NBDC - アーカイブトップ - ヘルプ
データベースの説明 | データ項目の説明 | 利用許諾 | ヘルプ
Dicty_cDB
Contig List | Clone List | cDNA Library List
Atlas
Atlas | Atlas Image List
NBDC - LSDB Archive
Description of this DB | Description of data items | Download | License
Dicty_cDB
Contig List | Clone List | cDNA Library List
Atlas
Atlas | Atlas Image List
Contig-U14615-1
Contig ID Contig-U14615-1
Contig update 2002.12.18
Contig sequence 
>Contig-U14615-1 (Contig-U14615-1Q) /CSM_Contig/Contig-U14615-1Q.Seq.d
TTAATTGAAGAAGGTTTAAATTGTTTACCATTCCATGAAACTACCATAAC
TACACCAACTGGTTGTGAATATCAAGGTGTTACTTTTGCAAGTAAAATCT
GTGGTGTCAGTATCGTAAGAGCTGGTGAATCAATGGAAGCTGGTTTACGT
GCAGTTTGTAAACATATTAAAATTGGTAAAATTTTAATTCAAAGAGATGA
AGAAACTGCTTTACCAAAATTATTATATGCAAAATTACCACACGATATTG
CAAATAGACAAGTATTATTATTAGATCCAATGTTGGCAACTGGTGGTACA
GTAACTCAAGCTGTTGAAGTTTTATTAGAAAGAGGTGTAAAAGAAGAGAA
TATTGTATTTATTAATTTAGTTGCATCACCAGAAGGTATTAAAGTTTTCA
CTGATAAATATCCAAGAGTAAAGGTTGTCACTGGAGAAATTGATTCACAT
TTAAATGAAAAGAAATACATTATTCCAGGTTTAGGTGATTTTGGAAATCT
TTATTTTGGTACTGAAGATTAATTAAAATTTTTAATCTTATTTTTTAACT
TGCTGATAGTAATTCCTATTTTAACTCAAAGCATTAAATTAATTAATTTG
GTTTCCAGCGTACTCAAATAAAAAAAAGTAACACACACACTAACAAAAAT
GAAAA
Gap no gap
Contig length 655
Chromosome number (1..6, M) 1
Chromosome length 4919822
Start point 330353
End point 331007
Strand (PLUS/MINUS) PLUS
Number of clones 2
Number of EST 2
Link to clone list U14615
List of clone(s) 

est1=VSE541Z,1,644
est2=SHH525F,153,655
Translated Amino Acid sequence 
LIEEGLNCLPFHETTITTPTGCEYQGVTFASKICGVSIVRAGESMEAGLRAVCKHIKIGK
ILIQRDEETALPKLLYAKLPHDIANRQVLLLDPMLATGGTVTQAVEVLLERGVKEENIVF
INLVASPEGIKVFTDKYPRVKVVTGEIDSHLNEKKYIIPGLGDFGNLYFGTED*lkflil
ffnllivipiltqsiklinlvssvlk*kkvthtltkmk
Translated Amino Acid sequence (All Frames) 
Frame A:
LIEEGLNCLPFHETTITTPTGCEYQGVTFASKICGVSIVRAGESMEAGLRAVCKHIKIGK
ILIQRDEETALPKLLYAKLPHDIANRQVLLLDPMLATGGTVTQAVEVLLERGVKEENIVF
INLVASPEGIKVFTDKYPRVKVVTGEIDSHLNEKKYIIPGLGDFGNLYFGTED*lkflil
ffnllivipiltqsiklinlvssvlk*kkvthtltkmk


Frame B:
*lkkv*ivyhsmklp*lhqlvvnikvlllqvksvvsvs*elvnqwklvyvqfvnilklvk
f*fkemkkllyqnyymqnyhtilqidkyyy*iqcwqlvvq*lkllkfy*kev*kkrilyl
li*lhhqkvlkfsliniqe*rlsleklihi*mkrntlfqv*vileifilvlkin*nf*sy
fltc***flf*lkaln*liwfpaysnkkk*hth*qk*k


Frame C:
n*rrfklftip*nyhnytnwl*isrcyfck*nlwcqyrksw*ingswftcsl*ty*nw*n
fnskr*rncftkiiickittryck*tsiiirsnvgnwwysnssc*sfirkrckrreyciy
*fscitrry*sfh**iskskgchwrn*ftfk*keihysrfr*fwkslfwy*rlikifnli
f*ladsnsyfnskh*in*fgfqrtqikksnthtnkne
own update 2004. 6.10
Homology vs CSM-cDNA 
Query= Contig-U14615-1 (Contig-U14615-1Q)
/CSM_Contig/Contig-U14615-1Q.Seq.d
         (655 letters)

Database: CSM
           6905 sequences; 5,674,871 total letters


                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

Contig-U14615-1 (Contig-U14615-1Q) /CSM_Contig/Conti...  1251  0.0
Contig-U13971-1 (Contig-U13971-1Q) /CSM_Contig/Conti...    38  0.012
Contig-U12044-1 (Contig-U12044-1Q) /CSM_Contig/Conti...    38  0.012
Contig-U11647-1 (Contig-U11647-1Q) /CSM_Contig/Conti...    38  0.012
Contig-U11135-1 (Contig-U11135-1Q) /CSM_Contig/Conti...    38  0.012
Contig-U14578-1 (Contig-U14578-1Q) /CSM_Contig/Conti...    36  0.046
Contig-U12757-1 (Contig-U12757-1Q) /CSM_Contig/Conti...    36  0.046
Contig-U11514-1 (Contig-U11514-1Q) /CSM_Contig/Conti...    36  0.046
Contig-U11117-1 (Contig-U11117-1Q) /CSM_Contig/Conti...    36  0.046
Contig-U00724-1 (Contig-U00724-1Q) /CSM_Contig/Conti...    36  0.046

>Contig-U14615-1 (Contig-U14615-1Q) /CSM_Contig/Contig-U14615-1Q.Seq.d
          Length = 655

 Score = 1251 bits (631), Expect = 0.0
 Identities = 647/655 (98%)
 Strand = Plus / Plus

                                                                       
Query: 1   ttaattgaagaaggtttaaattgtttaccattccatgaaactaccataactacaccaact 60
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1   ttaattgaagaaggtttaaattgtttaccattccatgaaactaccataactacaccaact 60

                                                                       
Query: 61  ggttgtgaatatcaaggtgttacttttgcaagtaaaatctgtggtgtcagtatcgtaaga 120
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 61  ggttgtgaatatcaaggtgttacttttgcaagtaaaatctgtggtgtcagtatcgtaaga 120

                                                                       
Query: 121 gctggtgaatcaatggaagctggtttacgtgcagtttgtaaacatattaaaattggtaaa 180
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 121 gctggtgaatcaatggaagctggtttacgtgcagtttgtaaacatattaaaattggtaaa 180

                                                                       
Query: 181 attttaattcaaagagatgaagaaactgctttaccaaaattattatatgcaaaattacca 240
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 181 attttaattcaaagagatgaagaaactgctttaccaaaattattatatgcaaaattacca 240

                                                                       
Query: 241 cacgatattgcaaatagacaagtattattattagatccaatgttggcaactggtggtaca 300
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 241 cacgatattgcaaatagacaagtattattattagatccaatgttggcaactggtggtaca 300

                                                                       
Query: 301 gtaactcaagctgttgaagttttattagaaagaggtgtaaaagaagagaatattgtattt 360
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 301 gtaactcaagctgttgaagttttattagaaagaggtgtaaaagaagagaatattgtattt 360

                                                                       
Query: 361 attaatttagttgcatcaccagaaggtattaaagttttcactgataaatatccaagagta 420
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 361 attaatttagttgcatcaccagaaggtattaaagttttcactgataaatatccaagagta 420

                                                                       
Query: 421 aaggttgtcactggagaaattgattcacatttaaatgaaaagaaatacattattccaggt 480
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 421 aaggttgtcactggagaaattgattcacatttaaatgaaaagaaatacattattccaggt 480

                                                                       
Query: 481 ttaggtgattttggaaatctttattttggtactgaagattaattaaaatttttaatctta 540
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 481 ttaggtgattttggaaatctttattttggtactgaagattaattaaaatttttaatctta 540

                                                                       
Query: 541 ttttttaacttgctgatagtaattcctattttaactcaaagcattaaattaattaatttg 600
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 541 ttttttaacttgctgatagtaattcctattttaactcaaagcattaaattaattaatttg 600

                                                                  
Query: 601 gtttccagcgtactcaaatnnnnnnnngtaacacacacactaacaaaaatgaaaa 655
           |||||||||||||||||||        ||||||||||||||||||||||||||||
Sbjct: 601 gtttccagcgtactcaaataaaaaaaagtaacacacacactaacaaaaatgaaaa 655


>Contig-U13971-1 (Contig-U13971-1Q) /CSM_Contig/Contig-U13971-1Q.Seq.d
          Length = 1468

 Score = 38.2 bits (19), Expect = 0.012
 Identities = 19/19 (100%)
 Strand = Plus / Plus

                               
Query: 518  attaattaaaatttttaat 536
            |||||||||||||||||||
Sbjct: 1322 attaattaaaatttttaat 1340


>Contig-U12044-1 (Contig-U12044-1Q) /CSM_Contig/Contig-U12044-1Q.Seq.d
          Length = 825

 Score = 38.2 bits (19), Expect = 0.012
 Identities = 25/27 (92%)
 Strand = Plus / Plus

                                      
Query: 520 taattaaaatttttaatcttatttttt 546
           ||||||||||||||||| || ||||||
Sbjct: 48  taattaaaatttttaattttttttttt 74


  Database: CSM
    Posted date:  Jun 9, 2004  7:35 PM
  Number of letters in database: 5,674,871
  Number of sequences in database:  6905
  
