| Contig-U14684-1 |
| Contig ID |
Contig-U14684-1 |
| Contig update |
2002.12.18 |
| Contig sequence |
 |
| Gap |
no gap |
| Contig length |
1466 |
| Chromosome number (1..6, M) |
- |
| Chromosome length |
- |
| Start point |
- |
| End point |
- |
| Strand (PLUS/MINUS) |
- |
| Number of clones |
3 |
| Number of EST |
3 |
| Link to clone list |
U14684 |
| List of clone(s) |
|
| Translated Amino Acid sequence |
|
| Translated Amino Acid sequence (All Frames) |
|
| own update |
2004. 6.10 |
| Homology vs CSM-cDNA |
|
| dna update |
2008.12.28 |
| Homology vs DNA |
|
| protein update |
2009. 7.12 |
| Homology vs Protein |
Query= Contig-U14684-1 (Contig-U14684-1Q) /CSM_Contig/Contig-U14684-1Q.Seq.d
(1466 letters)
Database: nrp_B
3,236,559 sequences; 1,051,180,864 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
BT049021_1(BT049021|pid:none) Salmo salar clone ssal-rgb2-571-16... 130 2e-28
DQ440298_1(DQ440298|pid:none) Aedes aegypti clone AET-3769 U2-as... 97 2e-18
(Q9D9B4) RecName: Full=Leucine-rich repeat-containing protein C1... 92 6e-17
AK153491_1(AK153491|pid:none) Mus musculus bone marrow macrophag... 88 9e-16
BC095822_1(BC095822|pid:none) Danio rerio c10orf11 homolog (H. s... 84 1e-14
AK012226_1(AK012226|pid:none) Mus musculus 11 days embryo whole ... 77 2e-12
BT081445_1(BT081445|pid:none) Rana catesbeiana clone rcat-evr-53... 74 1e-11
AE014297_2363(AE014297|pid:none) Drosophila melanogaster chromos... 73 3e-11
DQ207862_1(DQ207862|pid:none) Solanum tuberosum clone 081D11 unk... 66 4e-09
AE014297_4204(AE014297|pid:none) Drosophila melanogaster chromos... 65 6e-09
(A6NJI9) RecName: Full=Leucine-rich repeat-containing protein EN... 51 9e-05
FJ025009_2(FJ025009|pid:none) Listeria monocytogenes strain NRRL... 49 5e-04
FJ024980_2(FJ024980|pid:none) Listeria monocytogenes strain NRRL... 47 0.002
CP000448_1327(CP000448|pid:none) Syntrophomonas wolfei subsp. wo... 46 0.003
FJ024999_2(FJ024999|pid:none) Listeria monocytogenes strain NRRL... 46 0.004
CU928180_161(CU928180|pid:none) Kluyveromyces thermotolerans str... 45 0.005
FJ024968_2(FJ024968|pid:none) Listeria monocytogenes strain NRRL... 45 0.005
DQ302516_1(DQ302516|pid:none) Listeria monocytogenes strain FSLF... 45 0.005
AC147499_5(AC147499|pid:none) Medicago truncatula clone mth2-22h... 45 0.005
DQ844377_2(DQ844377|pid:none) Listeria monocytogenes strain NRRL... 45 0.007
AF121040_1(AF121040|pid:none) Listeria monocytogenes strain 122 ... 45 0.007
FJ024992_2(FJ024992|pid:none) Listeria monocytogenes strain NRRL... 45 0.007
AK049695_1(AK049695|pid:none) Mus musculus 12 days embryo spinal... 45 0.007
DQ843899_1(DQ843899|pid:none) Listeria monocytogenes strain NRRL... 45 0.007
DQ302493_1(DQ302493|pid:none) Listeria monocytogenes strain FSLF... 45 0.007
DQ347788_1(DQ347788|pid:none) Listeria monocytogenes strain FSLF... 45 0.007
DQ844406_2(DQ844406|pid:none) Listeria monocytogenes strain NRRL... 45 0.007
FJ025004_2(FJ025004|pid:none) Listeria monocytogenes strain NRRL... 45 0.007
FJ024997_2(FJ024997|pid:none) Listeria monocytogenes strain NRRL... 45 0.007
FJ025002_2(FJ025002|pid:none) Listeria monocytogenes strain NRRL... 45 0.007
FJ024978_2(FJ024978|pid:none) Listeria monocytogenes strain NRRL... 45 0.007
FJ025012_2(FJ025012|pid:none) Listeria monocytogenes strain NRRL... 45 0.007
FJ024967_2(FJ024967|pid:none) Listeria monocytogenes strain NRRL... 45 0.007
FJ024976_2(FJ024976|pid:none) Listeria monocytogenes strain NRRL... 45 0.007
DQ844403_2(DQ844403|pid:none) Listeria monocytogenes strain NRRL... 45 0.007
DQ843886_1(DQ843886|pid:none) Listeria monocytogenes strain NRRL... 45 0.007
FJ025005_2(FJ025005|pid:none) Listeria monocytogenes strain NRRL... 45 0.007
FJ025008_2(FJ025008|pid:none) Listeria monocytogenes strain NRRL... 45 0.007
FJ024973_2(FJ024973|pid:none) Listeria monocytogenes strain NRRL... 45 0.007
FJ024977_2(FJ024977|pid:none) Listeria monocytogenes strain NRRL... 45 0.007
AF121041_1(AF121041|pid:none) Listeria monocytogenes strain 123 ... 45 0.007
FJ024984_2(FJ024984|pid:none) Listeria monocytogenes strain NRRL... 45 0.007
FJ024966_2(FJ024966|pid:none) Listeria monocytogenes strain NRRL... 45 0.007
FJ025007_2(FJ025007|pid:none) Listeria monocytogenes strain NRRL... 45 0.007
(Q9D5E4) RecName: Full=Leucine-rich repeat-containing protein 48... 45 0.007
FJ024991_2(FJ024991|pid:none) Listeria monocytogenes strain NRRL... 45 0.007
AJ004824_1(AJ004824|pid:none) Salmo salar mRNA for U2 snRNP-spec... 45 0.009
AJ004823_1(AJ004823|pid:none) Salmo salar gene for U2 snRNP-spec... 45 0.009
DQ347784_1(DQ347784|pid:none) Listeria monocytogenes strain FSLR... 45 0.009
CP001175_2165(CP001175|pid:none) Listeria monocytogenes HCC23, c... 45 0.009
DQ132797_1(DQ132797|pid:none) Listeria monocytogenes strain H4 I... 45 0.009
AL844509_681(AL844509|pid:none) Plasmodium falciparum 3D7 chromo... 45 0.009
U25451_1(U25451|pid:none) Listeria monocytogenes F4233 internali... 45 0.009
FJ025003_2(FJ025003|pid:none) Listeria monocytogenes strain NRRL... 45 0.009
FJ025011_2(FJ025011|pid:none) Listeria monocytogenes strain NRRL... 45 0.009
