Homology vs DNA |
|
Homology vs Protein |
Query= Contig-U14675-1 (Contig-U14675-1Q) /CSM_Contig/Contig-U14675-1Q.Seq.d (1212 letters)
Database: nrp_B 3,236,559 sequences; 1,051,180,864 total letters
Searching..................................................done
Score E Sequences producing significant alignments: (bits) Value
(Q94480) RecName: Full=Cytoplasmic tRNA 2-thiolation protein 1; ... 381 0.0 U66527_1(U66527|pid:none) Dictyostelium discoideum ORFveg136 mRN... 362 0.0 (Q5FW05) RecName: Full=Cytoplasmic tRNA 2-thiolation protein 1; ... 278 e-125 (Q05AW7) RecName: Full=ATP-binding domain-containing protein 3; ... 274 e-124 (O64862) RecName: Full=Cytoplasmic tRNA 2-thiolation protein 1; ... 288 e-124 AK106684_1(AK106684|pid:none) Oryza sativa Japonica Group cDNA c... 285 e-123 (Q803X1) RecName: Full=ATP-binding domain-containing protein 3; ... 278 e-121 BC154793_1(BC154793|pid:none) Danio rerio zgc:55395, mRNA (cDNA ... 276 e-121 (Q4P6R3) RecName: Full=Cytoplasmic tRNA 2-thiolation protein 1; ... 300 e-119 AC004521_9(AC004521|pid:none) Arabidopsis thaliana chromosome 2 ... 288 e-119 (Q5KGC1) RecName: Full=Cytoplasmic tRNA 2-thiolation protein 1; ... 274 e-118 BT081180_1(BT081180|pid:none) Caligus clemensi clone ccle-evs-51... 269 e-114 BT077317_1(BT077317|pid:none) Caligus rogercresseyi clone crog-e... 268 e-114 (Q28ZC1) RecName: Full=Cytoplasmic tRNA 2-thiolation protein 1; ... 259 e-111 (Q6FMB5) RecName: Full=Cytoplasmic tRNA 2-thiolation protein 1; ... 269 e-109 FN357390_38(FN357390|pid:none) Schistosoma mansoni genome sequen... 255 e-108 (O94282) RecName: Full=Cytoplasmic tRNA 2-thiolation protein 1; ... 269 e-108 (Q6CWX6) RecName: Full=Cytoplasmic tRNA 2-thiolation protein 1; ... 266 e-107 (P53088) RecName: Full=Cytoplasmic tRNA 2-thiolation protein 1; ... 256 e-105 CU928181_341(CU928181|pid:none) Zygosaccharomyces rouxii strain ... 258 e-104 (A8WR63) RecName: Full=Cytoplasmic tRNA 2-thiolation protein 1; ... 239 e-102 AM920431_853(AM920431|pid:none) Penicillium chrysogenum Wisconsi... 247 2e-99 CT005272_632(CT005272|pid:none) Leishmania major strain Friedlin... 246 4e-99 S64230(S71668;S71671;S64230) hypothetical protein YGL211w - yeas... 256 5e-99 AM494972_644(AM494972|pid:none) Leishmania braziliensis chromoso... 241 6e-96 AP007155_780(AP007155|pid:none) Aspergillus oryzae RIB40 genomic... 249 2e-92 AL590443_120(AL590443|pid:none) chromosome III of strain GB-M1 o... 206 2e-76 (Q99J10) RecName: Full=Cytoplasmic tRNA 2-thiolation protein 1; ... 174 4e-75 BC161898_1(BC161898|pid:none) Rattus norvegicus ATP binding doma... 172 5e-75 (Q0VC66) RecName: Full=Cytoplasmic tRNA 2-thiolation protein 1; ... 174 6e-75 (Q7Z7A3) RecName: Full=Cytoplasmic tRNA 2-thiolation protein 1; ... 172 6e-75 CR382139_118(CR382139|pid:none) Debaryomyces hansenii strain CBS... 261 5e-68 (A3GGB3) RecName: Full=Cytoplasmic tRNA 2-thiolation protein 1; ... 258 2e-67 (Q16QI1) RecName: Full=Cytoplasmic tRNA 2-thiolation protein 1; ... 251 3e-65 (Q7Q9I4) RecName: Full=Cytoplasmic tRNA 2-thiolation protein 1; ... 247 7e-64 AM910993_363(AM910993|pid:none) Plasmodium knowlesi strain H chr... 202 3e-50 CR940348_159(CR940348|pid:none) Theileria annulata strain Ankara... 165 3e-39 AM114193_2749(AM114193|pid:none) Uncultured methanogenic archaeo... 110 4e-39 CP000099_2584(CP000099|pid:none) Methanosarcina barkeri str. Fus... 115 1e-38 CP000678_553(CP000678|pid:none) Methanobrevibacter smithii ATCC ... 134 1e-37 AE010299_1923(AE010299|pid:none) Methanosarcina acetivorans str.... 114 6e-37 AE008384_2796(AE008384|pid:none) Methanosarcina mazei strain Goe... 114 2e-36 CP000102_321(CP000102|pid:none) Methanosphaera stadtmanae DSM 30... 131 7e-36 CP000300_907(CP000300|pid:none) Methanococcoides burtonii DSM 62... 109 3e-34 CP000559_962(CP000559|pid:none) Methanocorpusculum labreanum Z, ... 115 2e-33 CP000743_785(CP000743|pid:none) Methanococcus aeolicus Nankai-3,... 107 4e-32 CP001365_510(CP001365|pid:none) Halorubrum lacusprofundi ATCC 49... 102 3e-31 AY596297_1781(AY596297|pid:none) Haloarcula marismortui ATCC 430... 100 6e-31 CP000477_563(CP000477|pid:none) Methanosaeta thermophila PT, com... 114 7e-31 AE017199_508(AE017199|pid:none) Nanoarchaeum equitans Kin4-M, co... 102 1e-30 (Q58558) RecName: Full=CTU1/ATPBD3 family protein MJ1157; &E644... 102 5e-30 BX950229_1356(BX950229|pid:none) Methanococcus maripaludis strai... 110 5e-30 CP000780_2111(CP000780|pid:none) Candidatus Methanoregula boonei... 97 8e-30 CP000682_1901(CP000682|pid:none) Metallosphaera sedula DSM 5348,... 95 1e-28 CP000855_1699(CP000855|pid:none) Thermococcus onnurineus NA1, co... 126 1e-27 CP000867_1304(CP000867|pid:none) Methanococcus maripaludis C6, c... 103 2e-27 CP000504_1007(CP000504|pid:none) Pyrobaculum islandicum DSM 4184... 89 3e-27 GM015893_282(GM015893|pid:none) Sequence 723 from Patent EP19234... 125 4e-27 CP000254_2136(CP000254|pid:none) Methanospirillum hungatei JF-1,... 97 6e-27 CP001399_1502(CP001399|pid:none) Sulfolobus islandicus L.S.2.15,... 