Lambda     K      H
    1.37    0.711     1.31 

Gapped
Lambda     K      H
    1.37    0.711     1.31 


Matrix: blastn matrix:1 -3
Gap Penalties: Existence: 5, Extension: 2
Number of Hits to DB: 23,015
Number of Sequences: 6905
Number of extensions: 23015
Number of successful extensions: 1772
Number of sequences better than 10.0: 197
length of query: 655
length of database: 5,674,871
effective HSP length: 16
effective length of query: 639
effective length of database: 5,564,391
effective search space: 3555645849
effective search space used: 3555645849
T: 0
A: 40
X1: 6 (11.9 bits)
X2: 15 (29.7 bits)
S1: 12 (24.3 bits)
S2: 15 (30.2 bits)
dna update 2008.12.27
Homology vs DNA 
Query= Contig-U14615-1 (Contig-U14615-1Q) /CSM_Contig/Contig-U14615-1Q.Seq.d
         (655 letters)

Database: ddbj_A
           92,845,959 sequences; 95,242,211,685 total letters

Searching..................................................done

                                                             Score    E
Sequences producing significant alignments:                  (bits) Value  N

(AU263183) Dictyostelium discoideum vegetative cDNA clone:VS...   965   0.0    3
(BJ395536) Dictyostelium discoideum cDNA clone:dds39a07, 5' ...   664   0.0    3
(EU327978) Candida tropicalis strain CBS 94 uracil phosphori...   105   3e-41  6
(EU327981) Candida tropicalis isolate ODL6-560,S-5FC uracil ...   105   3e-41  6
(EU327979) Candida tropicalis isolate ODL6-539,S-5FC uracil ...   105   3e-41  6
(EU327980) Candida tropicalis isolate ODL4-302,S-5FC uracil ...   105   3e-41  6
(AJ616008) Candida albicans fur1 gene for putative uracil  p...    82   1e-34  5
(AR548865) Sequence 3996 from patent US 6747137.                   82   1e-34  5
(EC854999) HDE00000652 Hyperamoeba dachnaya Non-normalized (...   109   3e-24  2
(DJ133697) Method for identification of useful proteins deri...    74   6e-24  5
(AQ502959) V47B9 mTn-3xHA/lacZ Insertion Library Saccharomyc...    76   8e-18  3
(DQ512720) Lachancea kluyveri uracil phosphoribosyltransfera...    64   8e-17  4
(AL438114) T7 end of clone BC0AA013E04 of library BC0AA from...    62   4e-16  3
(AL401745) T3 end of clone AS0AA029G01 of library AS0AA from...    82   9e-16  2
(AC141230) Homo sapiens chromosome 16 clone ICI-24GH2, WORKI...    68   1e-15  3
(DJ025876) Genome-wide DNA marker of Saccharomyces cerevisiae.     68   1e-15  3
(U10398) Saccharomyces cerevisiae chromosome VIII cosmid 9315.     68   1e-15  3
(X79811) S.cerevisiae ACT3 gene.                                   68   2e-15  3
(M36485) S.cerevisiae uracil phosphoribosyltransferase (FUR1...    68   2e-15  3
(AF312392) Synthetic construct Saccharomyces cerevisiae cyto...    68   2e-15  3
(AY693082) Saccharomyces cerevisiae clone FLH111420.01X YHR1...    68   2e-15  3
(DJ206374) Method for identification of useful proteins deri...    68   2e-15  3
(AX830978) Sequence 1698 from Patent WO03072602.                   68   2e-15  3
(AX819948) Sequence 1698 from Patent EP1338608.                    68   2e-15  3
(DB654091) Saccharomyces cerevisiae mRNA, clone: Y016_G20_F....    68   2e-15  3
(DB656901) Saccharomyces cerevisiae mRNA, clone: Y037_O01_F....    68   2e-15  3
(DB643721) Saccharomyces cerevisiae mRNA, clone: S03052-28_I...    68   2e-15  3
(EL564491) Physarum15579 Physarum polycephalum starvation st...    74   3e-14  2
(EL565615) Physarum15580 Physarum polycephalum starvation st...    74   3e-14  2
(EL566014) Physarum15581 Physarum polycephalum starvation st...    74   3e-14  2
(S57516) Saccharomyces cerevisiae uracil phosphoribosyl tran...    62   9e-14  3
(AM668381) Entamoeba terrapinae GSS, clone terra141e07.q1k.        58   1e-11  2
(DY895288) CeleSEQ15079 Cunninghamella elegans pBluescript (...    38   7e-10  5
(CR382137) Debaryomyces hansenii chromosome E of strain CBS7...    44   1e-07  2
(CR380954) Candida glabrata strain CBS138 chromosome H compl...    52   4e-07  2
(DQ657240) Candida glabrata strain 1085P10 uracil phosphorib...    48   7e-06  2
(DQ657238) Candida glabrata strain 1085S uracil phosphoribos...    48   7e-06  2
(DQ657239) Candida glabrata strain 1085P1 uracil phosphoribo...    48   7e-06  2
(EH016963) USDA-FP_189411 Lysiphlebus testaceipes adult whol...    42   3e-05  2
(DN913015) MCF7RNAL16F20TR Human MCF7 breast cancer cell lin...    42   3e-04  2
(FK928680) EST_lsal_evj_957762 lsalevj mixed_tissue_mixed_st...    46   0.001  2
(FK928679) EST_lsal_evj_952002 lsalevj mixed_tissue_mixed_st...    46   0.001  2
(CR382125) Kluyveromyces lactis strain NRRL Y-1140 chromosom...    56   0.002  1
(EF058938) Synthetic construct Saccharomyces cerevisiae clon...    42   0.008  3
(AB141729) Homo sapiens DNA, STS on chromosome X, DXS0258i, ...    50   0.10   1
(AC133954) Mus musculus BAC clone RP23-154C17 from chromosom...    50   0.10   1
(AC193613) Pan troglodytes BAC clone CH251-451G18 from chrom...    50   0.10   1
(AC193562) Pan troglodytes BAC clone CH251-408K13 from chrom...    50   0.10   1
(DJ473872) Method for analysing genome using microsatellite ...    50   0.10   1
(AL445213) Human DNA sequence from clone RP13-52K8 on chromo...    50   0.10   1
(AC026509) Homo sapiens chromosome X clone RP11-107J9 map X,...    50   0.10   1
(AC019087) Homo sapiens chromosome X clone RP11-362A20, WORK...    50   0.10   1
(AM821856) Nicotiana tabacum EST, clone nt005127075.               50   0.10   1
(FG166665) AGN_RNC009xl04r1.ab1 AGN_RNC Nicotiana tabacum cD...    50   0.10   1
(FG166593) AGN_RNC009xl04f1.ab1 AGN_RNC Nicotiana tabacum cD...    50   0.10   1
(Z48952) S.cerevisiae chromosome XIII cosmid 9916.                 42   0.19   3
(DQ681836) Synthetic construct Francisella tularensis clone ...    46   0.19   2
(AY966994) Synthetic construct isolate FTT0716 unknown prote...    46   0.22   2
(AX345369) Sequence 440 from Patent WO0200928.                     44   0.26   2
(BX511006) Zebrafish DNA sequence from clone DKEY-106F13 in ...    48   0.40   1
(CR848008) Zebrafish DNA sequence *** SEQUENCING IN PROGRESS...    48   0.40   1
(ED701958) GM_WBb0044O06.f GM_WBb Glycine max genomic clone ...    48   0.40   1
(BP745810) Nicotiana sylvestris mRNA, expressed in leaf, clo...    48   0.40   1
(CR936503) Lactobacillus sakei strain 23K complete genome.         48   0.40   1
(AF401665) Lactobacillus sakei uracil phosphoribosyltransfer...    48   0.40   1
(AL732629) Zebrafish DNA sequence from clone CH211-146F4 in ...    42   0.49   3
(AM285333) Spiroplasma citri GII3-3X chromosome, contig Cont...    32   0.68   4
(AI062867) GH02220.5prime GH Drosophila melanogaster head pO...    36   0.75   2
(EK455650) 1095468143230 Global-Ocean-Sampling_GS-32-01-01-1...    32   0.99   3
(DT797815) 127355939 TL1 Tribolium castaneum cDNA clone 87C2...    44   1.00   2
(EK457004) 1095468527482 Global-Ocean-Sampling_GS-32-01-01-1...    32   1.1    3
(EE007726) ROE00002768 Rhizopus oryzae Company Rhizopus oryz...    32   1.1    2
(EK517543) 1095515505458 Global-Ocean-Sampling_GS-32-01-01-1...    38   1.2    3
(CR854821) Zebrafish DNA sequence from clone DKEY-35H2 in li...    40   1.3    5
(AL513469) Human DNA sequence *** SEQUENCING CANCELLED *** f...    44   1.6    4
(CR382398) Plasmodium falciparum chromosome 6, complete sequ...    40   1.6    8
(AL807389) Zebrafish DNA sequence from clone CH211-237L4 in ...    46   1.6    1
(Y11210) N.tabacum mRNA for uracil phosphoribosyltransferase.      46   1.6    1
(CP000499) Pichia stipitis CBS 6054 chromosome 5, complete s...    46   1.6    1
(AC137644) Artibeus jamaicensis clone 25B10, complete sequence.    46   1.6    1
(CU914587) Pig DNA sequence *** SEQUENCING IN PROGRESS *** f...    46   1.6    1
(CU076063) Pig DNA sequence *** SEQUENCING IN PROGRESS *** f...    46   1.6    1
(EJ567015) 1092959727057 Global-Ocean-Sampling_GS-29-01-01-1...    46   1.6    1
(EJ535125) 1092955254295 Global-Ocean-Sampling_GS-29-01-01-1...    46   1.6    1
(EI315570) GM_WBc0048K08.f GM_WBc Glycine max genomic clone ...    46   1.6    1
(AL417242) T3 end of clone AX0AA022A07 of library AX0AA from...    46   1.6    1
(DH136542) Oryzias latipes Fosmid clone:GOLWFno362_f14, forw...    46   1.6    1
(CL826575) OR_CBa0047E20.f OR_CBa Oryza rufipogon genomic cl...    46   1.6    1
(CC203656) CH261-9E7_Sp6.2 CH261 Gallus gallus genomic clone...    46   1.6    1
(BG042211) su93b05.y1 Gm-c1055 Glycine max cDNA clone GENOME...    46   1.6    1
(FG187405) AGN_PNL212ar1_f12.trimmed.seq AGN_PNL Nicotiana t...    46   1.6    1
(FG169279) AGN_RNC004xd05r1.ab1 AGN_RNC Nicotiana tabacum cD...    46   1.6    1
(FG169208) AGN_RNC004xd05f1.ab1 AGN_RNC Nicotiana tabacum cD...    46   1.6    1
(CP000915) Francisella tularensis subsp. mediasiatica FSC147...    46   1.6    1
(CP000803) Francisella tularensis subsp. holarctica FTNF002-...    46   1.6    1
(CP000608) Francisella tularensis subsp. tularensis WY96-341...    46   1.6    1
(CP000439) Francisella tularensis subsp. novicida U112, comp...    46   1.6    1
(CP000437) Francisella tularensis subsp. holarctica OSU18, c...    46   1.6    1
(AM286280) Francisella tularensis subsp. tularensis strain F...    46   1.6    1
(AM233362) Francisella tularensis subsp. holarctica LVS comp...    46   1.6    1