DQ347780_1(DQ347780|pid:none) Listeria monocytogenes strain FSLJ... 45 0.009
BT081328_1(BT081328|pid:none) Caligus clemensi clone ccle-evs-50... 45 0.009
DQ151186_1(DQ151186|pid:none) Petromyzon marinus clone B.H8 vari... 45 0.009
DQ302514_1(DQ302514|pid:none) Listeria monocytogenes strain FSLN... 44 0.011
AL596090_9(AL596090|pid:none) Mouse DNA sequence from clone RP23... 44 0.011
AK228123_1(AK228123|pid:none) Arabidopsis thaliana mRNA for hypo... 44 0.011
FN357426_21(FN357426|pid:none) Schistosoma mansoni genome sequen... 44 0.011
(Q5RBD9) RecName: Full=Tubulin-specific chaperone E; AltName: Fu... 44 0.011
FJ024990_2(FJ024990|pid:none) Listeria monocytogenes strain NRRL... 44 0.015
GN103037_1(GN103037|pid:none) Sequence 7818 from Patent WO200903... 44 0.015
FJ024975_2(FJ024975|pid:none) Listeria monocytogenes strain NRRL... 44 0.015
FJ024970_2(FJ024970|pid:none) Listeria monocytogenes strain NRRL... 44 0.015
AM502242_69(AM502242|pid:none) Leishmania infantum chromosome 24. 44 0.020
EU408877_1(EU408877|pid:none) Listeria monocytogenes isolate VIM... 44 0.020
M67471_3(M67471|pid:none) Listeria monocytogenes internalin (inl... 44 0.020
AJ720043_1(AJ720043|pid:none) Gallus gallus mRNA for hypothetica... 44 0.020
DQ302502_1(DQ302502|pid:none) Listeria monocytogenes strain FSLN... 44 0.020
AM494961_104(AM494961|pid:none) Leishmania braziliensis chromoso... 44 0.020
AF121025_1(AF121025|pid:none) Listeria monocytogenes strain 83 i... 44 0.020
EF056196_1(EF056196|pid:none) Listeria monocytogenes strain VIMV... 44 0.020
DQ843878_1(DQ843878|pid:none) Listeria monocytogenes strain NRRL... 44 0.020
DQ302486_1(DQ302486|pid:none) Listeria monocytogenes strain FSLF... 44 0.020
DQ302504_1(DQ302504|pid:none) Listeria monocytogenes strain FSLN... 44 0.020
AF121032_1(AF121032|pid:none) Listeria monocytogenes strain 524 ... 44 0.020
AF121024_1(AF121024|pid:none) Listeria monocytogenes strain 77 i... 44 0.020
(P25147) RecName: Full=Internalin B; Flags: Precursor; &AC1129(... 44 0.020
(A0JM56) RecName: Full=Leucine-rich repeat-containing protein 9; 44 0.020
DQ347768_1(DQ347768|pid:none) Listeria monocytogenes strain FSLF... 44 0.020
DQ843881_1(DQ843881|pid:none) Listeria monocytogenes strain NRRL... 43 0.025
DQ302483_1(DQ302483|pid:none) Listeria monocytogenes strain FSLE... 43 0.025
AM433292_1(AM433292|pid:none) Vitis vinifera contig VV78X005567.... 43 0.025
AE013599_2241(AE013599|pid:none) Drosophila melanogaster chromos... 43 0.033
EF056203_1(EF056203|pid:none) Listeria monocytogenes strain VIMV... 43 0.033
EU408883_1(EU408883|pid:none) Listeria monocytogenes isolate VIM... 43 0.033
EU408868_1(EU408868|pid:none) Listeria monocytogenes isolate VIM... 43 0.033
U56961_4(U56961|pid:none) Caenorhabditis elegans cosmid T19D7, c... 43 0.033
(P24014) RecName: Full=Protein slit; Short=dSlit; Conta... 43 0.033
EU408885_1(EU408885|pid:none) Listeria monocytogenes isolate VIM... 43 0.033
EU408886_1(EU408886|pid:none) Listeria monocytogenes isolate VIM... 43 0.033
EF056206_1(EF056206|pid:none) Listeria monocytogenes strain VIMV... 43 0.033
(Q54XI9) RecName: Full=Probable inactive serine/threonine-protei... 43 0.033
AJ004808_1(AJ004808|pid:none) Listeria ivanovii i-inlB, i-inlJ, ... 42 0.043
AE014296_805(AE014296|pid:none) Drosophila melanogaster chromoso... 42 0.043
CP000581_140(CP000581|pid:none) Ostreococcus lucimarinus CCE9901... 42 0.043
AE014296_804(AE014296|pid:none) Drosophila melanogaster chromoso... 42 0.043
CP001332_134(CP001332|pid:none) Micromonas sp. RCC299 chromosome... 42 0.043
BC155656_1(BC155656|pid:none) Danio rerio leucine rich repeat ne... 42 0.057
DQ844356_2(DQ844356|pid:none) Listeria monocytogenes strain NRRL... 42 0.057
DQ302484_1(DQ302484|pid:none) Listeria monocytogenes strain FSLF... 42 0.057
DQ843854_1(DQ843854|pid:none) Listeria monocytogenes strain NRRL... 42 0.057
FJ024988_1(FJ024988|pid:none) Listeria monocytogenes strain NRRL... 42 0.057
DQ844358_2(DQ844358|pid:none) Listeria monocytogenes strain NRRL... 42 0.057
DQ843885_1(DQ843885|pid:none) Listeria monocytogenes strain NRRL... 42 0.057
DQ302487_1(DQ302487|pid:none) Listeria monocytogenes strain FSLF... 42 0.057
DQ302496_1(DQ302496|pid:none) Listeria monocytogenes strain FSLF... 42 0.057
DQ844404_2(DQ844404|pid:none) Listeria monocytogenes strain NRRL... 42 0.057
CP000589_130(CP000589|pid:none) Ostreococcus lucimarinus CCE9901... 42 0.057
DQ843851_1(DQ843851|pid:none) Listeria monocytogenes strain NRRL... 42 0.057
DQ302488_1(DQ302488|pid:none) Listeria monocytogenes strain FSLF... 42 0.057
DQ844399_2(DQ844399|pid:none) Listeria monocytogenes strain NRRL... 42 0.057
DQ844359_2(DQ844359|pid:none) Listeria monocytogenes strain NRRL... 42 0.057
DQ844362_2(DQ844362|pid:none) Listeria monocytogenes strain NRRL... 42 0.057
DQ844366_2(DQ844366|pid:none) Listeria monocytogenes strain NRRL... 42 0.057
DQ844349_2(DQ844349|pid:none) Listeria monocytogenes strain NRRL... 42 0.057
DQ844376_2(DQ844376|pid:none) Listeria monocytogenes strain NRRL... 42 0.057
DQ302512_1(DQ302512|pid:none) Listeria monocytogenes strain FSLS... 42 0.057