92 8e-27 AE009441_1600(AE009441|pid:none) Pyrobaculum aerophilum str. IM2... 83 1e-26 AE004437_159(AE004437|pid:none) Halobacterium sp. NRC-1, complet... 98 1e-26 CP000575_1(CP000575|pid:none) Staphylothermus marinus F1, comple... 105 2e-26 CP001338_1159(CP001338|pid:none) Candidatus Methanosphaerula pal... 91 2e-26 CP001014_1421(CP001014|pid:none) Thermoproteus neutrophilus V24S... 82 3e-26 CP001401_1509(CP001401|pid:none) Sulfolobus islandicus M.16.27, ... 92 6e-26 CP001398_21(CP001398|pid:none) Thermococcus gammatolerans EJ3, c... 120 1e-25 DQ372942_1(DQ372942|pid:none) Methanococcus voltae putative GMP ... 96 1e-25 CP000505_914(CP000505|pid:none) Thermofilum pendens Hrk 5, compl... 103 2e-25 BA000001_1727(BA000001|pid:none) Pyrococcus horikoshii OT3 DNA, ... 118 4e-25 (Q58873) RecName: Full=CTU1/ATPBD3 family protein MJ1478; &E644... 96 4e-25 AE009950_1758(AE009950|pid:none) Pyrococcus furiosus DSM 3638, c... 116 2e-24 CP000102_279(CP000102|pid:none) Methanosphaera stadtmanae DSM 30... 102 2e-24 CP001251_1603(CP001251|pid:none) Dictyoglomus turgidum DSM 6724,... 99 6e-23 CP000660_1450(CP000660|pid:none) Pyrobaculum arsenaticum DSM 135... 79 3e-22 BA000002_397(BA000002|pid:none) Aeropyrum pernix K1 DNA, complet... 94 1e-21 CP000816_505(CP000816|pid:none) Ignicoccus hospitalis KIN4/I, co... 79 1e-21 CP001140_489(CP001140|pid:none) Desulfurococcus kamchatkensis 12... 106 2e-21 A69100(A69100) conserved hypothetical protein MTH1742 - Methanob... 106 2e-21 CP000855_1724(CP000855|pid:none) Thermococcus onnurineus NA1, co... 82 4e-21 AJ248288_124(AJ248288|pid:none) Pyrococcus abyssi complete genom... 83 4e-21 CP001398_2131(CP001398|pid:none) Thermococcus gammatolerans EJ3,... 82 4e-21 CP000923_1130(CP000923|pid:none) Thermoanaerobacter sp. X514, co... 83 4e-21 AE000782_1303(AE000782|pid:none) Archaeoglobus fulgidus DSM 4304... 81 9e-21 BA000023_687(BA000023|pid:none) Sulfolobus tokodaii str. 7 DNA, ... 93 1e-20 CP000969_741(CP000969|pid:none) Thermotoga sp. RQ2, complete gen... 72 4e-20 AE008691_63(AE008691|pid:none) Thermoanaerobacter tengcongensis ... 82 4e-20 AE000512_195(AE000512|pid:none) Thermotoga maritima MSB8, comple... 72 7e-20 A72514(A72514) hypothetical protein APE2086 - Aeropyrum pernix (... 85 2e-19 CP000916_489(CP000916|pid:none) Thermotoga neapolitana DSM 4359,... 73 2e-19 AP008207_1754(AP008207|pid:none) Oryza sativa (japonica cultivar... 99 3e-19 CP000077_364(CP000077|pid:none) Sulfolobus acidocaldarius DSM 63... 87 6e-19 CP000812_411(CP000812|pid:none) Thermotoga lettingae TMO, comple... 72 6e-19 CP001146_1492(CP001146|pid:none) Dictyoglomus thermophilum H-6-1... 82 2e-18 H72637(H72637)hypothetical protein APE0537 - Aeropyrum pernix (s... 82 5e-18 CP000924_2121(CP000924|pid:none) Thermoanaerobacter pseudethanol... 78 1e-17 CP000562_481(CP000562|pid:none) Methanoculleus marisnigri JR1, c... 92 3e-17 CP001393_180(CP001393|pid:none) Anaerocellum thermophilum DSM 67... 71 1e-16 CP001147_1007(CP001147|pid:none) Thermodesulfovibrio yellowstoni... 77 2e-16 CP001140_719(CP001140|pid:none) Desulfurococcus kamchatkensis 12... 70 4e-16 CP000505_1256(CP000505|pid:none) Thermofilum pendens Hrk 5, comp... 59 1e-15 CP000679_92(CP000679|pid:none) Caldicellulosiruptor saccharolyti... 70 5e-15 CP001080_1456(CP001080|pid:none) Sulfurihydrogenibium sp. YO3AOP... 64 5e-15 AL445066_188(AL445066|pid:none) Thermoplasma acidophilum complet... 83 2e-14 BA000011_444(BA000011|pid:none) Thermoplasma volcanium GSS1 DNA,... 82 4e-14 CP001034_411(CP001034|pid:none) Natranaerobius thermophilus JW/N... 62 5e-14 CP001197_2309(CP001197|pid:none) Desulfovibrio vulgaris str. 'Mi... 62 1e-13 (Q3A6S7) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 75 6e-12 CP000140_2049(CP000140|pid:none) Parabacteroides distasonis ATCC... 67 9e-12 CP000728_339(CP000728|pid:none) Clostridium botulinum F str. Lan... 73 2e-11 CP000939_367(CP000939|pid:none) Clostridium botulinum B1 str. Ok... 73 2e-11 CP000726_333(CP000726|pid:none) Clostridium botulinum A str. ATC... 72 3e-11 (Q39QC5) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 72 3e-11 (Q12N51) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 60 4e-11 (A5GBX4) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 71 9e-11 CP000939_167(CP000939|pid:none) Clostridium botulinum B1 str. Ok... 71 9e-11 CP000728_159(CP000728|pid:none) Clostridium botulinum F str. Lan... 71 9e-11 CP001358_2252(CP001358|pid:none) Desulfovibrio desulfuricans sub... 56 9e-11 CP000962_159(CP000962|pid:none) Clostridium botulinum A3 str. Lo... 70 1e-10 CP001083_164(CP001083|pid:none) Clostridium botulinum Ba4 str. 6... 70 1e-10 CP000112_3603(CP000112|pid:none) Desulfovibrio desulfuricans G20... 54 1e-10 CP000968_210(CP000968|pid:none) Candidatus Korarchaeum cryptofil... 59 1e-10 CP001359_944(CP001359|pid:none) Anaeromyxobacter dehalogenans 2C... 65 2e-10 CP001131_944(CP001131|pid:none) Anaeromyxobacter sp. K, complete... 