNA c... 258 4e-67
FN314258_1(FN314258|pid:none) Schistosoma japonicum isolate Anhu... 258 4e-67
AY627304_1(AY627304|pid:none) Haloferax volcanii DS2 proteasome-... 258 4e-67
BC030840_1(BC030840|pid:none) Mus musculus protease (prosome, ma... 258 5e-67
AP007154_387(AP007154|pid:none) Aspergillus oryzae RIB40 genomic... 258 5e-67
AE010299_4017(AE010299|pid:none) Methanosarcina acetivorans str.... 258 5e-67
CR380957_405(CR380957|pid:none) Candida glabrata strain CBS138 c... 258 5e-67
AE017353_152(AE017353|pid:none) Cryptococcus neoformans var. neo... 256 1e-66
CP000099_389(CP000099|pid:none) Methanosarcina barkeri str. Fusa... 256 1e-66
CR936257_2506(CR936257|pid:none) Natronomonas pharaonis DSM 2160... 256 2e-66
AE008384_798(AE008384|pid:none) Methanosarcina mazei strain Goe1... 255 2e-66
AF134402_1(AF134402|pid:none) Drosophila melanogaster Tat-bindin... 255 2e-66
AY348237_1(AY348237|pid:none) Drosophila insignita RPT4 (Rpt4) g... 255 2e-66
AB170497_1(AB170497|pid:none) Macaca fascicularis brain cDNA clo... 255 3e-66
BX908808_47(BX908808|pid:none) Neurospora crassa DNA linkage gro... 254 4e-66
(Q9HNP9) RecName: Full=Proteasome-activating nucleotidase 1; Alt... 253 9e-66
AC147002_2(AC147002|pid:none) Medicago truncatula clone mth2-151... 252 2e-65
CP000881_144(CP000881|pid:none) Hemiselmis andersenii chromosome... 251 5e-65
AL691439_1(AL691439|pid:none) Mouse DNA sequence from clone RP23... 251 5e-65
AK071386_1(AK071386|pid:none) Oryza sativa Japonica Group cDNA c... 249 1e-64
CR855073_5(CR855073|pid:none) Oryza sativa (indica cultivar-grou... 249 2e-64
A99111(A99111) 26S proteasome AAA-ATPase subunit [imported] - Gu... 248 5e-64
AB429248_1(AB429248|pid:none) Dicyema japonicum psmc3 gene for 2... 244 7e-63
FN357393_55(FN357393|pid:none) Schistosoma mansoni genome sequen... 239 1e-61
AB170960_1(AB170960|pid:none) Macaca fascicularis brain cDNA clo... 236 2e-60
AE017261_456(AE017261|pid:none) Picrophilus torridus DSM 9790, c... 235 3e-60
AP006878_1158(AP006878|pid:none) Thermococcus kodakarensis KOD1 ... 228 6e-58
GM015171_186(GM015171|pid:none) Sequence 1 from Patent EP1923464. 228 6e-58
AJ871357_1(AJ871357|pid:none) Nyctotherus ovalis partial gene fo... 227 9e-58
B71196(B71196) probable transitional endoplasmic reticulum ATPas... 226 1e-57
EU188624_3(EU188624|pid:none) Giardia intestinalis isolate JH hy... 226 2e-57
EU188625_3(EU188625|pid:none) Giardia intestinalis isolate 55 hy... 226 2e-57
AE000782_2073(AE000782|pid:none) Archaeoglobus fulgidus DSM 4304... 226 2e-57
AJ248284_97(AJ248284|pid:none) Pyrococcus abyssi complete genome... 225 4e-57
AF115331_1(AF115331|pid:none) Amblyomma americanum 26S protease ... 224 5e-57
CP001398_1690(CP001398|pid:none) Thermococcus gammatolerans EJ3,... 224 5e-57
(Q58556) RecName: Full=Cell division cycle protein 48 homolog MJ... 224 6e-57
CP000505_671(CP000505|pid:none) Thermofilum pendens Hrk 5, compl... 224 6e-57
CP000855_1119(CP000855|pid:none) Thermococcus onnurineus NA1, co... 224 8e-57
(O28972) RecName: Full=Cell division cycle protein 48 homolog AF... 223 1e-56
CP000477_519(CP000477|pid:none) Methanosaeta thermophila PT, com... 223 1e-56
CP000493_1304(CP000493|pid:none) Hyperthermus butylicus DSM 5456... 221 4e-56
AE010299_3436(AE010299|pid:none) Methanosarcina acetivorans str.... 221 5e-56
AB018433_1(AB018433|pid:none) Pyrococcus kodakaraensis Pk-cdcA g... 220 1e-55
(O05209) RecName: Full=VCP-like ATPase; &AL445065_184(AL445065|... 219 2e-55
BA000011_975(BA000011|pid:none) Thermoplasma volcanium GSS1 DNA,... 219 2e-55
CP000682_210(CP000682|pid:none) Metallosphaera sedula DSM 5348, ... 219 3e-55
AK150989_1(AK150989|pid:none) Mus musculus bone marrow macrophag... 218 3e-55