DQ302480_1(DQ302480|pid:none) Listeria monocytogenes strain FSLE... 42 0.057
DQ843884_1(DQ843884|pid:none) Listeria monocytogenes strain NRRL... 42 0.057
DQ843856_1(DQ843856|pid:none) Listeria monocytogenes strain NRRL... 42 0.057
AF497155_1(AF497155|pid:none) Listeria monocytogenes strain FSLJ... 42 0.074
AB276429_1(AB276429|pid:none) Listeria monocytogenes inlA for in... 42 0.074
DQ843823_1(DQ843823|pid:none) Listeria monocytogenes strain NRRL... 42 0.074
FJ617527_1(FJ617527|pid:none) Listeria monocytogenes strain CSUF... 42 0.074
AY436594_1(AY436594|pid:none) Listeria monocytogenes isolate F69... 42 0.074
DQ347766_1(DQ347766|pid:none) Listeria monocytogenes strain FSLF... 42 0.074
AF497163_1(AF497163|pid:none) Listeria monocytogenes strain FSLj... 42 0.074
AB276406_1(AB276406|pid:none) Listeria monocytogenes inlA for in... 42 0.074
AY228472_1(AY228472|pid:none) Listeria monocytogenes strain F621... 42 0.074
FJ024968_1(FJ024968|pid:none) Listeria monocytogenes strain NRRL... 42 0.074
EF558942_1(EF558942|pid:none) Listeria monocytogenes isolate R9 ... 42 0.074
EF445918_1(EF445918|pid:none) Listeria monocytogenes clone n4290... 42 0.074
(Q723K6) RecName: Full=Internalin-A; Flags: Precursor; &AE01726... 42 0.074
EF558940_1(EF558940|pid:none) Listeria monocytogenes isolate R7 ... 42 0.074
DQ844405_1(DQ844405|pid:none) Listeria monocytogenes strain NRRL... 42 0.074
(Q4R6X9) RecName: Full=Leucine-rich repeat-containing protein 48... 42 0.074
AB276381_1(AB276381|pid:none) Listeria monocytogenes inlA for in... 42 0.074
FJ024986_1(FJ024986|pid:none) Listeria monocytogenes strain NRRL... 42 0.074
DQ843801_1(DQ843801|pid:none) Listeria monocytogenes strain NRRL... 42 0.074
DQ347771_1(DQ347771|pid:none) Listeria monocytogenes strain FSLJ... 42 0.074
EF558935_1(EF558935|pid:none) Listeria monocytogenes isolate R2 ... 42 0.074
AE014185_317(AE014185|pid:none) Plasmodium falciparum 3D7 chromo... 42 0.074
FM178788_1(FM178788|pid:none) Listeria monocytogenes inlA gene f... 42 0.074
FJ024991_1(FJ024991|pid:none) Listeria monocytogenes strain NRRL... 42 0.074
AY898265_1(AY898265|pid:none) Plasmodium falciparum leucine-rich... 42 0.074
AF497166_1(AF497166|pid:none) Listeria monocytogenes strain FSLW... 42 0.074
FJ025003_1(FJ025003|pid:none) Listeria monocytogenes strain NRRL... 42 0.074
EF445913_1(EF445913|pid:none) Listeria monocytogenes clone f2637... 42 0.074
FJ024979_1(FJ024979|pid:none) Listeria monocytogenes strain NRRL... 42 0.074
U25445_1(U25445|pid:none) Listeria monocytogenes F2365 internali... 42 0.074
DQ844359_1(DQ844359|pid:none) Listeria monocytogenes strain NRRL... 42 0.074
AB276428_1(AB276428|pid:none) Listeria monocytogenes inlA for in... 42 0.074
AF497164_1(AF497164|pid:none) Listeria monocytogenes strain FSLC... 42 0.074
DQ844350_1(DQ844350|pid:none) Listeria monocytogenes strain NRRL... 42 0.074
EF445928_1(EF445928|pid:none) Listeria monocytogenes clone f2663... 42 0.074
EF445930_1(EF445930|pid:none) Listeria monocytogenes clone s4295... 42 0.074
FJ617534_1(FJ617534|pid:none) Listeria monocytogenes strain CSUF... 42 0.074
DQ844351_1(DQ844351|pid:none) Listeria monocytogenes strain NRRL... 42 0.074
FJ024993_1(FJ024993|pid:none) Listeria monocytogenes strain NRRL... 42 0.074
DQ844404_1(DQ844404|pid:none) Listeria monocytogenes strain NRRL... 42 0.074
FJ024980_1(FJ024980|pid:none) Listeria monocytogenes strain NRRL... 42 0.074
EF445938_1(EF445938|pid:none) Listeria monocytogenes clone f2695... 42 0.074
DQ843792_1(DQ843792|pid:none) Listeria monocytogenes strain NRRL... 42 0.074
FJ025012_1(FJ025012|pid:none) Listeria monocytogenes strain NRRL... 42 0.074
DQ347777_1(DQ347777|pid:none) Listeria monocytogenes strain FSLR... 42 0.074
DQ843822_1(DQ843822|pid:none) Listeria monocytogenes strain NRRL... 42 0.074
FJ024971_1(FJ024971|pid:none) Listeria monocytogenes strain NRRL... 42 0.074
(P25146) RecName: Full=Internalin-A; Flags: Precursor; &AB1129(... 42 0.074
FJ024998_1(FJ024998|pid:none) Listeria monocytogenes strain NRRL... 42 0.074
DQ844375_1(DQ844375|pid:none) Listeria monocytogenes strain NRRL... 42 0.074
AY436593_1(AY436593|pid:none) Listeria monocytogenes isolate J01... 42 0.074
EF445931_1(EF445931|pid:none) Listeria monocytogenes clone s4304... 42 0.074
GN103035_1(GN103035|pid:none) Sequence 7816 from Patent WO200903... 42 0.074
DQ347776_1(DQ347776|pid:none) Listeria monocytogenes strain FSLR... 42 0.074
FJ025000_1(FJ025000|pid:none) Listeria monocytogenes strain NRRL... 42 0.074
DQ347769_1(DQ347769|pid:none) Listeria monocytogenes strain FSLF... 42 0.074
BT043499_1(BT043499|pid:none) Salmo salar clone HM4_0280 protein... 42 0.074
FJ024994_1(FJ024994|pid:none) Listeria monocytogenes strain NRRL... 42 0.074
DQ844403_1(DQ844403|pid:none) Listeria monocytogenes strain NRRL... 42 0.074
DQ844407_1(DQ844407|pid:none) Listeria monocytogenes strain NRRL... 42 0.074
EF445917_1(EF445917|pid:none) Listeria monocytogenes clone e1123... 42 0.074
AK340639_1(AK340639|pid:none) Acyrthosiphon pisum ACYPI000509 mR... 42 0.074