>(AU263183) Dictyostelium discoideum vegetative cDNA clone:VSE541,
           3' end single read.
          Length = 644

 Score =  965 bits (487), Expect(3) = 0.0
 Identities = 487/487 (100%)
 Strand = Plus / Plus


Query: 1   ttaattgaagaaggtttaaattgtttaccattccatgaaactaccataactacaccaact 60
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1   ttaattgaagaaggtttaaattgtttaccattccatgaaactaccataactacaccaact 60


Query: 61  ggttgtgaatatcaaggtgttacttttgcaagtaaaatctgtggtgtcagtatcgtaaga 120
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 61  ggttgtgaatatcaaggtgttacttttgcaagtaaaatctgtggtgtcagtatcgtaaga 120


Query: 121 gctggtgaatcaatggaagctggtttacgtgcagtttgtaaacatattaaaattggtaaa 180
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 121 gctggtgaatcaatggaagctggtttacgtgcagtttgtaaacatattaaaattggtaaa 180


Query: 181 attttaattcaaagagatgaagaaactgctttaccaaaattattatatgcaaaattacca 240
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 181 attttaattcaaagagatgaagaaactgctttaccaaaattattatatgcaaaattacca 240


Query: 241 cacgatattgcaaatagacaagtattattattagatccaatgttggcaactggtggtaca 300
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 241 cacgatattgcaaatagacaagtattattattagatccaatgttggcaactggtggtaca 300


Query: 301 gtaactcaagctgttgaagttttattagaaagaggtgtaaaagaagagaatattgtattt 360
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 301 gtaactcaagctgttgaagttttattagaaagaggtgtaaaagaagagaatattgtattt 360


Query: 361 attaatttagttgcatcaccagaaggtattaaagttttcactgataaatatccaagagta 420
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 361 attaatttagttgcatcaccagaaggtattaaagttttcactgataaatatccaagagta 420


Query: 421 aaggttgtcactggagaaattgattcacatttaaatgaaaagaaatacattattccaggt 480
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 421 aaggttgtcactggagaaattgattcacatttaaatgaaaagaaatacattattccaggt 480


Query: 481 ttaggtg 487
           |||||||
Sbjct: 481 ttaggtg 487

 Score =  141 bits (71), Expect(3) = 0.0
 Identities = 71/71 (100%)
 Strand = Plus / Plus


Query: 549 cttgctgatagtaattcctattttaactcaaagcattaaattaattaatttggtttccag 608
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 549 cttgctgatagtaattcctattttaactcaaagcattaaattaattaatttggtttccag 608


Query: 609 cgtactcaaat 619
           |||||||||||
Sbjct: 609 cgtactcaaat 619

 Score = 34.2 bits (17), Expect(3) = 0.0
 Identities = 17/17 (100%)
 Strand = Plus / Plus


Query: 628 gtaacacacacactaac 644
           |||||||||||||||||
Sbjct: 628 gtaacacacacactaac 644

Lambda     K      H
    1.37    0.711     1.31

Matrix: blastn matrix:1 -3
Number of Sequences: 92845959
Number of Hits to DB: 809,941,746
Number of extensions: 54948430
Number of successful extensions: 4386809
Number of sequences better than 10.0: 154
Length of query: 655
Length of database: 95,242,211,685
Length adjustment: 23
Effective length of query: 632
Effective length of database: 93,106,754,628
Effective search space: 58843468924896
Effective search space used: 58843468924896
X1: 11 (21.8 bits)
S2: 22 (44.1 bits)
protein update 2009. 7.12
Homology vs Protein 
Query= Contig-U14615-1 (Contig-U14615-1Q) /CSM_Contig/Contig-U14615-1Q.Seq.d
         (655 letters)

Database: nrp_B
           3,236,559 sequences; 1,051,180,864 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