CP000493_291(CP000493|pid:none) Hyperthermus butylicus DSM 5456,... 218 4e-55
CP000816_691(CP000816|pid:none) Ignicoccus hospitalis KIN4/I, co... 218 6e-55
CP000102_1047(CP000102|pid:none) Methanosphaera stadtmanae DSM 3... 218 6e-55
CP000682_2198(CP000682|pid:none) Metallosphaera sedula DSM 5348,... 217 8e-55
A69086(A69086) cell division control protein Cdc48 - Methanobact... 217 8e-55
CP000866_101(CP000866|pid:none) Nitrosopumilus maritimus SCM1, c... 217 8e-55
L17042_1(L17042|pid:none) Sulfolobus acidocaldarius ATPase gene,... 217 1e-54
AE009950_963(AE009950|pid:none) Pyrococcus furiosus DSM 3638, co... 217 1e-54
CP001399_1960(CP001399|pid:none) Sulfolobus islandicus L.S.2.15,... 216 1e-54
AY255679_4(AY255679|pid:none) Sulfolobus acidocaldarius DSM 639 ... 216 2e-54
BX950229_176(BX950229|pid:none) Methanococcus maripaludis strain... 216 2e-54
CP000866_11(CP000866|pid:none) Nitrosopumilus maritimus SCM1, co... 216 2e-54
BA000001_713(BA000001|pid:none) Pyrococcus horikoshii OT3 DNA, c... 216 2e-54
CP000702_338(CP000702|pid:none) Thermotoga petrophila RKU-1, com... 215 3e-54
FN357393_56(FN357393|pid:none) Schistosoma mansoni genome sequen... 215 3e-54
AY596297_707(AY596297|pid:none) Haloarcula marismortui ATCC 4304... 214 5e-54
CP000481_158(CP000481|pid:none) Acidothermus cellulolyticus 11B ... 214 5e-54
EF558547_15(EF558547|pid:none) Uncultured haloarchaeon FLAS10H9 ... 214 6e-54
AE000512_571(AE000512|pid:none) Thermotoga maritima MSB8, comple... 214 6e-54
CP000969_350(CP000969|pid:none) Thermotoga sp. RQ2, complete gen... 214 6e-54
CP001399_1656(CP001399|pid:none) Sulfolobus islandicus L.S.2.15,... 213 1e-53
CP001404_1031(CP001404|pid:none) Sulfolobus islandicus Y.N.15.51... 213 1e-53
CP001140_1067(CP001140|pid:none) Desulfurococcus kamchatkensis 1... 213 1e-53
CP000477_76(CP000477|pid:none) Methanosaeta thermophila PT, comp... 213 1e-53
CP000916_84(CP000916|pid:none) Thermotoga neapolitana DSM 4359, ... 213 1e-53
CP000099_2251(CP000099|pid:none) Methanosarcina barkeri str. Fus... 213 2e-53
CP000575_1105(CP000575|pid:none) Staphylothermus marinus F1, com... 212 2e-53
CR548612_21(CR548612|pid:none) Paramecium tetraurelia macronucle... 212 2e-53
CP000780_2417(CP000780|pid:none) Candidatus Methanoregula boonei... 211 4e-53
EF575938_1(EF575938|pid:none) Oryza sativa (indica cultivar-grou... 211 4e-53
CP000742_1163(CP000742|pid:none) Methanococcus vannielii SB, com... 211 4e-53
CP000300_1888(CP000300|pid:none) Methanococcoides burtonii DSM 6... 211 4e-53
CP001398_1723(CP001398|pid:none) Thermococcus gammatolerans EJ3,... 211 4e-53
CP001147_615(CP001147|pid:none) Thermodesulfovibrio yellowstonii... 211 4e-53
AE009439_486(AE009439|pid:none) Methanopyrus kandleri AV19, comp... 211 5e-53
(Q9HPF0) RecName: Full=Protein cdcH; &AE004437_1275(AE004437|pi... 210 9e-53
CP000866_1219(CP000866|pid:none) Nitrosopumilus maritimus SCM1, ... 209 2e-52
AE008384_1256(AE008384|pid:none) Methanosarcina mazei strain Goe... 209 2e-52
DQ515925_1(DQ515925|pid:none) Nicotiana tabacum putative spindle... 209 2e-52
CP001338_250(CP001338|pid:none) Candidatus Methanosphaerula palu... 209 2e-52
CP000394_1110(CP000394|pid:none) Granulibacter bethesdensis CGDN... 209 2e-52
CP000830_1108(CP000830|pid:none) Dinoroseobacter shibae DFL 12, ... 208 3e-52
CP000609_1479(CP000609|pid:none) Methanococcus maripaludis C5, c... 208 3e-52
CP000471_434(CP000471|pid:none) Magnetococcus sp. MC-1, complete... 208 5e-52
AM286690_322(AM286690|pid:none) Alcanivorax borkumensis SK2, com... 208 5e-52
AK098874_1(AK098874|pid:none) Oryza sativa Japonica Group cDNA c... 208 5e-52