FJ024976_1(FJ024976|pid:none) Listeria monocytogenes strain NRRL... 42 0.074
DQ347775_1(DQ347775|pid:none) Listeria monocytogenes strain FSLM... 42 0.074
AB276379_1(AB276379|pid:none) Listeria monocytogenes inlA for in... 42 0.074
DQ132795_1(DQ132795|pid:none) Listeria monocytogenes strain 1040... 42 0.074
FJ024983_1(FJ024983|pid:none) Listeria monocytogenes strain NRRL... 42 0.074
DQ843837_1(DQ843837|pid:none) Listeria monocytogenes strain NRRL... 42 0.074
DQ844376_1(DQ844376|pid:none) Listeria monocytogenes strain NRRL... 42 0.074
FJ024969_1(FJ024969|pid:none) Listeria monocytogenes strain NRRL... 42 0.074
EF445906_1(EF445906|pid:none) Listeria monocytogenes clone f2666... 42 0.074
DQ843819_1(DQ843819|pid:none) Listeria monocytogenes strain NRRL... 42 0.074
FJ495194_1(FJ495194|pid:none) Listeria monocytogenes strain 4140... 42 0.074
EF445901_1(EF445901|pid:none) Listeria monocytogenes clone e1125... 42 0.074
FM179779_1(FM179779|pid:none) Listeria monocytogenes inlA gene f... 42 0.074
CP001287_507(CP001287|pid:none) Cyanothece sp. PCC 8801, complet... 42 0.074
BC103420_1(BC103420|pid:none) Bos taurus leucine rich repeat con... 42 0.074
EF445920_1(EF445920|pid:none) Listeria monocytogenes clone n4293... 42 0.074
FJ024966_1(FJ024966|pid:none) Listeria monocytogenes strain NRRL... 42 0.074
DQ843789_1(DQ843789|pid:none) Listeria monocytogenes strain NRRL... 42 0.074
FJ024965_1(FJ024965|pid:none) Listeria monocytogenes strain NRRL... 42 0.074
DQ844401_1(DQ844401|pid:none) Listeria monocytogenes strain NRRL... 42 0.074
(Q5XI54) RecName: Full=Leucine-rich repeat-containing protein 48... 42 0.074
DQ844408_1(DQ844408|pid:none) Listeria monocytogenes strain NRRL... 42 0.074
DQ844349_1(DQ844349|pid:none) Listeria monocytogenes strain NRRL... 42 0.074
FJ025010_1(FJ025010|pid:none) Listeria monocytogenes strain NRRL... 42 0.074
EF409978_1(EF409978|pid:none) Listeria monocytogenes strain LI05... 42 0.074
DQ347774_1(DQ347774|pid:none) Listeria monocytogenes strain FSLJ... 41 0.097
DQ844366_1(DQ844366|pid:none) Listeria monocytogenes strain NRRL... 41 0.097
DQ843791_1(DQ843791|pid:none) Listeria monocytogenes strain NRRL... 41 0.097
EF056172_1(EF056172|pid:none) Listeria monocytogenes strain VIMH... 41 0.097
EU408871_1(EU408871|pid:none) Listeria monocytogenes isolate VIM... 41 0.097
AB276421_1(AB276421|pid:none) Listeria monocytogenes inlA for in... 41 0.097
DQ302597_1(DQ302597|pid:none) Listeria monocytogenes strain FSLE... 41 0.13
DQ302626_1(DQ302626|pid:none) Listeria monocytogenes strain FSLS... 41 0.13
AF126540_1(AF126540|pid:none) Drosophila melanogaster slit prote... 41 0.13
A36665(A36665;A31640;S13523) slit protein 1 precursor - fruit fl... 41 0.13
CP000001_1202(CP000001|pid:none) Bacillus cereus E33L, complete ... 41 0.13
U77368_2(U77368|pid:none) Listeria monocytogenes internalin (inl... 41 0.13
CP001357_1154(CP001357|pid:none) Brachyspira hyodysenteriae WA1,... 40 0.17
EF056175_1(EF056175|pid:none) Listeria monocytogenes strain VIMV... 40 0.17
DQ302625_1(DQ302625|pid:none) Listeria monocytogenes strain FSLS... 40 0.17
AJ888460_1(AJ888460|pid:none) Listeria ivanovii i-inlF gene, i-i... 40 0.17
DQ449831_1(DQ449831|pid:none) Listeria monocytogenes isolate e11... 40 0.17
EU126152_1(EU126152|pid:none) Danio rerio leucine-rich repeats a... 40 0.17
Y14181_1(Y14181|pid:none) Listeria ivanovii i-inlF gene. 40 0.17
AB168408_1(AB168408|pid:none) Macaca fascicularis testis cDNA cl... 40 0.17
FM242711_328(FM242711|pid:none) Listeria monocytogenes Clip81459... 40 0.17
DQ302610_1(DQ302610|pid:none) Listeria monocytogenes strain FSLF... 40 0.22
(Q723X5) RecName: Full=Internalin-I; Flags: Precursor; &AE01726... 40 0.22
AE014187_303(AE014187|pid:none) Plasmodium falciparum 3D7 chromo... 40 0.22
(Q7ZV84) RecName: Full=Leucine-rich repeat-containing protein 50; 40 0.22
BC045963_1(BC045963|pid:none) Danio rerio leucine rich repeat co... 40 0.22
CP000407_1569(CP000407|pid:none) Streptococcus suis 05ZYH33, com... 40 0.28
BC013777_1(BC013777|pid:none) Mus musculus small nuclear ribonuc... 40 0.28
EU408789_1(EU408789|pid:none) Listeria monocytogenes isolate VIM... 40 0.28
BC146154_1(BC146154|pid:none) Bos taurus small nuclear ribonucle... 40 0.28
AF230356_1(AF230356|pid:none) Mus musculus U2 small nuclear ribo... 40 0.28
AF497167_1(AF497167|pid:none) Listeria monocytogenes strain FSLX... 40 0.28
(Q8NEP3) RecName: Full=Leucine-rich repeat-containing protein 50; 40 0.28
CP000382_566(CP000382|pid:none) Clostridium novyi NT, complete g... 40 0.28
CP000408_1584(CP000408|pid:none) Streptococcus suis 98HAH33, com... 40 0.28
AL833328_1(AL833328|pid:none) Homo sapiens mRNA; cDNA DKFZp686E1... 40 0.28
EU583475_1(EU583475|pid:none) Ovis aries SNPRA1 mRNA, complete c... 40 0.28
FJ024984_1(FJ024984|pid:none) Listeria monocytogenes strain NRRL... 40 0.28
(P57784) RecName: Full=U2 small nuclear ribonucleoprotein A'; ... 40 0.28
AE017194_1437(AE017194|pid:none) Bacillus cereus ATCC 10987, com... 39 0.37
CP001283_1330(CP001283|pid:none) Bacillus cereus AH820, complete... 39 0.37
AM392530_1(AM392530|pid:none) Synthetic construct Homo sapiens c... 39 0.37