65 2e-10 (B2T6U6) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 69 3e-10 (A4TIV5) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 69 4e-10 (A7H8W2) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 69 4e-10 CP001106_623(CP001106|pid:none) Eubacterium eligens ATCC 27750 p... 69 4e-10 FN360867_1(FN360867|pid:none) Schistosoma mansoni genome sequenc... 68 6e-10 (A1AUS1) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 68 6e-10 CP001124_610(CP001124|pid:none) Geobacter bemidjiensis Bem, comp... 68 6e-10 AP009049_2751(AP009049|pid:none) Clostridium kluyveri NBRC 12016... 68 7e-10 (A1RJP0) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 68 7e-10 CP001390_900(CP001390|pid:none) Geobacter sp. FRC-32, complete g... 68 7e-10 (Q1BSY9) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 67 1e-09 (A0KB51) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 67 1e-09 (Q5E590) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 67 1e-09 AE017226_451(AE017226|pid:none) Treponema denticola ATCC 35405, ... 66 2e-09 AE017125_1612(AE017125|pid:none) Helicobacter hepaticus ATCC 514... 66 2e-09 CP000448_966(CP000448|pid:none) Syntrophomonas wolfei subsp. wol... 66 3e-09 (A3M828) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 66 3e-09 (A3QEG3) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 66 3e-09 CP001056_692(CP001056|pid:none) Clostridium botulinum B str. Ekl... 66 3e-09 (A5WG99) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 65 4e-09 CP000964_2972(CP000964|pid:none) Klebsiella pneumoniae 342, comp... 65 4e-09 AP006725_2205(AP006725|pid:none) Klebsiella pneumoniae NTUH-K204... 65 4e-09 (Q2T1V1) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 65 5e-09 CP000478_710(CP000478|pid:none) Syntrophobacter fumaroxidans MPO... 65 5e-09 (Q0BB90) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 65 5e-09 (B1YP61) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 65 5e-09 FM178379_1573(FM178379|pid:none) Aliivibrio salmonicida LFI1238 ... 65 6e-09 CP001078_652(CP001078|pid:none) Clostridium botulinum E3 str. Al... 65 6e-09 CP000860_826(CP000860|pid:none) Candidatus Desulforudis audaxvia... 65 6e-09 (Q1IX43) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 65 6e-09 (A5IGL1) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 65 6e-09 AE017285_135(AE017285|pid:none) Desulfovibrio vulgaris subsp. vu... 61 8e-09 (Q3IHG8) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 64 8e-09 CP000891_2197(CP000891|pid:none) Shewanella baltica OS195, compl... 64 8e-09 CP001107_1311(CP001107|pid:none) Eubacterium rectale ATCC 33656,... 64 8e-09 (A9MQT5) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 64 1e-08 (Q5PHS1) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 64 1e-08 CP001120_1727(CP001120|pid:none) Salmonella enterica subsp. ente... 64 1e-08 CP000776_658(CP000776|pid:none) Campylobacter hominis ATCC BAA-3... 64 1e-08 (A9MXN4) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 64 1e-08 AM942759_1346(AM942759|pid:none) Proteus mirabilis strain HI4320... 64 1e-08 (Q8ZP88) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 64 1e-08 (Q8D9J0) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 64 1e-08 (Q9KS29) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 64 1e-08 CP001408_244(CP001408|pid:none) Burkholderia pseudomallei MSHR34... 64 1e-08 CP001279_316(CP001279|pid:none) Nautilia profundicola AmH, compl... 64 1e-08 CP001600_1839(CP001600|pid:none) Edwardsiella ictaluri 93-146, c... 64 1e-08 (Q5F956) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 64 1e-08 (A1V7Z5) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 64 1e-08 CP000139_3526(CP000139|pid:none) Bacteroides vulgatus ATCC 8482,... 64 1e-08 CP001154_2669(CP001154|pid:none) Laribacter hongkongensis HLHK9,... 64 1e-08 (A1TUY3) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 63 2e-08 (A0KX28) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 63 2e-08 (A9AKB0) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 63 2e-08 (A6WNB3) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 63 2e-08 (Q57P06) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 63 2e-08 (Q6F8Q3) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 63 2e-08 BA000016_990(BA000016|pid:none) Clostridium perfringens str. 13 ... 63 2e-08 (Q124R0) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 63 2e-08 AE015928_4556(AE015928|pid:none) Bacteroides thetaiotaomicron VP... 62 2e-08 (Q6D5P6) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 63 2e-08 CP001348_3305(CP001348|pid:none) Clostridium cellulolyticum H10,... 63 2e-08 (A8H4Q7) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 62 3e-08 AJ278969_8(AJ278969|pid:none) Ruminococcus flavefaciens cellulos... 62 3e-08 (A9LZH0) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 62 3e-08 (B2U0Z1) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 62 3e-08 (B0TUN8) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 62 3e-08 FM180568_1536(FM180568|pid:none) Escherichia coli 0127:H6 E2348/... 62 4e-08 (A7ZLH4) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 62 4e-08 AE009951_1444(AE009951|pid:none) Fusobacterium nucleatum subsp. ... 