CU234118_1203(CU234118|pid:none) Bradyrhizobium sp. ORS278,compl... 208 5e-52
CP000781_3054(CP000781|pid:none) Xanthobacter autotrophicus Py2,... 208 5e-52
CP001074_3647(CP001074|pid:none) Rhizobium etli CIAT 652, comple... 207 6e-52
CP000812_1518(CP000812|pid:none) Thermotoga lettingae TMO, compl... 207 6e-52
CP000496_956(CP000496|pid:none) Pichia stipitis CBS 6054 chromos... 207 6e-52
AE005673_3200(AE005673|pid:none) Caulobacter crescentus CB15, co... 207 6e-52
CP000096_683(CP000096|pid:none) Pelodictyon luteolum DSM 273, co... 207 6e-52
CP000133_3410(CP000133|pid:none) Rhizobium etli CFN 42, complete... 207 6e-52
AJ297368_1(AJ297368|pid:none) Giardia lamblia partial s4 gene fo... 207 8e-52
CP000561_2090(CP000561|pid:none) Pyrobaculum calidifontis JCM 11... 207 8e-52
AM180088_2248(AM180088|pid:none) Haloquadratum walsbyi DSM 16790... 207 8e-52
AP009384_528(AP009384|pid:none) Azorhizobium caulinodans ORS 571... 207 8e-52
FB781858_1(FB781858|pid:none) Sequence 1131 from Patent WO200803... 207 1e-51
(Q96372) RecName: Full=Cell division cycle protein 48 homolog; ... 207 1e-51
CP001365_2346(CP001365|pid:none) Halorubrum lacusprofundi ATCC 4... 207 1e-51
FB906005_1(FB906005|pid:none) Sequence 125278 from Patent WO2008... 207 1e-51
CP000089_941(CP000089|pid:none) Dechloromonas aromatica RCB, com... 207 1e-51
FB781494_1(FB781494|pid:none) Sequence 767 from Patent WO2008034... 207 1e-51
GQ131539_1(GQ131539|pid:none) Nicotiana glutinosa cell division ... 207 1e-51
CP000758_1208(CP000758|pid:none) Ochrobactrum anthropi ATCC 4918... 207 1e-51
CP000872_1630(CP000872|pid:none) Brucella canis ATCC 23365 chrom... 206 1e-51
AE008917_342(AE008917|pid:none) Brucella melitensis 16M chromoso... 206 1e-51
CP001098_56(CP001098|pid:none) Halothermothrix orenii H 168, com... 206 1e-51
BC094063_1(BC094063|pid:none) Mus musculus proteasome (prosome, ... 206 1e-51
FB906007_1(FB906007|pid:none) Sequence 125280 from Patent WO2008... 206 1e-51
(Q7KN62) RecName: Full=Transitional endoplasmic reticulum ATPase... 206 2e-51
CP000968_194(CP000968|pid:none) Candidatus Korarchaeum cryptofil... 206 2e-51
AF047037_1(AF047037|pid:none) Drosophila melanogaster transition... 206 2e-51
BA000023_415(BA000023|pid:none) Sulfolobus tokodaii str. 7 DNA, ... 206 2e-51
AL162751_7(AL162751|pid:none) Arabidopsis thaliana DNA chromosom... 206 2e-51
CP001110_430(CP001110|pid:none) Pelodictyon phaeoclathratiforme ... 206 2e-51
CP001281_1686(CP001281|pid:none) Thauera sp. MZ1T, complete geno... 206 2e-51
BX842653_132(BX842653|pid:none) Bdellovibrio bacteriovorus compl... 206 2e-51
AE013599_1006(AE013599|pid:none) Drosophila melanogaster chromos... 206 2e-51
CT005272_140(CT005272|pid:none) Leishmania major strain Friedlin... 206 2e-51
CP000254_788(CP000254|pid:none) Methanospirillum hungatei JF-1, ... 206 2e-51
CP000099_888(CP000099|pid:none) Methanosarcina barkeri str. Fusa... 206 2e-51
CP001014_1584(CP001014|pid:none) Thermoproteus neutrophilus V24S... 206 2e-51
AE010299_1765(AE010299|pid:none) Methanosarcina acetivorans str.... 206 2e-51
EU606206_1(EU606206|pid:none) Dimocarpus longan cell division cy... 206 2e-51
CP000390_3134(CP000390|pid:none) Mesorhizobium sp. BNC1, complet... 206 2e-51
AY596297_1361(AY596297|pid:none) Haloarcula marismortui ATCC 430... 206 2e-51
AE009441_467(AE009441|pid:none) Pyrobaculum aerophilum str. IM2,... 206 2e-51
CP000319_3333(CP000319|pid:none) Nitrobacter hamburgensis X14, c... 206 2e-51
FB781796_1(FB781796|pid:none) Sequence 1069 from Patent WO200803... 205 3e-51
BA000023_2755(BA000023|pid:none) Sulfolobus tokodaii str. 7 DNA,... 205 3e-51
>EF676776_1(EF676776|pid:none) Picea sitchensis clone WS02751_M22
unknown mRNA.