AK291717_1(AK291717|pid:none) Homo sapiens cDNA FLJ77567 complet... 39 0.37
EU408831_1(EU408831|pid:none) Listeria monocytogenes isolate VIM... 39 0.37
EF094731_1(EF094731|pid:none) Petromyzon marinus isolate PmVLRA.... 39 0.37
EU408810_1(EU408810|pid:none) Listeria monocytogenes isolate VIM... 39 0.37
AK241152_1(AK241152|pid:none) Oryza sativa Japonica Group cDNA, ... 39 0.37
AE017355_1195(AE017355|pid:none) Bacillus thuringiensis serovar ... 39 0.37
CP000485_1123(CP000485|pid:none) Bacillus thuringiensis str. Al ... 39 0.37
AB040930_1(AB040930|pid:none) Homo sapiens mRNA for KIAA1497 pro... 39 0.37
EU408808_1(EU408808|pid:none) Listeria monocytogenes isolate VIM... 39 0.37
EU408804_1(EU408804|pid:none) Listeria monocytogenes isolate VIM... 39 0.37
AK223070_1(AK223070|pid:none) Homo sapiens mRNA for small nuclea... 39 0.37
CP001215_3147(CP001215|pid:none) Bacillus anthracis str. CDC 684... 39 0.37
AE001437_3227(AE001437|pid:none) Clostridium acetobutylicum ATCC... 39 0.37
AE1515(AE1515) internalin like protein (LPXTG motif) [imported] ... 39 0.37
AE016879_1236(AE016879|pid:none) Bacillus anthracis str. Ames, c... 39 0.37
AK223110_1(AK223110|pid:none) Homo sapiens mRNA for small nuclea... 39 0.37
EU408851_1(EU408851|pid:none) Listeria monocytogenes isolate VIM... 39 0.37
CP001177_1330(CP001177|pid:none) Bacillus cereus AH187, complete... 39 0.37
(Q6AYH9) RecName: Full=Leucine-rich repeat-containing protein 50... 39 0.37
DQ347812_1(DQ347812|pid:none) Listeria monocytogenes strain FSLF... 39 0.48
AY937243_1(AY937243|pid:none) Apis mellifera Toll-like receptor ... 39 0.48
AM431505_2(AM431505|pid:none) Vitis vinifera contig VV78X064503.... 39 0.48
AE015927_407(AE015927|pid:none) Clostridium tetani E88, complete... 39 0.48
DQ347813_1(DQ347813|pid:none) Listeria monocytogenes strain FSLJ... 39 0.48
DQ868125_1(DQ868125|pid:none) Drosophila affinis Toll-7 (Toll-7)... 39 0.63
T15864(T15864)hypothetical protein C56E6.6 - Caenorhabditis eleg... 39 0.63
AK128037_1(AK128037|pid:none) Homo sapiens cDNA FLJ46156 fis, cl... 39 0.63
AE1479(AE1479) probable cell surface protein (LPXTG motif) [impo... 39 0.63
CP000260_1179(CP000260|pid:none) Streptococcus pyogenes MGAS1027... 39 0.63
AB014462_1(AB014462|pid:none) Xenopus laevis XNLRR-1 mRNA, compl... 39 0.63
DQ868132_1(DQ868132|pid:none) Drosophila miranda strain MA28 chr... 39 0.63
CP000903_464(CP000903|pid:none) Bacillus weihenstephanensis KBAB... 39 0.63
DQ067619_1(DQ067619|pid:none) Fusarium proliferatum adenylate cy... 39 0.63
(Q6ZRR7) RecName: Full=Leucine-rich repeat-containing protein 9; 39 0.63
BC125720_1(BC125720|pid:none) Xenopus tropicalis hypothetical pr... 39 0.63
(A0N0X6) RecName: Full=Leucine-rich repeat neuronal protein 1; A... 39 0.63
DQ868133_1(DQ868133|pid:none) Drosophila miranda strain MA32 chr... 39 0.63
DQ868128_1(DQ868128|pid:none) Drosophila miranda strain 0101.4 c... 39 0.63
DQ868126_1(DQ868126|pid:none) Drosophila pseudoobscura chromosom... 39 0.63
AK101441_1(AK101441|pid:none) Oryza sativa Japonica Group cDNA c... 39 0.63
CP000261_1171(CP000261|pid:none) Streptococcus pyogenes MGAS2096... 38 0.82
DQ302632_1(DQ302632|pid:none) Listeria monocytogenes strain FSLS... 38 0.82
EU836300_1(EU836300|pid:none) Peromyscus aztecus hylocetes isola... 38 0.82
CP000259_1152(CP000259|pid:none) Streptococcus pyogenes MGAS9429... 38 0.82
BT021726_1(BT021726|pid:none) Bos taurus hypothetical protein FL... 38 0.82
CP000829_1320(CP000829|pid:none) Streptococcus pyogenes NZ131, c... 38 0.82
(Q6DIQ3) RecName: Full=Protein phosphatase 1 regulatory subunit ... 38 0.82
AE017262_370(AE017262|pid:none) Listeria monocytogenes str. 4b F... 38 0.82
AE009949_1132(AE009949|pid:none) Streptococcus pyogenes MGAS8232... 38 0.82
CP000259_1533(CP000259|pid:none) Streptococcus pyogenes MGAS9429... 38 0.82
FM242711_350(FM242711|pid:none) Listeria monocytogenes Clip81459... 38 0.82
BC118442_1(BC118442|pid:none) Bos taurus leucine rich repeat con... 38 0.82
EF409980_1(EF409980|pid:none) Listeria monocytogenes strain LI05... 38 0.82
BX470240_1(BX470240|pid:none) Zebrafish DNA sequence from clone ... 38 0.82
AE014074_1035(AE014074|pid:none) Streptococcus pyogenes MGAS315,... 38 0.82
AE004092_1043(AE004092|pid:none) Streptococcus pyogenes M1 GAS, ... 38 0.82
DQ302561_1(DQ302561|pid:none) Listeria monocytogenes strain FSLE... 38 0.82
CP000003_1522(CP000003|pid:none) Streptococcus pyogenes MGAS1039... 38 0.82
CP000056_1515(CP000056|pid:none) Streptococcus pyogenes MGAS6180... 38 0.82
(Q32Q07) RecName: Full=Leucine-rich repeat neuronal protein 1; A... 38 0.82
AK226790_1(AK226790|pid:none) Arabidopsis thaliana mRNA for prot... 38 1.1
CU928181_279(CU928181|pid:none) Zygosaccharomyces rouxii strain ... 38 1.1
AK047468_1(AK047468|pid:none) Mus musculus 10 days neonate cereb... 38 1.1
AF381545_1(AF381545|pid:none) Homo sapiens membrane glycoprotein... 38 1.1
BC071561_1(BC071561|pid:none) Homo sapiens leucine-rich repeats ... 38 1.1
FM992690_665(FM992690|pid:none) Candida dubliniensis CD36 chromo... 38 1.1