(Q55GQ6) RecName: Full=Uracil phosphoribosyltransferase;        ...   344   1e-93
CP000499_267(CP000499|pid:none) Pichia stipitis CBS 6054 chromos...   229   5e-59
AJ616008_1(AJ616008|pid:none) Candida albicans fur1 gene for put...   229   7e-59
EU327978_1(EU327978|pid:none) Candida tropicalis strain CBS 94 u...   227   3e-58
FM992692_312(FM992692|pid:none) Candida dubliniensis CD36 chromo...   226   3e-58
FN392319_572(FN392319|pid:none) Pichia pastoris GS115 chromosome...   223   4e-57
AM920435_46(AM920435|pid:none) Penicillium chrysogenum Wisconsin...   222   7e-57
CR382137_404(CR382137|pid:none) Debaryomyces hansenii strain CBS...   222   7e-57
PDBN(1BD3)A MOL_ID: 1;MOL_ID: 1; MOLECULE: URACIL PHOSPHORIBOSYL...   220   2e-56
CR382132_1283(CR382132|pid:none) Yarrowia lipolytica strain CLIB...   219   4e-56
BX294022_21(BX294022|pid:none) Neurospora crassa DNA linkage gro...   216   4e-55
AE017345_219(AE017345|pid:none) Cryptococcus neoformans var. neo...   216   5e-55
AE016819_285(AE016819|pid:none) Ashbya gossypii (= Eremothecium ...   214   1e-54
(A5H0J4) RecName: Full=Uracil phosphoribosyltransferase;        ...   213   5e-54
CR380954_392(CR380954|pid:none) Candida glabrata strain CBS138 c...   211   1e-53
AJ250199_2(AJ250199|pid:none) Streptomyces tendae nikkomycin bio...   206   4e-52
CU640366_545(CU640366|pid:none) Podospora anserina genomic DNA c...   205   1e-51
AM456869_1(AM456869|pid:none) Vitis vinifera contig VV78X229720....   203   3e-51
(O65583) RecName: Full=Uracil phosphoribosyltransferase;        ...   203   3e-51
AK228608_1(AK228608|pid:none) Arabidopsis thaliana mRNA for urac...   203   3e-51
AB011477_10(AB011477|pid:none) Arabidopsis thaliana genomic DNA,...   202   5e-51
AK175542_1(AK175542|pid:none) Arabidopsis thaliana mRNA for puta...   201   2e-50
CR954217_261(CR954217|pid:none) Ostreococcus tauri strain OTTH05...   198   1e-49
AK102065_1(AK102065|pid:none) Oryza sativa Japonica Group cDNA c...   197   2e-49
EU959693_1(EU959693|pid:none) Zea mays clone 219409 unknown mRNA.     197   3e-49
AP003920_7(AP003920|pid:none) Oryza sativa Japonica Group genomi...   196   5e-49
CP000596_256(CP000596|pid:none) Ostreococcus lucimarinus CCE9901...   193   4e-48
AM270393_36(AM270393|pid:none) Aspergillus niger contig An17c011...   191   2e-47
EU952606_1(EU952606|pid:none) Zea mays clone 1284326 unknown mRNA.    191   2e-47
AB024028_16(AB024028|pid:none) Arabidopsis thaliana genomic DNA,...   190   3e-47
AC002304_5(AC002304|pid:none) Genomic sequence for Arabidopsis t...   175   1e-42
AM502252_90(AM502252|pid:none) Leishmania infantum chromosome 34.     175   1e-42
AC080131_6(AC080131|pid:none) Trypanosoma brucei chromosome 4 cl...   173   5e-42
CT005271_108(CT005271|pid:none) Leishmania major strain Friedlin...   173   5e-42
AM494957_101(AM494957|pid:none) Leishmania braziliensis chromoso...   170   4e-41
AM270290_18(AM270290|pid:none) Aspergillus niger contig An12c034...   167   3e-40
BT082445_1(BT082445|pid:none) Anoplopoma fimbria clone afim-evh-...   163   5e-39
AE013599_2604(AE013599|pid:none) Drosophila melanogaster chromos...   162   6e-39
AE013599_2605(AE013599|pid:none) Drosophila melanogaster chromos...   162   6e-39
AL831748_2(AL831748|pid:none) Zebrafish DNA sequence from clone ...   161   1e-38
AY675206_1(AY675206|pid:none) Oryzias latipes hypothetical prote...   161   1e-38
BX649575_6(BX649575|pid:none) Zebrafish DNA sequence from clone ...   161   1e-38
AY466381_1(AY466381|pid:none) Chlamydomonas reinhardtii uridine ...   160   3e-38
CP000826_1689(CP000826|pid:none) Serratia proteamaculans 568, co...   160   4e-38
AB063065_1(AB063065|pid:none) Macaca fascicularis brain cDNA clo...   160   4e-38
AL731717_1(AL731717|pid:none) Mouse DNA sequence from clone RP23...   159   5e-38
BT076535_1(BT076535|pid:none) Caligus rogercresseyi clone crog-e...   159   9e-38
(Q5ZIJ8) RecName: Full=Uracil phosphoribosyltransferase;        ...   159   9e-38
BT048287_1(BT048287|pid:none) Salmo salar clone ssal-evd-551-070...   157   3e-37
(Q91YL3) RecName: Full=Uridine-cytidine kinase-like 1;          ...   154   2e-36
BC146741_1(BC146741|pid:none) Danio rerio similar to URKL1, mRNA...   154   3e-36
AK303688_1(AK303688|pid:none) Homo sapiens cDNA FLJ53265 complet...   152   6e-36
AY335675_1(AY335675|pid:none) Synthetic construct Homo sapiens u...   152   6e-36
AE014296_1081(AE014296|pid:none) Drosophila melanogaster chromos...   147   3e-34
BT059390_1(BT059390|pid:none) Salmo salar clone ssal-rgf-518-011...   146   6e-34
FM164414_19(FM164414|pid:none) Corynebacterium aurimucosum plasm...   145   1e-33
AL137013_5(AL137013|pid:none) Human DNA sequence from clone RP11...   145   1e-33
AK056354_1(AK056354|pid:none) Homo sapiens cDNA FLJ31792 fis, cl...   145   1e-33
FN357878_3(FN357878|pid:none) Schistosoma mansoni genome sequenc...   142   7e-33
AY466394_1(AY466394|pid:none) Cryptosporidium parvum uracil phos...   142   9e-33
FN359080_1(FN359080|pid:none) Schistosoma mansoni genome sequenc...   142   1e-32
(A5VIQ0) RecName: Full=Uracil phosphoribosyltransferase;        ...   141   2e-32
T19992(T19992) hypothetical protein C47B2.2b - Caenorhabditis el...   139   9e-32
T19987(T19987) hypothetical protein C47B2.2a - Caenorhabditis el...   139   9e-32
CP001107_108(CP001107|pid:none) Eubacterium rectale ATCC 33656, ...   135   8e-31
(Q831G0) RecName: Full=Uracil phosphoribosyltransferase;        ...   135   1e-30
T21110(T21110) hypothetical protein F19B6.1b - Caenorhabditis el...   133   4e-30
(Q03EK5) RecName: Full=Uracil phosphoribosyltransferase;        ...   132   7e-30
(Q8RG35) RecName: Full=Uracil phosphoribosyltransferase;        ...   132   9e-30
AE009951_1059(AE009951|pid:none) Fusobacterium nucleatum subsp. ...   132   9e-30
(Q02WM7) RecName: Full=Uracil phosphoribosyltransferase;        ...   132   1e-29
(Q9CEC9) RecName: Full=Uracil phosphoribosyltransferase;        ...   131   2e-29
CP001015_670(CP001015|pid:none) Streptococcus pneumoniae G54, co...   131   2e-29
AY815607_1(AY815607|pid:none) Schistosoma japonicum SJCHGC06345 ...   131   2e-29
(Q9RE01) RecName: Full=Uracil phosphoribosyltransferase;        ...   130   3e-29
(A4VWM9) RecName: Full=Uracil phosphoribosyltransferase;        ...   130   3e-29
CP000918_747(CP000918|pid:none) Streptococcus pneumoniae 70585, ...   130   4e-29
AE007317_655(AE007317|pid:none) Streptococcus pneumoniae R6, com...   129   6e-29
(A8AYQ0) RecName: Full=Uracil phosphoribosyltransferase;        ...   129   6e-29
(Q8DST6) RecName: Full=Uracil phosphoribosyltransferase;        ...   128   1e-28
(P36399) RecName: Full=Uracil phosphoribosyltransferase;        ...   128   1e-28
(Q03M79) RecName: Full=Uracil phosphoribosyltransferase;        ...   128   1e-28
(Q97RQ3) RecName: Full=Uracil phosphoribosyltransferase;        ...   128   1e-28
(B5YDB8) RecName: Full=Uracil phosphoribosyltransferase;        ...   127   4e-28
DQ489736_543(DQ489736|pid:none) Leuconostoc citreum KM20, comple...   127   4e-28
(A3DIL9) RecName: Full=Uracil phosphoribosyltransferase;        ...   126   5e-28
(B8E009) RecName: Full=Uracil phosphoribosyltransferase;        ...   125   8e-28
CP001056_435(CP001056|pid:none) Clostridium botulinum B str. Ekl...   125   1e-27
CP001068_2353(CP001068|pid:none) Ralstonia pickettii 12J chromos...   125   1e-27
CP001129_1559(CP001129|pid:none) Streptococcus equi subsp. zooep...   124   2e-27
(Q9K6G5) RecName: Full=Uracil phosphoribosyltransferase;        ...   124   2e-27
CP000414_1360(CP000414|pid:none) Leuconostoc mesenteroides subsp...   124   3e-27
DQ074977_41(DQ074977|pid:none) Janthinobacterium lividum contig ...   124   3e-27
(Q8EUA1) RecName: Full=Uracil phosphoribosyltransferase;        ...   123   4e-27
(Q03A25) RecName: Full=Uracil phosphoribosyltransferase;        ...   123   5e-27
(B5ZXI2) RecName: Full=Uracil phosphoribosyltransferase;        ...   122   7e-27
(Q8EM74) RecName: Full=Uracil phosphoribosyltransferase;        ...   122   7e-27
(Q1MMV8) RecName: Full=Uracil phosphoribosyltransferase;        ...   122   9e-27
(Q5SIQ7) RecName: Full=Uracil phosphoribosyltransferase;        ...   122   9e-27
CP000557_3265(CP000557|pid:none) Geobacillus thermodenitrificans...   122   9e-27
CP001074_233(CP001074|pid:none) Rhizobium etli CIAT 652, complet...   122   9e-27
(Q5WB67) RecName: Full=Uracil phosphoribosyltransferase;        ...   122   9e-27
AP008971_1081(AP008971|pid:none) Finegoldia magna ATCC 29328 DNA...   122   9e-27
(Q898X9) RecName: Full=Uracil phosphoribosyltransferase;        ...   122   1e-26
(A7H0F9) RecName: Full=Uracil phosphoribosyltransferase;        ...   121   2e-26
(B7GMG3) RecName: Full=Uracil phosphoribosyltransferase;        ...   121   2e-26
CP000090_2498(CP000090|pid:none) Ralstonia eutropha JMP134 chrom...   120   3e-26
(A7GV65) RecName: Full=Uracil phosphoribosyltransferase;        ...   119   6e-26
CP000661_277(CP000661|pid:none) Rhodobacter sphaeroides ATCC 170...   119   8e-26
(A0RR59) RecName: Full=Uracil phosphoribosyltransferase;        ...   119   1e-25
(B6IW12) RecName: Full=Uracil phosphoribosyltransferase;        ...   118   1e-25
(A7Z9Q8) RecName: Full=Uracil phosphoribosyltransferase;        ...   118   1e-25
(A0RLA2) RecName: Full=Uracil phosphoribosyltransferase;        ...   118   1e-25
(B7HFL2) RecName: Full=Uracil phosphoribosyltransferase;        ...   118   2e-25
(B5ZAU8) RecName: Full=Uracil phosphoribosyltransferase;        ...   118   2e-25
CP000394_2366(CP000394|pid:none) Granulibacter bethesdensis CGDN...   117   2e-25
CP001393_591(CP001393|pid:none) Anaerocellum thermophilum DSM 67...   117   2e-25
CP000378_1669(CP000378|pid:none) Burkholderia cenocepacia AU 105...   117   2e-25
(Q38WJ8) RecName: Full=Uracil phosphoribosyltransferase;        ...   117   3e-25
CP000679_1139(CP000679|pid:none) Caldicellulosiruptor saccharoly...   117   3e-25
CP000458_2290(CP000458|pid:none) Burkholderia cenocepacia HI2424...   117   3e-25
CP000628_262(CP000628|pid:none) Agrobacterium radiobacter K84 ch...   117   3e-25
(Q0BD86) RecName: Full=Uracil phosphoribosyltransferase;        ...   117   4e-25
(A6WYH9) RecName: Full=Uracil phosphoribosyltransferase;        ...   117   4e-25
(A5N3J1) RecName: Full=Uracil phosphoribosyltransferase;        ...   116   5e-25