62 4e-08 (Q0AI06) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 62 4e-08 (A8AGE0) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 62 4e-08 (A4JIF6) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 62 4e-08 CP001068_58(CP001068|pid:none) Ralstonia pickettii 12J chromosom... 62 4e-08 CP001503_3129(CP001503|pid:none) Burkholderia glumae BGR1 chromo... 62 5e-08 (Q0VQ34) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 62 5e-08 CP001091_1031(CP001091|pid:none) Actinobacillus pleuropneumoniae... 62 5e-08 CP001107_1644(CP001107|pid:none) Eubacterium rectale ATCC 33656,... 62 5e-08 (Q47ZU5) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 62 5e-08 CU861906_201(CU861906|pid:none) Ralstonia solanacearum strain Mo... 62 5e-08 (Q477W2) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 62 5e-08 CP001020_823(CP001020|pid:none) Coxiella burnetii CbuK_Q154, com... 62 5e-08 (Q2KU24) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 62 5e-08 CU928158_1554(CU928158|pid:none) Escherichia fergusonii ATCC 354... 61 7e-08 CU468135_1655(CU468135|pid:none) Erwinia tasmaniensis strain ET1... 61 7e-08 (Q7N3Y7) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 61 7e-08 (Q1RC21) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 61 7e-08 CP001147_879(CP001147|pid:none) Thermodesulfovibrio yellowstonii... 61 7e-08 (Q0TI22) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 61 7e-08 (B0UU61) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 61 7e-08 (Q0I3K3) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 61 7e-08 (B1LG84) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 61 7e-08 CP001635_962(CP001635|pid:none) Variovorax paradoxus S110 chromo... 61 7e-08 CP001157_3209(CP001157|pid:none) Azotobacter vinelandii DJ, comp... 61 7e-08 (A9BXV6) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 61 7e-08 (Q7NQK6) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 61 9e-08 (A0Q736) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 61 9e-08 AE017143_1452(AE017143|pid:none) Haemophilus ducreyi strain 3500... 61 9e-08 (Q7WEL6) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 60 1e-07 (Q0T3Z1) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 60 1e-07 (B0CEK4) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 60 1e-07 CP000728_3273(CP000728|pid:none) Clostridium botulinum F str. La... 60 1e-07 (A1VJK9) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 60 1e-07 CP001056_2158(CP001056|pid:none) Clostridium botulinum B str. Ek... 60 1e-07 (Q320D9) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 60 1e-07 (Q7VU56) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 60 1e-07 AY967275_1(AY967275|pid:none) Synthetic construct isolate FTT104... 60 2e-07 (A4IYL5) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 60 2e-07 (A7NC76) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 60 2e-07 AP009178_1208(AP009178|pid:none) Nitratiruptor sp. SB155-2 genom... 60 2e-07 CP001344_1185(CP001344|pid:none) Cyanothece sp. PCC 7425, comple... 60 2e-07 AY774657_1(AY774657|pid:none) Synthetic construct Francisella tu... 60 2e-07 CP001581_3500(CP001581|pid:none) Clostridium botulinum A2 str. K... 60 2e-07 (A4IXY7) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 60 2e-07 (Q1QZ76) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 60 2e-07 BA000026_507(BA000026|pid:none) Mycoplasma penetrans HF-2 DNA, c... 60 2e-07 AE015927_246(AE015927|pid:none) Clostridium tetani E88, complete... 60 2e-07 (A3N0Y3) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 60 2e-07 CP000382_1959(CP000382|pid:none) Clostridium novyi NT, complete ... 60 2e-07 (A0Q6E3) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 60 2e-07 (Q0AA41) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 60 2e-07 (A4SMC4) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 59 3e-07 CP000679_508(CP000679|pid:none) Caldicellulosiruptor saccharolyt... 59 3e-07 CP001019_850(CP001019|pid:none) Coxiella burnetii CbuG_Q212, com... 59 3e-07 CP000939_3294(CP000939|pid:none) Clostridium botulinum B1 str. O... 59 3e-07 (A7NBC6) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 59 3e-07 (Q8Y306) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 59 3e-07 AP006841_1180(AP006841|pid:none) Bacteroides fragilis YCH46 DNA,... 59 3e-07 (Q082E9) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 59 3e-07 CP000568_2141(CP000568|pid:none) Clostridium thermocellum ATCC 2... 59 3e-07 (A6VXH3) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 59 3e-07 (Q2SK22) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 59 3e-07 (Q65TL6) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 59 3e-07 CP000768_99(CP000768|pid:none) Campylobacter jejuni subsp. doyle... 