BT045924_1(BT045924|pid:none) Salmo salar clone ssal-rgf-536-316... 38 1.1
CP001037_4503(CP001037|pid:none) Nostoc punctiforme PCC 73102, c... 38 1.1
BC140907_1(BC140907|pid:none) Homo sapiens leucine-rich repeats ... 38 1.1
EU836298_1(EU836298|pid:none) Peromyscus maniculatus bairdii iso... 38 1.1
AB050468_1(AB050468|pid:none) Homo sapiens mRNA for membrane gly... 38 1.1
AC006300_12(AC006300|pid:none) Arabidopsis thaliana chromosome 2... 38 1.1
BT076497_1(BT076497|pid:none) Caligus rogercresseyi clone crog-e... 38 1.1
AJ004825_1(AJ004825|pid:none) Salmo salar mRNA for U2 snRNP-spec... 38 1.1
(B6D5P3) RecName: Full=Leucine-rich repeat-containing protein 50... 38 1.1
AY730707_1(AY730707|pid:none) Homo sapiens leucine-rich repeat p... 38 1.1
AM502242_16(AM502242|pid:none) Leishmania infantum chromosome 24. 38 1.1
(B6D5P1) RecName: Full=Leucine-rich repeat-containing protein 50... 38 1.1
(O74473) RecName: Full=Septation initiation network scaffold pro... 38 1.1
DQ347817_1(DQ347817|pid:none) Listeria monocytogenes strain FSLR... 38 1.1
AL935261_71(AL935261|pid:none) Lactobacillus plantarum strain WC... 38 1.1
AK164849_1(AK164849|pid:none) Mus musculus 15 days embryo head c... 38 1.1
(Q96JA1) RecName: Full=Leucine-rich repeats and immunoglobulin-l... 38 1.1
DQ302581_1(DQ302581|pid:none) Listeria monocytogenes strain FSLN... 37 1.4
DQ302563_1(DQ302563|pid:none) Listeria monocytogenes strain FSLF... 37 1.4
AJ012385_2(AJ012385|pid:none) Listeria monocytogenes inlF, inlD ... 37 1.4
DQ138914_1(DQ138914|pid:none) Drosophila melanogaster strain Ral... 37 1.4
EU707134_1(EU707134|pid:none) Drosophila melanogaster isolate ML... 37 1.4
AL845366_2(AL845366|pid:none) Zebrafish DNA sequence from clone ... 37 1.4
DQ302560_1(DQ302560|pid:none) Listeria monocytogenes strain FSLE... 37 1.4
DQ302624_1(DQ302624|pid:none) Listeria monocytogenes strain FSLS... 37 1.4
AE015927_406(AE015927|pid:none) Clostridium tetani E88, complete... 37 1.4
DQ302565_1(DQ302565|pid:none) Listeria monocytogenes strain FSLF... 37 1.4
DQ302587_1(DQ302587|pid:none) Listeria monocytogenes strain FSLS... 37 1.4
AE017194_606(AE017194|pid:none) Bacillus cereus ATCC 10987, comp... 37 1.4
AM412317_3113(AM412317|pid:none) Clostridium botulinum A str. AT... 37 1.4
(Q5FVI3) RecName: Full=Leucine-rich repeat-containing protein 57... 37 1.4
CP001083_1873(CP001083|pid:none) Clostridium botulinum Ba4 str. ... 37 1.4
DQ302586_1(DQ302586|pid:none) Listeria monocytogenes strain FSLS... 37 1.4
AH1107(AH1107) internalin H [imported] - Listeria monocytogenes ... 37 1.4
DQ138919_1(DQ138919|pid:none) Drosophila erecta voucher stock #1... 37 1.4
DQ302559_1(DQ302559|pid:none) Listeria monocytogenes strain FSLE... 37 1.4
DQ138917_1(DQ138917|pid:none) Drosophila yakuba strain Tai18 CG8... 37 1.4
DQ302584_1(DQ302584|pid:none) Listeria monocytogenes strain FSLS... 37 1.4
DQ138916_1(DQ138916|pid:none) Drosophila simulans strain Ky-b CG... 37 1.4
DQ302477_1(DQ302477|pid:none) Listeria monocytogenes strain FSLF... 37 1.4
U77368_1(U77368|pid:none) Listeria monocytogenes internalin (inl... 37 1.4
DQ017481_1(DQ017481|pid:none) Plasmodium falciparum leucine-rich... 37 1.4
DQ302573_1(DQ302573|pid:none) Listeria monocytogenes strain FSLF... 37 1.4
AM263198_759(AM263198|pid:none) Listeria welshimeri serovar 6b s... 37 1.8
EF512462_1(EF512462|pid:none) Gallus gallus leucine-rich repeat ... 37 1.8
AL772299_9(AL772299|pid:none) Mouse DNA sequence from clone RP23... 37 1.8
AE016877_462(AE016877|pid:none) Bacillus cereus ATCC 14579, comp... 37 1.8
AK003037_1(AK003037|pid:none) Mus musculus adult male brain cDNA... 37 1.8
AK134971_1(AK134971|pid:none) Mus musculus adult male olfactory ... 37 1.8
DQ138918_1(DQ138918|pid:none) Drosophila yakuba strain T33 CG859... 37 1.8
CU928168_655(CU928168|pid:none) Kluyveromyces thermotolerans str... 37 1.8
CP001323_723(CP001323|pid:none) Micromonas sp. RCC299 chromosome... 37 1.8
DQ347803_1(DQ347803|pid:none) Listeria monocytogenes strain FSLF... 37 1.8
CP000393_2252(CP000393|pid:none) Trichodesmium erythraeum IMS101... 37 1.8
AK012637_1(AK012637|pid:none) Mus musculus 10, 11 days embryo wh... 37 1.8
(Q9D1G5) RecName: Full=Leucine-rich repeat-containing protein 57... 37 1.8
CP000885_1793(CP000885|pid:none) Clostridium phytofermentans ISD... 37 1.8
AE001437_3221(AE001437|pid:none) Clostridium acetobutylicum ATCC... 37 2.4
AY091081_1(AY091081|pid:none) Arabidopsis thaliana putative leuc... 37 2.4
AC002334_21(AC002334|pid:none) Arabidopsis thaliana chromosome 2... 37 2.4
AB027844_1(AB027844|pid:none) Schizosaccharomyces pombe gene for... 37 2.4
EF081372_1(EF081372|pid:none) Triticum aestivum FORL2 mRNA, comp... 37 2.4
DQ347801_1(DQ347801|pid:none) Listeria monocytogenes strain FSLJ... 37 2.4
CP001283_541(CP001283|pid:none) Bacillus cereus AH820, complete ... 37 2.4
AM981304_1(AM981304|pid:none) Ovis aries mRNA for Toll-like rece... 37 2.4
BC139541_1(BC139541|pid:none) Danio rerio vasorin like, mRNA (cD... 37 2.4
FJ708675_1(FJ708675|pid:none) Arabidopsis thaliana leucine-rich ... 37 2.4
AM910993_8(AM910993|pid:none) Plasmodium knowlesi strain H chrom... 37 2.4