(Q8UJ06) RecName: Full=Uracil phosphoribosyltransferase;        ...   116   5e-25
(A4JGH4) RecName: Full=Uracil phosphoribosyltransferase;        ...   116   5e-25
(Q042K8) RecName: Full=Uracil phosphoribosyltransferase;        ...   116   7e-25
AM747720_2383(AM747720|pid:none) Burkholderia cenocepacia J2315 ...   116   7e-25
CU633749_838(CU633749|pid:none) Cupriavidus taiwanensis str. LMG...   116   7e-25
(Q9RGY8) RecName: Full=Uracil phosphoribosyltransferase;        ...   116   7e-25
(B0TYR5) RecName: Full=Uracil phosphoribosyltransferase;        ...   115   9e-25
(A8YUJ4) RecName: Full=Uracil phosphoribosyltransferase;        ...   115   1e-24
CP000480_3354(CP000480|pid:none) Mycobacterium smegmatis str. MC...   115   1e-24
(A5IUQ7) RecName: Full=Uracil phosphoribosyltransferase;        ...   115   1e-24
(A6TK51) RecName: Full=Uracil phosphoribosyltransferase;        ...   115   1e-24
AP009385_2227(AP009385|pid:none) Burkholderia multivorans ATCC 1...   114   2e-24
CP001098_1778(CP001098|pid:none) Halothermothrix orenii H 168, c...   114   2e-24
(Q39EA2) RecName: Full=Uracil phosphoribosyltransferase;        ...   114   2e-24
CP000264_2983(CP000264|pid:none) Jannaschia sp. CCS1, complete g...   114   2e-24
CP000091_522(CP000091|pid:none) Ralstonia eutropha JMP134 chromo...   114   2e-24
CP000362_3700(CP000362|pid:none) Roseobacter denitrificans OCh 1...   114   2e-24
CP001104_1207(CP001104|pid:none) Eubacterium eligens ATCC 27750,...   114   2e-24
(Q24MM7) RecName: Full=Uracil phosphoribosyltransferase;        ...   114   2e-24
AE014292_1024(AE014292|pid:none) Brucella suis 1330 chromosome I...   114   2e-24
(Q92T49) RecName: Full=Uracil phosphoribosyltransferase;        ...   114   2e-24
CP000930_858(CP000930|pid:none) Heliobacterium modesticaldum Ice...   114   2e-24
(B2A3H5) RecName: Full=Uracil phosphoribosyltransferase;        ...   114   3e-24
CP001503_2498(CP001503|pid:none) Burkholderia glumae BGR1 chromo...   114   3e-24
CP000261_346(CP000261|pid:none) Streptococcus pyogenes MGAS2096,...   114   3e-24
CP000633_177(CP000633|pid:none) Agrobacterium vitis S4 chromosom...   114   3e-24
(B0RRQ3) RecName: Full=Uracil phosphoribosyltransferase;        ...   113   4e-24
(A0ALM3) RecName: Full=Uracil phosphoribosyltransferase;        ...   113   4e-24
CP000577_250(CP000577|pid:none) Rhodobacter sphaeroides ATCC 170...   113   6e-24
(Q9JV58) RecName: Full=Uracil phosphoribosyltransferase;        ...   113   6e-24
CP001615_1310(CP001615|pid:none) Exiguobacterium sp. AT1b, compl...   113   6e-24
(Q04DP1) RecName: Full=Uracil phosphoribosyltransferase;        ...   113   6e-24
(Q2SZS9) RecName: Full=Uracil phosphoribosyltransferase;        ...   113   6e-24
(Q8YDE5) RecName: Full=Uracil phosphoribosyltransferase;        ...   113   6e-24
(Q2A285) RecName: Full=Uracil phosphoribosyltransferase;        ...   112   7e-24
(A0Q5K6) RecName: Full=Uracil phosphoribosyltransferase;        ...   112   7e-24
AJ749949_716(AJ749949|pid:none) Francisella tularensis subsp. tu...   112   7e-24
AK003541_1(AK003541|pid:none) Mus musculus 18-day embryo whole b...   112   7e-24
CP000915_1085(CP000915|pid:none) Francisella tularensis subsp. m...   112   7e-24
AY966994_1(AY966994|pid:none) Synthetic construct isolate FTT071...   112   7e-24
(Q2P2V7) RecName: Full=Uracil phosphoribosyltransferase;        ...   112   9e-24
(Q3BS29) RecName: Full=Uracil phosphoribosyltransferase;        ...   112   9e-24
CP000967_2001(CP000967|pid:none) Xanthomonas oryzae pv. oryzae P...   112   9e-24
CP000316_1926(CP000316|pid:none) Polaromonas sp. JS666, complete...   112   9e-24
(A1V2G4) RecName: Full=Uracil phosphoribosyltransferase;        ...   112   9e-24
(A6LQG6) RecName: Full=Uracil phosphoribosyltransferase;        ...   112   9e-24
AE013598_2449(AE013598|pid:none) Xanthomonas oryzae pv. oryzae K...   112   9e-24
(Q927V5) RecName: Full=Uracil phosphoribosyltransferase;        ...   112   9e-24
(B7IDR9) RecName: Full=Uracil phosphoribosyltransferase;        ...   112   1e-23
CR543861_663(CR543861|pid:none) Acinetobacter sp. ADP1 complete ...   111   2e-23
(A3N7G1) RecName: Full=Uracil phosphoribosyltransferase;        ...   111   2e-23
(Q2S320) RecName: Full=Uracil phosphoribosyltransferase;        ...   111   2e-23
(Q15ZS0) RecName: Full=Uracil phosphoribosyltransferase;        ...   111   2e-23
(A6UET4) RecName: Full=Uracil phosphoribosyltransferase;        ...   111   2e-23
(Q9RU32) RecName: Full=Uracil phosphoribosyltransferase;        ...   111   2e-23
AF298155_1(AF298155|pid:none) Cryptosporidium parvum uridine kin...   111   2e-23
CU633750_1394(CU633750|pid:none) Cupriavidus taiwanensis str. LM...   110   3e-23
CP001029_1661(CP001029|pid:none) Methylobacterium populi BJ001, ...   110   3e-23
(A8MJX1) RecName: Full=Uracil phosphoribosyltransferase;        ...   110   3e-23
(A9NEQ2) RecName: Full=Uracil phosphoribosyltransferase;        ...   110   3e-23
(A1B467) RecName: Full=Uracil phosphoribosyltransferase;        ...   110   4e-23
(Q67TC9) RecName: Full=Uracil phosphoribosyltransferase;        ...   110   4e-23
AE017198_774(AE017198|pid:none) Lactobacillus johnsonii NCC 533,...   110   4e-23
(Q5HMB1) RecName: Full=Uracil phosphoribosyltransferase;        ...   110   4e-23
(A7NRA6) RecName: Full=Uracil phosphoribosyltransferase;        ...   110   5e-23
AP009484_1767(AP009484|pid:none) Macrococcus caseolyticus JCSC54...   109   6e-23
(Q311Z9) RecName: Full=Uracil phosphoribosyltransferase;        ...   109   6e-23
(Q65RC3) RecName: Full=Uracil phosphoribosyltransferase;        ...   109   8e-23
(Q9PJJ6) RecName: Full=Uracil phosphoribosyltransferase;        ...   109   8e-23
CP000943_1878(CP000943|pid:none) Methylobacterium sp. 4-46, comp...   109   8e-23
CP001154_499(CP001154|pid:none) Laribacter hongkongensis HLHK9, ...   109   8e-23
AY182240_1(AY182240|pid:none) Giardia intestinalis uracil phosph...   108   1e-22
AM295250_1606(AM295250|pid:none) Staphylococcus carnosus subsp. ...   108   1e-22
CP000908_1517(CP000908|pid:none) Methylobacterium extorquens PA1...   108   1e-22
(B8DP34) RecName: Full=Uracil phosphoribosyltransferase;        ...   108   1e-22
CP001358_983(CP001358|pid:none) Desulfovibrio desulfuricans subs...   108   1e-22
(Q97F73) RecName: Full=Uracil phosphoribosyltransferase;        ...   108   2e-22
(B2FLX2) RecName: Full=Uracil phosphoribosyltransferase;        ...   108   2e-22
CP001392_1665(CP001392|pid:none) Diaphorobacter sp. TPSY, comple...   108   2e-22
CP000909_1491(CP000909|pid:none) Chloroflexus aurantiacus J-10-f...   108   2e-22
AL132960_20(AL132960|pid:none) Arabidopsis thaliana DNA chromoso...   108   2e-22
AP011115_387(AP011115|pid:none) Rhodococcus opacus B4 DNA, compl...   107   2e-22
CU234118_3326(CU234118|pid:none) Bradyrhizobium sp. ORS278,compl...   107   2e-22
AY084756_1(AY084756|pid:none) Arabidopsis thaliana clone 116841 ...   107   2e-22
(A5VYH8) RecName: Full=Uracil phosphoribosyltransferase;        ...   107   4e-22
CP001349_455(CP001349|pid:none) Methylobacterium nodulans ORS 20...   107   4e-22
(Q0SK44) RecName: Full=Uracil phosphoribosyltransferase;        ...   107   4e-22
AM942759_1557(AM942759|pid:none) Proteus mirabilis strain HI4320...   107   4e-22
AC111016_11(AC111016|pid:none) Oryza sativa (japonica cultivar-g...   107   4e-22
CP001635_2623(CP001635|pid:none) Variovorax paradoxus S110 chrom...   106   5e-22
AM889285_3345(AM889285|pid:none) Gluconacetobacter diazotrophicu...   106   7e-22
(A1VEW8) RecName: Full=Uracil phosphoribosyltransferase;        ...   106   7e-22
(Q4QJV5) RecName: Full=Uracil phosphoribosyltransferase;        ...   106   7e-22
AP007154_585(AP007154|pid:none) Aspergillus oryzae RIB40 genomic...   106   7e-22
CP001157_4001(CP001157|pid:none) Azotobacter vinelandii DJ, comp...   106   7e-22
CP000605_1588(CP000605|pid:none) Bifidobacterium longum DJO10A, ...   105   9e-22
CP000656_3240(CP000656|pid:none) Mycobacterium gilvum PYR-GCK, c...   105   9e-22
CP001328_396(CP001328|pid:none) Micromonas sp. RCC299 chromosome...   105   9e-22
(A4XQU8) RecName: Full=Uracil phosphoribosyltransferase;        ...   105   9e-22
(Q2ST42) RecName: Full=Uracil phosphoribosyltransferase;        ...   105   9e-22
AE014295_1414(AE014295|pid:none) Bifidobacterium longum NCC2705,...   105   9e-22
(Q1DG16) RecName: Full=Uracil phosphoribosyltransferase;        ...   105   1e-21
(Q1IEV9) RecName: Full=Uracil phosphoribosyltransferase;        ...   105   1e-21
CP000494_3949(CP000494|pid:none) Bradyrhizobium sp. BTAi1, compl...   105   1e-21
AE009952_1384(AE009952|pid:none) Yersinia pestis KIM, complete g...   105   1e-21
(A1JKZ8) RecName: Full=Uracil phosphoribosyltransferase;        ...   105   2e-21
(B6EJU2) RecName: Full=Uracil phosphoribosyltransferase;        ...   105   2e-21
CP000267_2036(CP000267|pid:none) Rhodoferax ferrireducens T118, ...   105   2e-21
EU972607_1(EU972607|pid:none) Zea mays clone 384324 uracil phosp...   105   2e-21
(Q9WZI0) RecName: Full=Uracil phosphoribosyltransferase;        ...   105   2e-21
(A5UBP1) RecName: Full=Uracil phosphoribosyltransferase;        ...   105   2e-21
(A6VC42) RecName: Full=Uracil phosphoribosyltransferase;        ...   104   2e-21
(Q0HHL7) RecName: Full=Uracil phosphoribosyltransferase;        ...   104   2e-21
(A3D3D2) RecName: Full=Uracil phosphoribosyltransferase;        ...   104   2e-21
CP000812_118(CP000812|pid:none) Thermotoga lettingae TMO, comple...   104   2e-21
(A5IJ64) RecName: Full=Uracil phosphoribosyltransferase;        ...   104   2e-21
AM849034_2502(AM849034|pid:none) Clavibacter michiganensis subsp...   104   2e-21
(B1JEN1) RecName: Full=Uracil phosphoribosyltransferase;        ...   104   2e-21
CP000521_794(CP000521|pid:none) Acinetobacter baumannii ATCC 179...   104   3e-21
AY657593_1(AY657593|pid:none) Synthetic construct Peudomonas aer...   104   3e-21
(Q87MH1) RecName: Full=Uracil phosphoribosyltransferase;        ...   104   3e-21
CP000020_1947(CP000020|pid:none) Vibrio fischeri ES114 chromosom...   104   3e-21
CP000820_5797(CP000820|pid:none) Frankia sp. EAN1pec, complete g...   104   3e-21
(A1RKQ4) RecName: Full=Uracil phosphoribosyltransferase;        ...   104   3e-21
(B5FGY4) RecName: Full=Uracil phosphoribosyltransferase;        ...   104   3e-21