59 3e-07 (Q2NSV5) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 59 3e-07 (Q4FTN3) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 59 5e-07 (Q476S4) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 59 5e-07 (Q1QCP2) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 59 5e-07 CP000742_171(CP000742|pid:none) Methanococcus vannielii SB, comp... 59 5e-07 CP000025_108(CP000025|pid:none) Campylobacter jejuni RM1221, com... 59 5e-07 CP000814_109(CP000814|pid:none) Campylobacter jejuni subsp. jeju... 59 5e-07 AL111168_108(AL111168|pid:none) Campylobacter jejuni subsp. jeju... 59 5e-07 CP000673_147(CP000673|pid:none) Clostridium kluyveri DSM 555, co... 58 6e-07 (B1KFY6) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 58 6e-07 CP000962_3532(CP000962|pid:none) Clostridium botulinum A3 str. L... 58 6e-07 (A6VP68) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 58 6e-07 (Q1IDN2) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 58 6e-07 AP009049_139(AP009049|pid:none) Clostridium kluyveri NBRC 12016 ... 58 6e-07 CP000939_3541(CP000939|pid:none) Clostridium botulinum B1 str. O... 58 6e-07 (Q9CN39) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 58 8e-07 CP000728_3512(CP000728|pid:none) Clostridium botulinum F str. La... 58 8e-07 (Q48FG8) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 58 8e-07 AM180355_3695(AM180355|pid:none) Clostridium difficile 630 compl... 58 8e-07 (Q4ZQ35) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 58 8e-07 CP000561_1993(CP000561|pid:none) Pyrobaculum calidifontis JCM 11... 51 8e-07 CP000361_518(CP000361|pid:none) Arcobacter butzleri RM4018, comp... 57 1e-06 (A4T0E0) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 57 1e-06 (A1SWS4) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 57 1e-06 (B0U092) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 57 1e-06 CP000962_3278(CP000962|pid:none) Clostridium botulinum A3 str. L... 57 1e-06 AY658774_1(AY658774|pid:none) Synthetic construct Peudomonas aer... 57 2e-06 CP001614_1073(CP001614|pid:none) Teredinibacter turnerae T7901, ... 57 2e-06 (Q181G3) RecName: Full=tRNA(Ile)-lysidine synthase; EC=... 57 2e-06 (B0KT32) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 57 2e-06 (Q02J28) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 57 2e-06 (B1J1K3) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 57 2e-06 (A5W7U0) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 57 2e-06 (A7N0R3) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 56 2e-06 CP000076_4400(CP000076|pid:none) Pseudomonas fluorescens Pf-5, c... 56 2e-06 CP001098_2076(CP001098|pid:none) Halothermothrix orenii H 168, c... 56 2e-06 (B1Y629) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 56 2e-06 (Q4K882) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 56 2e-06 (A5UBX9) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 56 2e-06 (Q4QK81) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 56 2e-06 CP001037_5446(CP001037|pid:none) Nostoc punctiforme PCC 73102, c... 56 3e-06 (A4VJ19) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 56 3e-06 DQ823379_1(DQ823379|pid:none) Rhodobacter capsulatus PP superfam... 56 3e-06 CP001083_3668(CP001083|pid:none) Clostridium botulinum Ba4 str. ... 56 3e-06 (A3PNA9) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 56 3e-06 (Q8R7K9) RecName: Full=tRNA(Ile)-lysidine synthase; EC=... 56 3e-06 AM181176_3701(AM181176|pid:none) Pseudomonas fluorescens SBW25 c... 56 3e-06 (Q3K8D5) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 55 4e-06 CP000671_775(CP000671|pid:none) Haemophilus influenzae PittEE, c... 55 4e-06 CP001281_664(CP001281|pid:none) Thauera sp. MZ1T, complete genome. 55 4e-06 BX950229_1353(BX950229|pid:none) Methanococcus maripaludis strai... 55 4e-06 CP001010_1436(CP001010|pid:none) Polynucleobacter necessarius su... 55 4e-06 CP001322_1230(CP001322|pid:none) Desulfatibacillum alkenivorans ... 55 5e-06 (Q21IJ4) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 55 5e-06 CP000816_705(CP000816|pid:none) Ignicoccus hospitalis KIN4/I, co... 55 7e-06 AM920689_4346(AM920689|pid:none) Xanthomonas campestris pv. camp... 55 7e-06 (B0RYY8) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 55 7e-06 (A1B0E2) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 55 7e-06 (Q4UNZ5) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 55 7e-06 (A4XWK1) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 55 7e-06 AE008691_1420(AE008691|pid:none) Thermoanaerobacter tengcongensi... 54 9e-06 CP001146_699(CP001146|pid:none) Dictyoglomus thermophilum H-6-12... 54 9e-06 (Q5P3T7) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 54 9e-06 (Q6LR31) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 54 1e-05 CP000381_1119(CP000381|pid:none) Neisseria meningitidis 053442, ... 54 1e-05 CP000473_3149(CP000473|pid:none) Solibacter usitatus Ellin6076, ... 54 1e-05 CP001034_79(CP001034|pid:none) Natranaerobius thermophilus JW/NM... 54 1e-05 CP000924_1318(CP000924|pid:none) Thermoanaerobacter pseudethanol... 54 1e-05 CP000609_224(CP000609|pid:none) Methanococcus maripaludis C5, co... 54 1e-05 CP000478_1596(CP000478|pid:none) Syntrophobacter fumaroxidans MP... 53 2e-05 CP001072_1158(CP001072|pid:none) Helicobacter pylori Shi470, com... 53 2e-05 AE000511_1165(AE000511|pid:none) Helicobacter pylori 26695, comp... 53 2e-05 CP001173_1099(CP001173|pid:none) Helicobacter pylori G27, comple... 