AB1497(AB1497) internalin protein, probable peptidoglycan bound ... 36 3.1
AL669839_1(AL669839|pid:none) Mouse DNA sequence from clone RP23... 36 3.1
CP000031_3347(CP000031|pid:none) Ruegeria pomeroyi DSS-3, comple... 36 3.1
FM242711_413(FM242711|pid:none) Listeria monocytogenes Clip81459... 36 3.1
BC167810_1(BC167810|pid:none) Synthetic construct Homo sapiens c... 36 3.1
EF409977_1(EF409977|pid:none) Prunus persica polygalacturonase i... 36 3.1
(Q9Y4C4) RecName: Full=Malignant fibrous histiocytoma-amplified ... 36 3.1
AM451552_1(AM451552|pid:none) Vitis vinifera contig VV78X141848.... 36 3.1
AM778955_126(AM778955|pid:none) Microcystis aeruginosa PCC 7806 ... 36 3.1
FM242711_275(FM242711|pid:none) Listeria monocytogenes Clip81459... 36 3.1
(Q9WVB4) RecName: Full=Slit homolog 3 protein; Short=Sl... 36 3.1
EU117213_1(EU117213|pid:none) Fragaria x ananassa polygalacturon... 36 3.1
T23841(T23841) hypothetical protein M88.6b - Caenorhabditis eleg... 36 3.1
AC140031_16(AC140031|pid:none) Medicago truncatula clone mth2-24... 36 3.1
(O88280) RecName: Full=Slit homolog 3 protein; Short=Sl... 36 3.1
BC150780_1(BC150780|pid:none) Mus musculus slit homolog 3 (Droso... 36 3.1
DQ302601_1(DQ302601|pid:none) Listeria monocytogenes strain FSLF... 36 3.1
AY965606_1(AY965606|pid:none) Eptatretus stoutii clone Es3mVLRB.... 36 3.1
EF094719_1(EF094719|pid:none) Petromyzon marinus isolate PmVLRA.... 36 3.1
Z79598_2(Z79598|pid:none) Caenorhabditis elegans Cosmid C44H4, c... 36 3.1
T23836(T23836) hypothetical protein M88.6a - Caenorhabditis eleg... 36 3.1
CP001186_465(CP001186|pid:none) Bacillus cereus G9842, complete ... 36 3.1
CU468799_1(CU468799|pid:none) Danio rerio cDNA, clone cssl:d0413. 36 3.1
DQ302622_1(DQ302622|pid:none) Listeria monocytogenes strain FSLN... 36 3.1
AY349696_1(AY349696|pid:none) Drosophila simulans strain Sim5 18... 36 4.1
FN376191_2(FN376191|pid:none) Schistosoma mansoni genome sequenc... 36 4.1
(Q54Y32) RecName: Full=MAP kinase phosphatase with leucine-rich ... 36 4.1
EF471283_1(EF471283|pid:none) Oncorhynchus mykiss neuronal leuci... 36 4.1
DQ138942_1(DQ138942|pid:none) Drosophila yakuba strain T33 CG889... 36 4.1
AE014296_806(AE014296|pid:none) Drosophila melanogaster chromoso... 36 4.1
(Q6BT60) RecName: Full=U2 small nuclear ribonucleoprotein A'; ... 36 4.1
AK132349_1(AK132349|pid:none) Mus musculus 15 days embryo head c... 36 4.1
CU468795_1(CU468795|pid:none) Danio rerio cDNA, clone cssl:d0381. 36 4.1
AY903226_1(AY903226|pid:none) Prunus americana polygalacturonase... 36 4.1
(Q3V1N1) RecName: Full=Malignant fibrous histiocytoma-amplified ... 36 4.1
DQ138943_1(DQ138943|pid:none) Drosophila erecta voucher stock #1... 36 4.1
EF678730_1(EF678730|pid:none) Picea sitchensis clone WS0297_D22 ... 36 4.1
AE013599_3151(AE013599|pid:none) Drosophila melanogaster chromos... 36 4.1
AB019228_2(AB019228|pid:none) Arabidopsis thaliana genomic DNA, ... 36 4.1
BC170476_1(BC170476|pid:none) Xenopus laevis slit homolog 2 (Dro... 36 4.1
AY738489_1(AY738489|pid:none) Gemmata sp. Wa1-1 GTP-binding prot... 36 4.1
AY964751_1(AY964751|pid:none) Eptatretus burgeri clone Eb7VLRA.4... 36 4.1
AM494961_50(AM494961|pid:none) Leishmania braziliensis chromosom... 36 4.1
EF094746_1(EF094746|pid:none) Petromyzon marinus isolate PmVLRA.... 36 4.1
L23171_1(L23171|pid:none) Drosophila melanogaster wheeler mRNA, ... 36 4.1
DQ138941_1(DQ138941|pid:none) Drosophila yakuba strain Tai18 CG8... 36 4.1
(Q3UM45) RecName: Full=Protein phosphatase 1 regulatory subunit ... 36 4.1
AK171731_1(AK171731|pid:none) Mus musculus activated spleen cDNA... 36 4.1
AY046070_1(AY046070|pid:none) Xenopus laevis Slit mRNA, complete... 36 4.1
(Q6DHL5) RecName: Full=Leucine-rich repeat-containing protein 57... 36 4.1
EF094766_1(EF094766|pid:none) Petromyzon marinus isolate PmVLRA.... 36 4.1
DQ138940_1(DQ138940|pid:none) Drosophila simulans strain Ky-b CG... 36 4.1
CP001175_2334(CP001175|pid:none) Listeria monocytogenes HCC23, c... 36 4.1
AY964744_1(AY964744|pid:none) Eptatretus burgeri clone Eb7VLRA.3... 35 5.3
DQ121376_15(DQ121376|pid:none) Uncultured bacterium clone YC01G1... 35 5.3
AM293330_1(AM293330|pid:none) Manduca sexta mRNA for leureptin (... 35 5.3
DQ437870_1(DQ437870|pid:none) Toxoplasma gondii leucine-rich rep... 35 5.3
AY964904_1(AY964904|pid:none) Eptatretus stoutii clone Es5VLRA.B... 35 5.3
DQ347818_1(DQ347818|pid:none) Listeria monocytogenes strain FSLJ... 35 5.3
CR940353_258(CR940353|pid:none) Theileria annulata strain Ankara... 35 5.3
AY964747_1(AY964747|pid:none) Eptatretus burgeri clone Eb7VLRA.3... 35 5.3
CP001248_27(CP001248|pid:none) Borrelia afzelii ACA-1 plasmid cp... 35 5.3
AY964752_1(AY964752|pid:none) Eptatretus burgeri clone Eb7VLRA.4... 35 5.3
AB070579_1(AB070579|pid:none) Bombyx mori Bm18w gene for 18 whee... 35 5.3
AB275676_1(AB275676|pid:none) Lethenteron japonicum jVLR gene fo... 35 5.3
EU006644_1(EU006644|pid:none) Bos taurus x Bos indicus isolate 2... 35 5.3
EU006649_1(EU006649|pid:none) Bos indicus isolate 86X Toll-like ... 35 5.3