CP000390_3621(CP000390|pid:none) Mesorhizobium sp. BNC1, complet...   104   3e-21
CP000884_3507(CP000884|pid:none) Delftia acidovorans SPH-1, comp...   104   3e-21
(A5IE48) RecName: Full=Uracil phosphoribosyltransferase;        ...   103   3e-21
BA000040_6788(BA000040|pid:none) Bradyrhizobium japonicum USDA 1...   103   3e-21
CP000789_3087(CP000789|pid:none) Vibrio harveyi ATCC BAA-1116 ch...   103   3e-21
(B7GZA8) RecName: Full=Uracil phosphoribosyltransferase;        ...   103   3e-21
AL118506_10(AL118506|pid:none) Human DNA sequence from clone RP4...   103   3e-21
AP009493_3535(AP009493|pid:none) Streptomyces griseus subsp. gri...   103   3e-21
(A1R2Y2) RecName: Full=Uracil phosphoribosyltransferase;        ...   103   3e-21
(A8FUD4) RecName: Full=Uracil phosphoribosyltransferase;        ...   103   4e-21
FP236842_1088(FP236842|pid:none) Erwinia pyrifoliae strain Ep1/9...   103   4e-21
(Q6LN74) RecName: Full=Uracil phosphoribosyltransferase;        ...   103   4e-21
CP000587_347(CP000587|pid:none) Ostreococcus lucimarinus CCE9901...   103   6e-21
CP001618_512(CP001618|pid:none) Beutenbergia cavernae DSM 12333,...   103   6e-21
CU468135_1058(CU468135|pid:none) Erwinia tasmaniensis strain ET1...   103   6e-21
CP000249_678(CP000249|pid:none) Frankia sp. CcI3, complete genome.    102   8e-21
(A4SL29) RecName: Full=Uracil phosphoribosyltransferase;        ...   102   8e-21
(Q5WUK0) RecName: Full=Uracil phosphoribosyltransferase;        ...   102   8e-21
(Q2KWB3) RecName: Full=Uracil phosphoribosyltransferase;        ...   102   1e-20
(A5F642) RecName: Full=Uracil phosphoribosyltransferase;        ...   102   1e-20
CP000783_731(CP000783|pid:none) Enterobacter sakazakii ATCC BAA-...   102   1e-20
CT978603_1246(CT978603|pid:none) Synechococcus sp. RCC307 genomi...   102   1e-20
CT005238_57(CT005238|pid:none) Methylocapsa acidiphila B2, overl...   102   1e-20
CP001080_1170(CP001080|pid:none) Sulfurihydrogenibium sp. YO3AOP...   102   1e-20
CP000656_4808(CP000656|pid:none) Mycobacterium gilvum PYR-GCK, c...   102   1e-20
(Q6A5S3) RecName: Full=Uracil phosphoribosyltransferase;        ...   102   1e-20
(O67914) RecName: Full=Uracil phosphoribosyltransferase;        ...   102   1e-20
(Q49Z59) RecName: Full=Uracil phosphoribosyltransferase;        ...   101   2e-20
(Q7NBH2) RecName: Full=Uracil phosphoribosyltransferase;        ...   101   2e-20
(A1SVA9) RecName: Full=Uracil phosphoribosyltransferase;        ...   101   2e-20
CP000513_556(CP000513|pid:none) Dichelobacter nodosus VCS1703A, ...   101   2e-20
CP000961_2718(CP000961|pid:none) Shewanella woodyi ATCC 51908, c...   101   2e-20
BT039566_1(BT039566|pid:none) Zea mays full-length cDNA clone ZM...   101   2e-20
CP000826_3511(CP000826|pid:none) Serratia proteamaculans 568, co...   100   3e-20
(Q7MIK2) RecName: Full=Uracil phosphoribosyltransferase;        ...   100   3e-20
(B0T2R0) RecName: Full=Uracil phosphoribosyltransferase;        ...   100   3e-20
CP001089_1062(CP001089|pid:none) Geobacter lovleyi SZ, complete ...   100   3e-20
AE017347_223(AE017347|pid:none) Cryptococcus neoformans var. neo...   100   3e-20
AP009179_1102(AP009179|pid:none) Sulfurovum sp. NBC37-1 genomic ...   100   4e-20
AM920437_918(AM920437|pid:none) Penicillium chrysogenum Wisconsi...   100   4e-20
(B3PM96) RecName: Full=Uracil phosphoribosyltransferase;        ...   100   4e-20
(Q084L0) RecName: Full=Uracil phosphoribosyltransferase;        ...   100   4e-20
AY223453_1(AY223453|pid:none) Schistosoma japonicum clone ZZZ47 ...   100   5e-20
(Q9KPY7) RecName: Full=Uracil phosphoribosyltransferase;        ...   100   5e-20
(A0JSM6) RecName: Full=Uracil phosphoribosyltransferase;        ...   100   5e-20
CP000431_6196(CP000431|pid:none) Rhodococcus jostii RHA1, comple...   100   6e-20
(A6LMU0) RecName: Full=Uracil phosphoribosyltransferase;        ...   100   6e-20
(A1KNZ5) RecName: Full=Uracil phosphoribosyltransferase;        ...   100   6e-20
(Q6F210) RecName: Full=Uracil phosphoribosyltransferase;        ...    99   8e-20
AX196060_1(AX196060|pid:none) Sequence 132 from Patent WO0151639.      99   8e-20
CP001344_4054(CP001344|pid:none) Cyanothece sp. PCC 7425, comple...    99   8e-20
A65026(A65026;S23412) uracil phosphoribosyltransferase (EC 2.4.2...    99   8e-20
(A1ADZ1) RecName: Full=Uracil phosphoribosyltransferase;        ...    99   8e-20
(Q5Z187) RecName: Full=Uracil phosphoribosyltransferase;        ...    99   1e-19
CP001213_184(CP001213|pid:none) Bifidobacterium animalis subsp. ...    99   1e-19
(P47276) RecName: Full=Uracil phosphoribosyltransferase;        ...    99   1e-19
CP000393_1891(CP000393|pid:none) Trichodesmium erythraeum IMS101...    99   1e-19
CP000479_4122(CP000479|pid:none) Mycobacterium avium 104, comple...    99   1e-19
CT573213_1161(CT573213|pid:none) Frankia alni str. ACN14A chromo...    99   1e-19
(Q73UD7) RecName: Full=Uracil phosphoribosyltransferase;        ...    98   2e-19
(P75081) RecName: Full=Uracil phosphoribosyltransferase;        ...    98   2e-19
AP006725_3694(AP006725|pid:none) Klebsiella pneumoniae NTUH-K204...    98   2e-19
S73447(S73447)uracil phosphoribosyltransferase (EC 2.4.2.9) upp ...    98   2e-19
CP000386_1628(CP000386|pid:none) Rubrobacter xylanophilus DSM 99...    98   2e-19
(B5XNQ4) RecName: Full=Uracil phosphoribosyltransferase;        ...    98   2e-19
CP001145_692(CP001145|pid:none) Coprothermobacter proteolyticus ...    98   2e-19
(P43049) RecName: Full=Uracil phosphoribosyltransferase;        ...    98   2e-19
(Q1QVR2) RecName: Full=Uracil phosphoribosyltransferase;        ...    98   2e-19
(Q12MF1) RecName: Full=Uracil phosphoribosyltransferase;        ...    98   2e-19
CU458896_3633(CU458896|pid:none) Mycobacterium abscessus chromos...    98   2e-19
(A7HJR3) RecName: Full=Uracil phosphoribosyltransferase;        ...    98   2e-19
CP000697_1864(CP000697|pid:none) Acidiphilium cryptum JF-5, comp...    98   2e-19
CP000828_1426(CP000828|pid:none) Acaryochloris marina MBIC11017,...    98   2e-19
(A1WQN5) RecName: Full=Uracil phosphoribosyltransferase;        ...    97   3e-19
(Q492F3) RecName: Full=Uracil phosphoribosyltransferase;        ...    97   3e-19
(Q9AK76) RecName: Full=Uracil phosphoribosyltransferase;        ...    97   3e-19
(Q7VZ79) RecName: Full=Uracil phosphoribosyltransferase;        ...    97   3e-19
(A1W0S0) RecName: Full=Uracil phosphoribosyltransferase;        ...    97   3e-19
(Q5HTC1) RecName: Full=Uracil phosphoribosyltransferase;        ...    97   3e-19
AL939118_199(AL939118|pid:none) Streptomyces coelicolor A3(2) co...    97   3e-19
(A1AMK6) RecName: Full=Uracil phosphoribosyltransferase;        ...    97   3e-19
(O74427) RecName: Full=Uridine kinase;          EC=2.7.1.48; Alt...    97   4e-19
CP000806_2626(CP000806|pid:none) Cyanothece sp. ATCC 51142 circu...    97   4e-19
(A1U241) RecName: Full=Uracil phosphoribosyltransferase;        ...    97   4e-19
AP011115_6316(AP011115|pid:none) Rhodococcus opacus B4 DNA, comp...    97   4e-19
CP001087_524(CP001087|pid:none) Desulfobacterium autotrophicum H...    97   5e-19
CP001276_693(CP001276|pid:none) Thermomicrobium roseum DSM 5159 ...    97   5e-19
(Q9PN13) RecName: Full=Uracil phosphoribosyltransferase;        ...    97   5e-19
(Q98QP6) RecName: Full=Uracil phosphoribosyltransferase;        ...    97   5e-19
(Q9A627) RecName: Full=Uracil phosphoribosyltransferase;        ...    96   7e-19
(B5EBM3) RecName: Full=Uracil phosphoribosyltransferase;        ...    96   7e-19
(Q4K6B5) RecName: Full=Uracil phosphoribosyltransferase;        ...    96   7e-19
AP009178_1764(AP009178|pid:none) Nitratiruptor sp. SB155-2 genom...    96   7e-19
AP008957_5883(AP008957|pid:none) Rhodococcus erythropolis PR4 DN...    96   7e-19
(P72753) RecName: Full=Uracil phosphoribosyltransferase;        ...    96   7e-19
AM420293_6372(AM420293|pid:none) Saccharopolyspora erythraea NRR...    96   1e-18
(A9WLN5) RecName: Full=Uracil phosphoribosyltransferase;        ...    95   2e-18
CP000667_821(CP000667|pid:none) Salinispora tropica CNB-440, com...    95   2e-18
AP009552_2189(AP009552|pid:none) Microcystis aeruginosa NIES-843...    94   3e-18
(A1SDD5) RecName: Full=Uracil phosphoribosyltransferase;        ...    94   3e-18
(Q8YVB5) RecName: Full=Uracil phosphoribosyltransferase;        ...    94   5e-18
CP001601_535(CP001601|pid:none) Corynebacterium aurimucosum ATCC...    94   5e-18
CP000117_3093(CP000117|pid:none) Anabaena variabilis ATCC 29413,...    93   6e-18
(Q6AHB4) RecName: Full=Uracil phosphoribosyltransferase;        ...    93   6e-18
(A4QC29) RecName: Full=Uracil phosphoribosyltransferase;        ...    93   8e-18
CP000384_1230(CP000384|pid:none) Mycobacterium sp. MCS, complete...    92   1e-17
AP009608_575(AP009608|pid:none) Mycoplasma fermentans PG18 DNA, ...    92   1e-17
BA000035_704(BA000035|pid:none) Corynebacterium efficiens YS-314...    92   2e-17
BA000039_1763(BA000039|pid:none) Thermosynechococcus elongatus B...    92   2e-17
BX294151_34(BX294151|pid:none) Rhodopirellula baltica SH 1 compl...    91   3e-17
(B1VF60) RecName: Full=Uracil phosphoribosyltransferase;        ...    91   4e-17
CP000494_1984(CP000494|pid:none) Bradyrhizobium sp. BTAi1, compl...    89   9e-17
CP001014_648(CP001014|pid:none) Thermoproteus neutrophilus V24St...    88   2e-16
CP000612_1300(CP000612|pid:none) Desulfotomaculum reducens MI-1,...    88   2e-16
CP001287_858(CP001287|pid:none) Cyanothece sp. PCC 8801, complet...    88   2e-16
(A4WMQ7) RecName: Full=Probable uracil phosphoribosyltransferase...    88   2e-16
(A1RV13) RecName: Full=Probable uracil phosphoribosyltransferase...    87   3e-16
FM864216_535(FM864216|pid:none) Mycoplasma conjunctivae HRC/581T...    87   3e-16
CP000239_1713(CP000239|pid:none) Synechococcus sp. JA-3-3Ab, com...    87   6e-16
AE017345_213(AE017345|pid:none) Cryptococcus neoformans var. neo...    86   7e-16
(Q3ISU0) RecName: Full=Probable uracil phosphoribosyltransferase...    86   1e-15
(B6YTB2) RecName: Full=Probable uracil phosphoribosyltransferase...    86   1e-15
CU234118_1685(CU234118|pid:none) Bradyrhizobium sp. ORS278,compl...    85   2e-15
FM992690_392(FM992690|pid:none) Candida dubliniensis CD36 chromo...    85   2e-15
CP000975_1106(CP000975|pid:none) Methylacidiphilum infernorum V4...    84   3e-15