53 2e-05 AE001439_1104(AE001439|pid:none) Helicobacter pylori J99, comple... 53 2e-05 (Q9MUR3) RecName: Full=tRNA(Ile)-lysidine synthase, chloroplasti... 53 2e-05 CP001217_1140(CP001217|pid:none) Helicobacter pylori P12, comple... 53 2e-05 CP000252_1526(CP000252|pid:none) Syntrophus aciditrophicus SB, c... 52 3e-05 (B7IFR8) RecName: Full=tRNA(Ile)-lysidine synthase; EC=... 52 3e-05 CP001111_58(CP001111|pid:none) Stenotrophomonas maltophilia R551... 52 6e-05 (Q74C65) RecName: Full=tRNA(Ile)-lysidine synthase; EC=... 52 6e-05 CR522870_1330(CR522870|pid:none) Desulfotalea psychrophila LSv54... 52 6e-05 CP001251_809(CP001251|pid:none) Dictyoglomus turgidum DSM 6724, ... 51 7e-05 CP000382_155(CP000382|pid:none) Clostridium novyi NT, complete g... 51 7e-05 CP001562_968(CP001562|pid:none) Bartonella grahamii as4aup, comp... 51 9e-05 (Q8YYB8) RecName: Full=tRNA(Ile)-lysidine synthase; EC=... 50 1e-04 CP000362_1357(CP000362|pid:none) Roseobacter denitrificans OCh 1... 50 1e-04 AP009179_1754(AP009179|pid:none) Sulfurovum sp. NBC37-1 genomic ... 50 2e-04 AP009510_205(AP009510|pid:none) Uncultured Termite group 1 bacte... 50 2e-04 (Q8RHN5) RecName: Full=tRNA(Ile)-lysidine synthase; EC=... 50 2e-04 CP000109_181(CP000109|pid:none) Thiomicrospira crunogena XCL-2, ... 50 2e-04 (B2FU61) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 50 2e-04 AP009247_516(AP009247|pid:none) Candidatus Vesicomyosocius okuta... 50 2e-04 CP001287_182(CP001287|pid:none) Cyanothece sp. PCC 8801, complet... 50 2e-04 (Q67JG9) RecName: Full=tRNA(Ile)-lysidine synthase; EC=... 50 2e-04 (A9IUA2) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 49 3e-04 CP000117_509(CP000117|pid:none) Anabaena variabilis ATCC 29413, ... 49 4e-04 CP001055_1529(CP001055|pid:none) Elusimicrobium minutum Pei191, ... 49 5e-04 CP000932_201(CP000932|pid:none) Campylobacter lari RM2100, compl... 49 5e-04 CP000488_528(CP000488|pid:none) Candidatus Ruthia magnifica str.... 49 5e-04 (Q3BMF4) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 48 6e-04 (Q97EB0) RecName: Full=tRNA(Ile)-lysidine synthase; EC=... 48 6e-04 CP001398_151(CP001398|pid:none) Thermococcus gammatolerans EJ3, ... 48 8e-04 AE015925_511(AE015925|pid:none) Chlamydophila caviae GPIC, compl... 48 8e-04 (Q5LW09) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 48 8e-04 CP001098_54(CP001098|pid:none) Halothermothrix orenii H 168, com... 48 8e-04 CP001078_145(CP001078|pid:none) Clostridium botulinum E3 str. Al... 47 0.001 AC024202_8(AC024202|pid:none) Caenorhabditis elegans cosmid Y71H... 45 0.001 CP000859_2217(CP000859|pid:none) Desulfococcus oleovorans Hxd3, ... 47 0.001 (A5EXQ4) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 47 0.001 CP001344_3506(CP001344|pid:none) Cyanothece sp. PCC 7425, comple... 47 0.002 CP000581_575(CP000581|pid:none) Ostreococcus lucimarinus CCE9901... 47 0.002 CP000487_1438(CP000487|pid:none) Campylobacter fetus subsp. fetu... 47 0.002 CP001130_1546(CP001130|pid:none) Hydrogenobaculum sp. Y04AAS1, c... 47 0.002 (Q2NXR3) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 47 0.002 (A8LMA2) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 47 0.002 CP000360_62(CP000360|pid:none) Acidobacteria bacterium Ellin345,... 47 0.002 (A6X1K4) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 47 0.002 CP000767_1494(CP000767|pid:none) Campylobacter curvus 525.92, co... 47 0.002 (B2I7H1) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 47 0.002 CP001191_1927(CP001191|pid:none) Rhizobium leguminosarum bv. tri... 46 0.002 AE009439_144(AE009439|pid:none) Methanopyrus kandleri AV19, comp... 46 0.002 CP001087_498(CP001087|pid:none) Desulfobacterium autotrophicum H... 46 0.002 (A5VQ10) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 46 0.003 (A4WWJ3) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 45 0.004 AP006861_487(AP006861|pid:none) Chlamydophila felis Fe/C-56 DNA,... 45 0.004 BC089700_1(BC089700|pid:none) Xenopus tropicalis hypothetical LO... 45 0.004 CP001056_152(CP001056|pid:none) Clostridium botulinum B str. Ekl... 45 0.004 CP000633_1420(CP000633|pid:none) Agrobacterium vitis S4 chromoso... 45 0.004 CR954201_554(CR954201|pid:none) Ostreococcus tauri strain OTTH05... 45 0.004 CP000568_2215(CP000568|pid:none) Clostridium thermocellum ATCC 2... 45 0.005 CP000116_2508(CP000116|pid:none) Thiobacillus denitrificans ATCC... 45 0.007 (Q92PH1) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 45 0.007 CP001389_1595(CP001389|pid:none) Rhizobium sp. NGR234, complete ... 45 0.007 CP001634_1528(CP001634|pid:none) Kosmotoga olearia TBF 19.5.1, c... 45 0.007 AL591688_1791(AL591688|pid:none) Sinorhizobium meliloti 1021 com... 45 0.007 (Q11U13) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 44 0.009 AE001363_252(AE001363|pid:none) Chlamydophila pneumoniae CWL029,... 44 0.009 BA000016_1494(BA000016|pid:none) Clostridium perfringens str. 13... 