AM920436_1105(AM920436|pid:none) Penicillium chrysogenum Wiscons... 35 5.3
CP000903_1223(CP000903|pid:none) Bacillus weihenstephanensis KBA... 35 5.3
DQ020574_1(DQ020574|pid:none) Solanum torvum verticillium wilt d... 35 5.3
AF413062_1(AF413062|pid:none) Manduca sexta leureptin mRNA, comp... 35 5.3
EU006648_1(EU006648|pid:none) Bos taurus isolate 80U Toll-like r... 35 5.3
FN357369_80(FN357369|pid:none) Schistosoma mansoni genome sequen... 35 6.9
EU746470_1(EU746470|pid:none) Bos taurus isolate 74 toll-like re... 35 6.9
AM910987_279(AM910987|pid:none) Plasmodium knowlesi strain H chr... 35 6.9
AP009046_78(AP009046|pid:none) Hyphantria cunea nucleopolyhedrov... 35 6.9
AB120627_1(AB120627|pid:none) Populus nigra PnLRK1 mRNA for leuc... 35 6.9
DQ302680_1(DQ302680|pid:none) Listeria monocytogenes strain FSLN... 35 6.9
EU408881_1(EU408881|pid:none) Listeria monocytogenes isolate VIM... 35 6.9
AM473958_2(AM473958|pid:none) Vitis vinifera contig VV78X180524.... 35 6.9
DQ302673_1(DQ302673|pid:none) Listeria monocytogenes strain FSLE... 35 6.9
CR940347_994(CR940347|pid:none) Theileria annulata strain Ankara... 35 6.9
EF094790_1(EF094790|pid:none) Petromyzon marinus isolate PmVLRA.... 35 6.9
DQ302682_1(DQ302682|pid:none) Listeria monocytogenes strain FSLS... 35 6.9
AE016877_1204(AE016877|pid:none) Bacillus cereus ATCC 14579, com... 35 6.9
AM425879_2(AM425879|pid:none) Vitis vinifera contig VV78X020791.... 35 6.9
DQ302681_1(DQ302681|pid:none) Listeria monocytogenes strain FSLS... 35 6.9
DQ302691_1(DQ302691|pid:none) Listeria monocytogenes strain FSLF... 35 6.9
EU746474_1(EU746474|pid:none) Bos indicus isolate 86 toll-like r... 35 6.9
CP001083_2070(CP001083|pid:none) Clostridium botulinum Ba4 str. ... 35 6.9
S76155_1(S76155|pid:none) tlr=Toll-like receptor [Drosophila mel... 35 6.9
DQ302674_1(DQ302674|pid:none) Listeria monocytogenes strain FSLF... 35 6.9
AJ618974_1(AJ618974|pid:none) Bos taurus mRNA for toll-like rece... 35 6.9
EU746472_1(EU746472|pid:none) Bos indicus x Bos taurus isolate 8... 35 6.9
AM910994_541(AM910994|pid:none) Plasmodium knowlesi strain H chr... 35 6.9
DQ302678_1(DQ302678|pid:none) Listeria monocytogenes strain FSLF... 35 6.9
DQ302683_1(DQ302683|pid:none) Listeria monocytogenes strain FSLS... 35 6.9
U77367_1(U77367|pid:none) Listeria monocytogenes internalin (inl... 35 6.9
AB1126(AB1126) internalin, peptidoglycan bound protein (LPxTG mo... 35 6.9
DQ302684_1(DQ302684|pid:none) Listeria monocytogenes strain FSLS... 35 6.9
(O55226) RecName: Full=Chondroadherin; AltName: Full=Cartilage l... 35 9.1
DQ302566_1(DQ302566|pid:none) Listeria monocytogenes strain FSLF... 35 9.1
CP000962_1769(CP000962|pid:none) Clostridium botulinum A3 str. L... 35 9.1
AJ012386_1(AJ012386|pid:none) Listeria monocytogenes inlG gene, ... 35 9.1
CP001102_101(CP001102|pid:none) Candidatus Amoebophilus asiaticu... 35 9.1
DQ529276_1(DQ529276|pid:none) Ictalurus punctatus toll-like rece... 35 9.1
EF409979_1(EF409979|pid:none) Listeria monocytogenes strain LI05... 35 9.1
CP000939_1706(CP000939|pid:none) Clostridium botulinum B1 str. O... 35 9.1
CP001037_5526(CP001037|pid:none) Nostoc punctiforme PCC 73102, c... 35 9.1
CT005269_317(CT005269|pid:none) Leishmania major strain Friedlin... 35 9.1
CR954209_147(CR954209|pid:none) Ostreococcus tauri strain OTTH05... 35 9.1
AY965563_1(AY965563|pid:none) Eptatretus stoutii clone Es6VLRB.B... 35 9.1
BC167614_1(BC167614|pid:none) Xenopus tropicalis hypothetical pr... 35 9.1
>BT049021_1(BT049021|pid:none) Salmo salar clone ssal-rgb2-571-162
C10orf11 homolog putative mRNA, complete cds.
Length = 196
Score = 130 bits (326), Expect = 2e-28
Identities = 65/152 (42%), Positives = 97/152 (63%)
Frame = +1
Query: 121 LDLAYRDIIEINPQIVDRFGPYVKELDLSNNNLEKDLTILEGFKRLTTLVLDNNRITHHI 300
L AY+ ++EI +++ ++ LDLS N LE+ +L ++L+TL+LD N + H+
Sbjct: 28 LSFAYQGLLEIPYEVILAQQHTLEVLDLSYNLLEESPALLGELEQLSTLILDCNSYSSHV 87
Query: 301 KFPLLTQLHTLWINSNQISNLSVFVDRVCESFPNIRTFSMLKNEACPNFFNGHSLRXYKD 480
KFP + + T+WIN N+ISNL +FV+ + FPNI+ SM+ NEA P++FNG SL Y D
Sbjct: 88 KFPYMPSVTTVWINKNKISNLPIFVEEIRSKFPNIKILSMMNNEAAPSYFNGGSLPQYID 147
Query: 481 YRLYIXSRLKYVQILDSTPVTPEERVDAIKLY 576
YR Y+ S++ + ILD T V +ER A K Y
Sbjct: 148 YRQYVISQIPSLTILDDTEVLGKERAQAEKTY 179
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3236559
Number of Hits to DB: 1,535,451,893
Number of extensions: 26013691
Number of successful extensions: 75066
Number of sequences better than 10.0: 511
Number of HSP's gapped: 74563
Number of HSP's successfully gapped: 720
Length of query: 488
Length of database: 1,051,180,864
Length adjustment: 133
Effective length of query: 355
Effective length of database: 620,718,517
Effective search space: 220355073535
Effective search space used: 220355073535
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 32 (16.9 bits)
|
| PSORT |
|
| VS (DIR, S) |
0 |
| VH (FL, L) |
0 |
| VF (FL, S) |
1 |
| AH (FL, L) |
0 |
| AF (FL, S) |
0 |
| SL (DIR, L) |
2 |
| SS (DIR, S) |
0 |
| SH (FL, L) |
0 |
| SF (FL, S) |
0 |
| CH (FL, L) |
0 |
| CF (FL, S) |
0 |
| FCL (DIR, L) |
0 |
| FC (DIR, S) |
0 |
| FC-IC (SUB) |
0 |