CU179680_367(CU179680|pid:none) Mycoplasma agalactiae PG2 chromo...    84   4e-15
BA000045_63(BA000045|pid:none) Gloeobacter violaceus PCC 7421 DN...    84   5e-15
(Q5UZD3) RecName: Full=Probable uracil phosphoribosyltransferase...    83   8e-15
CP001398_1407(CP001398|pid:none) Thermococcus gammatolerans EJ3,...    83   8e-15
CP000493_977(CP000493|pid:none) Hyperthermus butylicus DSM 5456,...    83   8e-15
(A6USD4) RecName: Full=Probable uracil phosphoribosyltransferase...    83   8e-15
(A4YCQ1) RecName: Full=Probable uracil phosphoribosyltransferase...    82   1e-14
(Q9V0K1) RecName: Full=Probable uracil phosphoribosyltransferase...    81   3e-14
AM455643_6(AM455643|pid:none) Vitis vinifera contig VV78X038713....    80   5e-14
(Q5JGQ6) RecName: Full=Probable uracil phosphoribosyltransferase...    80   5e-14
AE017245_300(AE017245|pid:none) Mycoplasma synoviae 53, complete...    80   7e-14
FJ436358_1(FJ436358|pid:none) Streptomyces laurentii strain ATCC...    80   7e-14
(Q8ZWV9) RecName: Full=Probable uracil phosphoribosyltransferase...    79   9e-14
CR382134_367(CR382134|pid:none) Debaryomyces hansenii strain CBS...    79   9e-14
(Q18DK8) RecName: Full=Probable uracil phosphoribosyltransferase...    78   2e-13
CP000575_173(CP000575|pid:none) Staphylothermus marinus F1, comp...    77   4e-13
(Q980Q4) RecName: Full=Probable uracil phosphoribosyltransferase...    77   6e-13
EU958140_1(EU958140|pid:none) Zea mays clone 1674927 unknown mRNA.     77   6e-13
CP000496_721(CP000496|pid:none) Pichia stipitis CBS 6054 chromos...    76   1e-12
CP001365_2682(CP001365|pid:none) Halorubrum lacusprofundi ATCC 4...    75   1e-12
CP001402_1879(CP001402|pid:none) Sulfolobus islandicus M.16.4, c...    75   2e-12
CP000685_1039(CP000685|pid:none) Flavobacterium johnsoniae UW101...    74   5e-12
(B0R7K0) RecName: Full=Probable uracil phosphoribosyltransferase...    74   5e-12
(Q6LZE9) RecName: Full=Probable uracil phosphoribosyltransferase...    74   5e-12
CU928165_244(CU928165|pid:none) Kluyveromyces thermotolerans str...    73   6e-12
AM398681_2405(AM398681|pid:none) Flavobacterium psychrophilum JI...    73   8e-12
CP000867_203(CP000867|pid:none) Methanococcus maripaludis C6, co...    72   1e-11
AP007162_211(AP007162|pid:none) Aspergillus oryzae RIB40 genomic...    72   1e-11
DQ118403_37(DQ118403|pid:none) Uncultured euryarchaeote Alv-FOS1...    72   2e-11
AM920436_181(AM920436|pid:none) Penicillium chrysogenum Wisconsi...    72   2e-11
(A4FYB9) RecName: Full=Probable uracil phosphoribosyltransferase...    71   2e-11
AE016817_688(AE016817|pid:none) Ashbya gossypii (= Eremothecium ...    71   3e-11
CR382131_843(CR382131|pid:none) Yarrowia lipolytica strain CLIB1...    70   4e-11
AM270349_15(AM270349|pid:none) Aspergillus niger contig An15c022...    70   5e-11
FN392320_824(FN392320|pid:none) Pichia pastoris GS115 chromosome...    70   5e-11
CU633900_511(CU633900|pid:none) Podospora anserina genomic DNA c...    69   1e-10
(O27186) RecName: Full=Probable uracil phosphoribosyltransferase...    68   3e-10
(P27515) RecName: Full=Uridine kinase;          EC=2.7.1.48; Alt...    67   3e-10
DQ118404_24(DQ118404|pid:none) Uncultured euryarchaeote Alv-FOS4...    67   5e-10
CP001140_827(CP001140|pid:none) Desulfurococcus kamchatkensis 12...    67   5e-10
CU928176_384(CU928176|pid:none) Zygosaccharomyces rouxii strain ...    67   6e-10
CP000139_942(CP000139|pid:none) Bacteroides vulgatus ATCC 8482, ...    64   3e-09
(B2RIV3) RecName: Full=Uracil phosphoribosyltransferase;        ...    61   3e-08
CU207366_1547(CU207366|pid:none) Gramella forsetii KT0803 comple...    60   6e-08
AE015928_2790(AE015928|pid:none) Bacteroides thetaiotaomicron VP...    59   1e-07
BX640539_6(BX640539|pid:none) Zebrafish DNA sequence from clone ...    55   2e-06
AF098522_1(AF098522|pid:none) Lactobacillus acidophilus uracil p...    52   1e-05
L08445_3(L08445|pid:none) Streptococcus salivarius fructosyltran...    50   8e-05
CP000878_987(CP000878|pid:none) Prochlorococcus marinus str. MIT...    49   1e-04
GM016257_180(GM016257|pid:none) Sequence 1087 from Patent EP1923...    49   1e-04
CP000113_4939(CP000113|pid:none) Myxococcus xanthus DK 1622, com...    47   5e-04
BX569692_71(BX569692|pid:none) Synechococcus sp. WH8102 complete...    46   8e-04
CP000251_125(CP000251|pid:none) Anaeromyxobacter dehalogenans 2C...    45   0.002
CP001131_133(CP001131|pid:none) Anaeromyxobacter sp. K, complete...    45   0.002
AE017126_847(AE017126|pid:none) Prochlorococcus marinus subsp. m...    44   0.003
(Q98R83) RecName: Full=Ribose-phosphate pyrophosphokinase;      ...    44   0.004
CP000435_1659(CP000435|pid:none) Synechococcus sp. CC9311, compl...    44   0.004
BX842655_14(BX842655|pid:none) Bdellovibrio bacteriovorus comple...    44   0.005
CP000769_128(CP000769|pid:none) Anaeromyxobacter sp. Fw109-5, co...    43   0.007
AF378363_1(AF378363|pid:none) Giardia intestinalis adenine phosp...    43   0.009
CT971583_1133(CT971583|pid:none) Synechococcus WH7803 complete g...    42   0.012
CP000383_2587(CP000383|pid:none) Cytophaga hutchinsonii ATCC 334...    42   0.021
AM942759_1068(AM942759|pid:none) Proteus mirabilis strain HI4320...    41   0.027
BA000003_158(BA000003|pid:none) Buchnera aphidicola str. APS (Ac...    41   0.027
(P57266) RecName: Full=Ribose-phosphate pyrophosphokinase;      ...    41   0.027
CP001158_154(CP001158|pid:none) Buchnera aphidicola str. Tuc7 (A...    41   0.027
CP000814_853(CP000814|pid:none) Campylobacter jejuni subsp. jeju...    41   0.027
(Q9PP15) RecName: Full=Ribose-phosphate pyrophosphokinase;      ...    41   0.027
AM746676_2471(AM746676|pid:none) Sorangium cellulosum 'So ce 56'...    41   0.027
(Q8K9X2) RecName: Full=Ribose-phosphate pyrophosphokinase;      ...    41   0.027
CP000436_1003(CP000436|pid:none) Haemophilus somnus 129PT, compl...    41   0.035
BA000026_942(BA000026|pid:none) Mycoplasma penetrans HF-2 DNA, c...    41   0.035
CP001616_816(CP001616|pid:none) Tolumonas auensis DSM 9187, comp...    40   0.046
CP000057_1252(CP000057|pid:none) Haemophilus influenzae 86-028NP...    40   0.046
(P44328) RecName: Full=Ribose-phosphate pyrophosphokinase;      ...    40   0.060
CP000746_1722(CP000746|pid:none) Actinobacillus succinogenes 130...    40   0.060
AE015928_748(AE015928|pid:none) Bacteroides thetaiotaomicron VPI...    40   0.078
(Q9CP22) RecName: Full=Ribose-phosphate pyrophosphokinase;      ...    40   0.078
Z33263_1(Z33263|pid:none) M.capricolum DNA for CONTIG MC357.           40   0.078
CP001275_30(CP001275|pid:none) Thermomicrobium roseum DSM 5159, ...    40   0.078
CP000767_1458(CP000767|pid:none) Campylobacter curvus 525.92, co...    39   0.10
AE016827_1536(AE016827|pid:none) Mannheimia succiniciproducens M...    39   0.10
CP001614_3382(CP001614|pid:none) Teredinibacter turnerae T7901, ...    39   0.10
DQ362017_1(DQ362017|pid:none) Shigella dysenteriae strain G1292 ...    39   0.13
CP000140_3669(CP000140|pid:none) Parabacteroides distasonis ATCC...    39   0.13
CP001628_511(CP001628|pid:none) Micrococcus luteus NCTC 2665, co...    39   0.13
CP000783_1443(CP000783|pid:none) Enterobacter sakazakii ATCC BAA...    39   0.17
AP009049_122(AP009049|pid:none) Clostridium kluyveri NBRC 12016 ...    39   0.17
DQ362002_1(DQ362002|pid:none) Shigella boydii strain G1191 PrsA ...    39   0.17
DQ362040_1(DQ362040|pid:none) Escherichia coli strain 44738 PrsA...    39   0.17
(Q7N590) RecName: Full=Ribose-phosphate pyrophosphokinase;      ...    39   0.17
DQ362009_1(DQ362009|pid:none) Shigella boydii strain G1224 PrsA ...    39   0.17
AE009952_2258(AE009952|pid:none) Yersinia pestis KIM, complete g...    39   0.17
DQ362018_1(DQ362018|pid:none) Shigella dysenteriae strain G1246 ...    39   0.17
BX950851_2164(BX950851|pid:none) Erwinia carotovora subsp. atros...    39   0.17
AE014075_1613(AE014075|pid:none) Escherichia coli CFT073, comple...    39   0.17
CP000382_138(CP000382|pid:none) Clostridium novyi NT, complete g...    39   0.17
(P0A1V6) RecName: Full=Ribose-phosphate pyrophosphokinase;      ...    39   0.17
AM933173_1303(AM933173|pid:none) Salmonella enterica subsp. ente...    39   0.17
AE017220_1774(AE017220|pid:none) Salmonella enterica subsp. ente...    39   0.17
M13174_1(M13174|pid:none) E.coli prs gene encoding phosphoribosy...    39   0.17
CP000141_193(CP000141|pid:none) Carboxydothermus hydrogenoforman...    39   0.17
CP000826_1979(CP000826|pid:none) Serratia proteamaculans 568, co...    39   0.17
DQ362005_1(DQ362005|pid:none) Shigella boydii strain G1300 PrsA ...    39   0.17
(Q8ZEY2) RecName: Full=Ribose-phosphate pyrophosphokinase;      ...    39   0.17
CP001063_1169(CP001063|pid:none) Shigella boydii CDC 3083-94, co...    39   0.17
AM286415_2307(AM286415|pid:none) Yersinia enterocolitica subsp. ...    39   0.17
CP000159_1301(CP000159|pid:none) Salinibacter ruber DSM 13855, c...    38   0.23
CP000529_889(CP000529|pid:none) Polaromonas naphthalenivorans CJ...    38   0.23
CP000462_3071(CP000462|pid:none) Aeromonas hydrophila subsp. hyd...    38   0.23
CP000454_1211(CP000454|pid:none) Arthrobacter sp. FB24, complete...    38   0.23
CP000644_1065(CP000644|pid:none) Aeromonas salmonicida subsp. sa...    38   0.23
CP000554_1682(CP000554|pid:none) Prochlorococcus marinus str. MI...    38   0.30
AP008230_153(AP008230|pid:none) Desulfitobacterium hafniense Y51...    38   0.30
CP000687_735(CP000687|pid:none) Actinobacillus pleuropneumoniae ...    38   0.30
(Q7VL55) RecName: Full=Ribose-phosphate pyrophosphokinase;      ...    38   0.30
CP000859_2810(CP000859|pid:none) Desulfococcus oleovorans Hxd3, ...    37   0.39
AM420293_2342(AM420293|pid:none) Saccharopolyspora erythraea NRR...    37   0.39
AP006841_2229(AP006841|pid:none) Bacteroides fragilis YCH46 DNA,...    37   0.39
(Q38X29) RecName: Full=Bifunctional protein pyrR; Includes:   Re...    37   0.39
CP000539_881(CP000539|pid:none) Acidovorax sp. JS42, complete ge...    37   0.39
CU207211_2738(CU207211|pid:none) Herminiimonas arsenicoxydans ch...    37   0.39
CP000099_353(CP000099|pid:none) Methanosarcina barkeri str. Fusa...    37   0.39
CP001013_3476(CP001013|pid:none) Leptothrix cholodnii SP-6, comp...    37   0.51
CP000316_1276(CP000316|pid:none) Polaromonas sp. JS666, complete...    37   0.66