44 0.009 CP000860_85(CP000860|pid:none) Candidatus Desulforudis audaxviat... 44 0.009 (Q7V9L9) RecName: Full=tRNA(Ile)-lysidine synthase; EC=... 44 0.009 (Q6AJ19) RecName: Full=tRNA(Ile)-lysidine synthase; EC=... 44 0.009 AP008971_996(AP008971|pid:none) Finegoldia magna ATCC 29328 DNA,... 44 0.012 CP000679_1146(CP000679|pid:none) Caldicellulosiruptor saccharoly... 44 0.012 AE017285_3226(AE017285|pid:none) Desulfovibrio vulgaris subsp. v... 44 0.015 CP000922_60(CP000922|pid:none) Anoxybacillus flavithermus WK1, c... 44 0.015 CR848038_501(CR848038|pid:none) Chlamydophila abortus strain S26... 44 0.015 (Q9PFT8) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 44 0.015 CP001186_58(CP001186|pid:none) Bacillus cereus G9842, complete g... 44 0.015 AE003849_566(AE003849|pid:none) Xylella fastidiosa 9a5c, complet... 44 0.015 CP001104_1813(CP001104|pid:none) Eubacterium eligens ATCC 27750,... 44 0.015 CP001291_2925(CP001291|pid:none) Cyanothece sp. PCC 7424, comple... 44 0.015 CP001124_2615(CP001124|pid:none) Geobacter bemidjiensis Bem, com... 43 0.020 (A9BJK2) RecName: Full=tRNA(Ile)-lysidine synthase; EC=... 43 0.020 (Q10441) RecName: Full=Probable tRNA(Ile)-lysidine synthase; ... 43 0.026 (Q7CYD2) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 43 0.026 BC108465_1(BC108465|pid:none) Xenopus laevis UPF0432 protein C16... 43 0.026 (Q08B12) UPF0432 protein C16orf84 homolog B. &BC124921_1(BC1249... 43 0.026 (Q32NV1) RecName: Full=UPF0432 protein C16orf84 homolog A; 43 0.026 (Q81J84) RecName: Full=tRNA(Ile)-lysidine synthase; EC=... 43 0.026 BC070752_1(BC070752|pid:none) Xenopus laevis UPF0432 protein C16... 43 0.026 CP001176_58(CP001176|pid:none) Bacillus cereus B4264, complete g... 43 0.026 (Q6B8L1) RecName: Full=tRNA(Ile)-lysidine synthase, chloroplasti... 43 0.026 AE009441_2578(AE009441|pid:none) Pyrobaculum aerophilum str. IM2... 42 0.044 CP001100_2619(CP001100|pid:none) Chloroherpeton thalassium ATCC ... 42 0.044 (Q6NAQ6) RecName: Full=tRNA(Ile)-lysidine synthase; EC=... 42 0.044 CP001096_1293(CP001096|pid:none) Rhodopseudomonas palustris TIE-... 42 0.044 CP000612_123(CP000612|pid:none) Desulfotomaculum reducens MI-1, ... 42 0.044 AM422018_486(AM422018|pid:none) Candidatus Phytoplasma australie... 32 0.054 CP000885_137(CP000885|pid:none) Clostridium phytofermentans ISDg... 42 0.057 CP000112_244(CP000112|pid:none) Desulfovibrio desulfuricans G20,... 42 0.057 (Q0BYJ5) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 42 0.057 AM055942_108(AM055942|pid:none) Toxoplasma gondii RH, genomic DN... 42 0.057 CP000159_1672(CP000159|pid:none) Salinibacter ruber DSM 13855, c... 41 0.075 (Q32RX0) RecName: Full=tRNA(Ile)-lysidine synthase, chloroplasti... 41 0.075 AP006878_1552(AP006878|pid:none) Thermococcus kodakarensis KOD1 ... 41 0.075 GM017008_87(GM017008|pid:none) Sequence 1838 from Patent EP19234... 41 0.075 AM886060_25(AM886060|pid:none) Geobacillus stearothermophilus pl... 41 0.098 CP001089_2496(CP001089|pid:none) Geobacter lovleyi SZ, complete ... 41 0.098 CP000412_288(CP000412|pid:none) Lactobacillus delbrueckii subsp.... 40 0.13 CT978603_72(CT978603|pid:none) Synechococcus sp. RCC307 genomic ... 40 0.13 BA000001_2030(BA000001|pid:none) Pyrococcus horikoshii OT3 DNA, ... 40 0.13 CP001348_3159(CP001348|pid:none) Clostridium cellulolyticum H10,... 40 0.17 CP000806_2597(CP000806|pid:none) Cyanothece sp. ATCC 51142 circu... 40 0.17 BT077810_1(BT077810|pid:none) Lepeophtheirus salmonis Pacific fo... 39 0.20 (Q63HD6) RecName: Full=tRNA(Ile)-lysidine synthase; EC=... 40 0.22 AE009439_1054(AE009439|pid:none) Methanopyrus kandleri AV19, com... 40 0.22 CP000051_228(CP000051|pid:none) Chlamydia trachomatis A/HAR-13, ... 40 0.22 FM872308_220(FM872308|pid:none) Chlamydia trachomatis JALI20 ser... 40 0.22 CP000227_61(CP000227|pid:none) Bacillus cereus Q1, complete geno... 40 0.22 AM884176_464(AM884176|pid:none) Chlamydia trachomatis strain L2/... 40 0.22 (Q98NP4) RecName: Full=tRNA 2-thiocytidine biosynthesis protein ... 39 0.28 (Q6HPV4) RecName: Full=tRNA(Ile)-lysidine synthase; EC=... 39 0.28 CP000115_2696(CP000115|pid:none) Nitrobacter winogradskyi Nb-255... 39 0.28 CP001390_3389(CP001390|pid:none) Geobacter sp. FRC-32, complete ... 39 0.28 (Q73FE5) RecName: Full=tRNA(Ile)-lysidine synthase; EC=... 39 0.28 CP001177_58(CP001177|pid:none) Bacillus cereus AH187, complete g... 39 0.28 (Q9CJH4) RecName: Full=tRNA(Ile)-lysidine synthase; EC=... 39 0.28 CP000485_56(CP000485|pid:none) Bacillus thuringiensis str. Al Ha... 39 0.28 CP001196_3239(CP001196|pid:none) Oligotropha carboxidovorans OM5... 39 0.37 (Q2JRN8) RecName: Full=tRNA(Ile)-lysidine synthase; EC=... 39 0.37 DQ422812_53(DQ422812|pid:none) Chlorokybus atmophyticus chloropl... 39 0.37 CU234118_1113(CU234118|pid:none) Bradyrhizobium sp. ORS278,compl... 39 0.37 CP000916_85(CP000916|pid:none) Thermotoga neapolitana DSM 4359, ... 39 0.49 (Q3ZYX5) RecName: Full=tRNA(Ile)-lysidine synthase; EC=... 39 0.49 (Q7V987) RecName: Full=tRNA(Ile)-lysidine synthase; EC=... 