Length = 398
Score = 552 bits (1423), Expect = e-155
Identities = 277/380 (72%), Positives = 313/380 (82%)
Frame = +2
Query: 143 ALQNYRDRLIEHKNAELRLNKAHELIKKLKKDFQKTEDHIKTIQYIGEIIGEVLRSLDEE 322
A+ YR +L++HK + R+ + ++ KK+F KTED +K++Q +G+IIGEVLR LD E
Sbjct: 13 AVNEYRKKLLQHKEFDARVRALRDNLRAAKKEFDKTEDDLKSLQSVGQIIGEVLRPLDNE 72
Query: 323 RFIVKACNGPRYVVRCANYQDKAHLLVPGARVXXXXXXXXXXXXXPREVDPIIFNMTAES 502
R IVKA +GPRYVV C N DK L G RV PREVDP+++NM E
Sbjct: 73 RLIVKASSGPRYVVGCRNKVDKEKLTA-GTRVVLDMTTLTIMRALPREVDPVVYNMLHED 131
Query: 503 PGSVSYGEIGGLSNQIRELREVVELPLMIPELFIRVGIKAPKGVLLYGPPGTGKTLLARA 682
PG+VSY +GGL++QIRELRE +ELPLM PELFIRVGIK PKGVLLYGPPGTGKTLLARA
Sbjct: 132 PGNVSYSAVGGLADQIRELRESIELPLMNPELFIRVGIKPPKGVLLYGPPGTGKTLLARA 191
Query: 683 IASNLEANFLKVVSSAIVDKYIGESARVIREMFGYARDHQPCVIFMDEIDAIGGRRFSEG 862
IASN+EANFLKVVSSAI+DKYIGESAR+IREMFGYARDHQPC+IFMDEIDAIGGRRFSEG
Sbjct: 192 IASNIEANFLKVVSSAIIDKYIGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFSEG 251
Query: 863 TSADREIQRTLMELLNQMDGFDTLSKVKIIMATNRPDVLDPALLRPGRLDRKIEIPLPNE 1042
TSADREIQRTLMELLNQ+DGFD L KVK+IMATNRPDVLDPALLRPGRLDRKIEIPLPNE
Sbjct: 252 TSADREIQRTLMELLNQLDGFDQLGKVKMIMATNRPDVLDPALLRPGRLDRKIEIPLPNE 311
Query: 1043 AGRVDVLKIHAANITKHGDVDYEAIAKLADGFNAADLRNVCTEAGMFAIRAERDYVMEED 1222
R++VLKIHAA I KHGD+DYEA+ KLA+GFN ADLRNVCTEAGM AIRAERDYV+ ED
Sbjct: 312 QARMEVLKIHAAGIAKHGDIDYEAVVKLAEGFNGADLRNVCTEAGMSAIRAERDYVIHED 371
Query: 1223 FMKAVRKCQEAKKLEGKLDY 1282
FMKAVRK EAKKLE Y
Sbjct: 372 FMKAVRKLNEAKKLESTSHY 391
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3236559
Number of Hits to DB: 1,811,489,258
Number of extensions: 33509597
Number of successful extensions: 139633
Number of sequences better than 10.0: 5546
Number of HSP's gapped: 135521
Number of HSP's successfully gapped: 6004
Length of query: 487
Length of database: 1,051,180,864
Length adjustment: 133
Effective length of query: 354
Effective length of database: 620,718,517
Effective search space: 219734355018
Effective search space used: 219734355018
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 32 (16.9 bits)
|
| PSORT |
|
| VS (DIR, S) |
0 |
| VH (FL, L) |
0 |
| VF (FL, S) |
2 |
| AH (FL, L) |
0 |
| AF (FL, S) |
11 |
| SL (DIR, L) |
1 |
| SS (DIR, S) |
0 |
| SH (FL, L) |
0 |
| SF (FL, S) |
4 |
| CH (FL, L) |
0 |
| CF (FL, S) |
0 |
| FCL (DIR, L) |
1 |
| FC (DIR, S) |
1 |
| FC-IC (SUB) |
0 |