>(Q55GQ6) RecName: Full=Uracil phosphoribosyltransferase;
           EC=2.4.2.9; AltName: Full=UMP pyrophosphorylase;
           AltName: Full=UPRTase;
          Length = 216

 Score =  344 bits (882), Expect = 1e-93
 Identities = 172/173 (99%), Positives = 172/173 (99%)
 Frame = +1

Query: 1   LIEEGLNCLPFHETTITTPTGCEYQGVTFASKICGVSIVRAGESMEAGLRAVCKHIKIGK 180
           LIEEGL CLPFHETTITTPTGCEYQGVTFASKICGVSIVRAGESMEAGLRAVCKHIKIGK
Sbjct: 44  LIEEGLYCLPFHETTITTPTGCEYQGVTFASKICGVSIVRAGESMEAGLRAVCKHIKIGK 103

Query: 181 ILIQRDEETALPKLLYAKLPHDIANRQVLLLDPMLATGGTVTQAVEVLLERGVKEENIVF 360
           ILIQRDEETALPKLLYAKLPHDIANRQVLLLDPMLATGGTVTQAVEVLLERGVKEENIVF
Sbjct: 104 ILIQRDEETALPKLLYAKLPHDIANRQVLLLDPMLATGGTVTQAVEVLLERGVKEENIVF 163

Query: 361 INLVASPEGIKVFTDKYPRVKVVTGEIDSHLNEKKYIIPGLGDFGNLYFGTED 519
           INLVASPEGIKVFTDKYPRVKVVTGEIDSHLNEKKYIIPGLGDFGNLYFGTED
Sbjct: 164 INLVASPEGIKVFTDKYPRVKVVTGEIDSHLNEKKYIIPGLGDFGNLYFGTED 216

Lambda     K      H
   0.318    0.134    0.401

Gapped
Lambda     K      H
   0.267   0.0410    0.140

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3236559
Number of Hits to DB: 962,340,597
Number of extensions: 18438615
Number of successful extensions: 44611
Number of sequences better than 10.0: 697
Number of HSP's gapped: 44201
Number of HSP's successfully gapped: 697
Length of query: 218
Length of database: 1,051,180,864
Length adjustment: 124
Effective length of query: 94
Effective length of database: 649,847,548
Effective search space: 61085669512
Effective search space used: 61085669512
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 31 (16.5 bits)
PSORT 

 psg: 0.75  gvh: 0.50  alm: 0.39  top: 0.53  tms: 0.00  mit: 0.22  mip: 0.00
 nuc: 0.00  erl: 0.00  erm: 0.00  pox: 0.00  px2: 0.00  vac: 0.00  rnp: 0.00
 act: 0.00  caa: 0.00  yqr: 0.00  tyr: 0.00  leu: 0.00  gpi: 0.00  myr: 0.00
 dna: 0.00  rib: 0.00  bac: 0.00  m1a: 0.00  m1b: 0.00  m2 : 0.00  mNt: 0.00
 m3a: 0.00  m3b: 0.00  m_ : 1.00 

	 48.0 %: cytoplasmic
	 24.0 %: nuclear
	 16.0 %: mitochondrial
	  4.0 %: cytoskeletal
	  4.0 %: Golgi
	  4.0 %: vesicles of secretory system

>> prediction for Contig-U14615-1 is cyt
VS (DIR, S) 1
VH (FL, L) 0
VF (FL, S) 0
AH (FL, L) 0
AF (FL, S) 0
SL (DIR, L) 0
SS (DIR, S) 0
SH (FL, L) 1
SF (FL, S) 0
CH (FL, L) 0
CF (FL, S) 0
FCL (DIR, L) 0
FC (DIR, S) 0
FC-IC (SUB) 0