39 0.49 AE016830_553(AE016830|pid:none) Enterococcus faecalis V583, comp... 39 0.49 E72564(E72564)hypothetical protein APE1799 - Aeropyrum pernix (s... 39 0.49 BA000002_1178(BA000002|pid:none) Aeropyrum pernix K1 DNA, comple... 39 0.49 (Q2JJ74) RecName: Full=tRNA(Ile)-lysidine synthase; EC=... 39 0.49 CP000554_77(CP000554|pid:none) Prochlorococcus marinus str. MIT ... 38 0.63 (Q32RJ9) RecName: Full=tRNA(Ile)-lysidine synthase, chloroplasti... 38 0.63 AM942759_2244(AM942759|pid:none) Proteus mirabilis strain HI4320... 38 0.63 (Q5WYB4) RecName: Full=tRNA(Ile)-lysidine synthase; EC=... 38 0.63 CP000504_17(CP000504|pid:none) Pyrobaculum islandicum DSM 4184, ... 38 0.63 CP001358_944(CP001358|pid:none) Desulfovibrio desulfuricans subs... 38 0.83 CP000359_984(CP000359|pid:none) Deinococcus geothermalis DSM 113... 38 0.83 (Q7UNE1) RecName: Full=tRNA(Ile)-lysidine synthase; EC=... 38 0.83 CP001359_2438(CP001359|pid:none) Anaeromyxobacter dehalogenans 2... 38 0.83 A81698(A81698) conserved hypothetical protein TC0489 [imported] ... 37 1.1 CP000964_4439(CP000964|pid:none) Klebsiella pneumoniae 342, comp... 37 1.1 (Q5L3T3) RecName: Full=tRNA(Ile)-lysidine synthase; EC=... 37 1.1 (Q5WAE0) RecName: Full=tRNA(Ile)-lysidine synthase; EC=... 37 1.1 CP001131_2357(CP001131|pid:none) Anaeromyxobacter sp. K, complet... 37 1.1 AM295250_158(AM295250|pid:none) Staphylococcus carnosus subsp. c... 37 1.1 AP006725_928(AP006725|pid:none) Klebsiella pneumoniae NTUH-K2044... 37 1.1 CP000817_78(CP000817|pid:none) Lysinibacillus sphaericus C3-41, ... 37 1.4 (Q0SM64) RecName: Full=tRNA(Ile)-lysidine synthase; EC=... 37 1.4 CP000825_1919(CP000825|pid:none) Prochlorococcus marinus str. MI... 37 1.4 (A0Q152) RecName: Full=tRNA-specific 2-thiouridylase mnmA; ... 37 1.4 CP000875_3013(CP000875|pid:none) Herpetosiphon aurantiacus ATCC ... 37 1.4 (A7GZX4) RecName: Full=tRNA-specific 2-thiouridylase mnmA; ... 37 1.4 CP000033_262(CP000033|pid:none) Lactobacillus acidophilus NCFM, ... 37 1.8 CP000633_2651(CP000633|pid:none) Agrobacterium vitis S4 chromoso... 37 1.8 (Q667K7) RecName: Full=tRNA(Ile)-lysidine synthase; EC=... 37 1.8 CP001145_876(CP001145|pid:none) Coprothermobacter proteolyticus ... 37 1.8 CP001127_250(CP001127|pid:none) Salmonella enterica subsp. enter... 37 1.8 CP000425_16(CP000425|pid:none) Lactococcus lactis subsp. cremori... 36 2.4 AE009439_51(AE009439|pid:none) Methanopyrus kandleri AV19, compl... 36 2.4 CP000764_57(CP000764|pid:none) Bacillus cereus subsp. cytotoxis ... 36 2.4 CP000720_1011(CP000720|pid:none) Yersinia pseudotuberculosis IP ... 36 2.4 (Q9XBG6) RecName: Full=tRNA(Ile)-lysidine synthase; EC=... 36 3.1 CP001015_11(CP001015|pid:none) Streptococcus pneumoniae G54, com... 36 3.1
>(Q94480) RecName: Full=Cytoplasmic tRNA 2-thiolation protein 1; EC=2.7.7.-; AltName: Full=Cytoplasmic tRNA adenylyltransferase 1; AltName: Full=ATP-binding domain-containing protein 3; Length = 360
Score = 381 bits (978), Expect(2) = 0.0 Identities = 187/189 (98%), Positives = 188/189 (99%) Frame = +2
Query: 35 MENTATKKKSKLCEVCNVSRPVLKRPKTGEMICKECFYTVFEDEIHHTIISNNLFKRGDR 214 MENTATKKKSKLCEVCNVSRPVLKRPKTGEMICKECFYTVFEDEIHHTIISNNLFKRGDR Sbjct: 1 MENTATKKKSKLCEVCNVSRPVLKRPKTGEMICKECFYTVFEDEIHHTIISNNLFKRGDR 60
Query: 215 VAIGASGGKDSTVLAEIMTLLNKKYDYGLDLFLLSIDEGITGYRDDSLETVKRNQEQYQI 394 VAIGASGGKDSTVLAEIMTLLNKKYDYGLDLFLLSIDEGITGYRDDSLETVKRNQEQYQI Sbjct: 61 VAIGASGGKDSTVLAEIMTLLNKKYDYGLDLFLLSIDEGITGYRDDSLETVKRNQEQYQI 120
Query: 395 PLKILSYKELYNWTMDDIVKEIGLKGNCTFCGVFRRQALDRGAVMLKANKIVTGHNADDI 574 PLKILSYKELYNWTMDDIVKEIGLKGNCTFCGVFRRQALDRGAVMLKANKIVTGHNADDI Sbjct: 121 PLKILSYKELYNWTMDDIVKEIGLKGNCTFCGVFRRQALDRGAVMLKANKIVTGHNADDI 180
Query: 575 AETVLMNFI 601 AETVLMN + Sbjct: 181 AETVLMNLL 189
Score = 298 bits (763), Expect(2) = 0.0 Identities = 149/173 (86%), Positives = 149/173 (86%) Frame = +3
Query: 597 LLRGDIPRLQRCVNIITGSEGALPRSKPFKYTYQKEIVMYAYFKKLDYFSTECIYAPNAY 776 LLRGDIPRLQRCVNIITGSEGALPRSKPFKYTYQKEIVMYAYFKKLDYFSTECIYAPNAY Sbjct: 188 LLRGDIPRLQRCVNIITGSEGALPRSKPFKYTYQKEIVMYAYFKKLDYFSTECIYAPNAY 247
Query: 777 RGHARDFLKDLEAVRPSIIIDIIHSAENFHFREENKMPVQRNCIQCGYICSNDICMACDL 956 RGHARDFLKDLEAVRPSIIIDIIHSAENFHFREENKMPVQRNCIQCGYICSNDICMACDL Sbjct: 248 RGHARDFLKDLEAVRPSIIIDIIHSAENFHFREENKMPVQRNCIQCGYICSNDICMACDL 307
Query: 957 LKNLNSGLAKVKLSINLKRGKXXXXXXXXXXXXXTLKLEXXXXXXXXXXXVSN 1115 LKNLNSGLAKVKLSINLKRGK TLKLE VSN Sbjct: 308 LKNLNSGLAKVKLSINLKRGKDNNNNSNNNDNNNTLKLESTSAATTTTTTVSN 360
Lambda K H 0.318 0.134 0.401
Gapped Lambda K H 0.267 0.0410 0.140
Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 3236559 Number of Hits to DB: 1,531,583,919 Number of extensions: 28098448 Number of successful extensions: 74689 Number of sequences better than 10.0: 539 Number of HSP's gapped: 74137 Number of HSP's successfully gapped: 666 Length of query: 404 Length of database: 1,051,180,864 Length adjustment: 131 Effective length of query: 273 Effective length of database: 627,191,635 Effective search space: 171223316355 Effective search space used: 171223316355 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 32 (16.9 bits)
|