| Homology vs DNA |
 Query= Contig-U14512-1 (Contig-U14512-1Q) /CSM_Contig/Contig-U14512-1Q.Seq.d
(1396 letters)
Database: ddbj_A
92,845,959 sequences; 95,242,211,685 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value N
(BJ398144) Dictyostelium discoideum cDNA clone:dds11o02, 3' ... 1124 0.0 1
(AU033910) Dictyostelium discoideum slug cDNA, clone SLB604. 827 0.0 2
(AU060820) Dictyostelium discoideum slug cDNA, clone SLB604. 934 0.0 1
(BJ399811) Dictyostelium discoideum cDNA clone:dds7g17, 3' e... 912 0.0 1
(G65017) DH0253 Dictyostelium discoideum ( P.Dear ) Dictyost... 680 0.0 2
(EA072895) Sequence 253 from patent US 7183083. 40 4e-14 5
(AR886592) Sequence 253 from patent US 7060458. 40 4e-14 5
(DJ377409) Identification of Essential Genes in Prokaryotes. 38 2e-12 5
(EC130395) HVE00006688 Hartmannella vermiformis Regular Larg... 40 4e-12 5
(CQ646586) Sequence 3543 from Patent WO0234771. 46 2e-11 4
(DD119498) STAPHYLOCOCCUS AUREUS PROTEINS AND NUCLEIC ACIDS. 38 3e-11 5
(CS707769) Sequence 309 from Patent EP1829892. 38 3e-11 5
(AX617346) Sequence 309 from Patent WO02094868. 38 3e-11 5
(DJ377648) Identification of Essential Genes in Prokaryotes. 38 3e-11 5
(FF421865) G125P60056RG10.T0 Acorn worm blastula/gastrula pC... 52 3e-11 4
(FF638203) G825P591RE4.T0 Acorn worm normalized gastrula pEx... 52 3e-11 4
(FF493006) G708P5221RH10.T0 Acorn worm normalized gastrula p... 52 6e-11 4
(FF495208) G708P531RG1.T0 Acorn worm normalized gastrula pEx... 52 8e-11 4
(AR535740) Sequence 302 from patent US 6737248. 38 2e-08 5
(AR354184) Sequence 302 from patent US 6593114. 38 2e-08 5
(EH014278) USDA-FP_186994 Lysiphlebus testaceipes adult whol... 44 4e-07 3
(FK144524) XABT176631.b1 Gateway compatible cien cDNA librar... 50 1e-06 2
(AE009968) Streptococcus pyogenes strain MGAS8232, section 1... 46 2e-06 4
(FG069097) UI-FF-IF0-aac-m-11-0-UI.r1 Ceratitis capitata emb... 54 2e-06 2
(FF765266) XABT69561.fwd Gateway compatible cien cDNA librar... 50 2e-06 2
(FF733433) XABT47206.fwd Gateway compatible cien cDNA librar... 50 2e-06 2
(FK216402) XABT221117.b1 Gateway compatible cien cDNA librar... 50 2e-06 2
(ER626549) 1093018209991 Global-Ocean-Sampling_GS-36-01-01-2... 40 2e-06 3
(DQ311147) Bombyx mori coiled-coil domain containing 25 prot... 56 4e-06 2
(BY939865) Bombyx mori cDNA, clone:E_FL_e100_24M07_F_0, 5' e... 56 2e-05 2
(CK488809) rswab0_006458.y1 swa Bombyx mori cDNA, mRNA seque... 56 2e-05 2
(CK544970) rswhb0_015422.y1 swh Bombyx mori cDNA, mRNA seque... 56 2e-05 2
(CK546052) rswhb0_017535.y1 swh Bombyx mori cDNA, mRNA seque... 56 2e-05 2
(DE156747) Bombyx mori genomic DNA, Fosmid clone:RO0299-P06_R. 56 3e-05 2
(EK058112) 1092960047392 Global-Ocean-Sampling_GS-31-01-01-1... 44 3e-05 3
(BJ649525) Eptatretus burgeri leukocyte cDNA clone:hg117h01,... 36 6e-05 4
(CN374595) rzhswab0_002673 Silkworm posterior silkgland libr... 56 7e-05 2
(FK130224) XABT168002.b1 Gateway compatible cien cDNA librar... 44 8e-05 2
(FF774097) XABT75302.fwd Gateway compatible cien cDNA librar... 44 9e-05 2
(FF395592) MOOE074TR MOO Vigna unguiculata cDNA 3', mRNA seq... 48 3e-04 2
(FC186071) CAAB656.fwd CAAB Nematostella vectensis nemve_P1 ... 58 3e-04 2
(FF403428) MOOE074TF MOO Vigna unguiculata cDNA 5', mRNA seq... 48 3e-04 2
(FC196900) CAAD490.fwd CAAD Nematostella vectensis nemve_P1 ... 58 3e-04 2
(CT863537) Oryza sativa Indica Group EST sequence:CONTIG4800. 44 4e-04 3
(FC225429) CAGF8589.fwd CAGF Nematostella vectensis Nemve Ea... 58 4e-04 2
(FC288222) CAGN4342.fwd CAGN Nematostella vectensis Nemve mi... 58 4e-04 2
(EC003462) 7401263 CE04 Caenorhabditis elegans cDNA clone 27... 40 8e-04 3
(EL568080) Physarum02480 Physarum polycephalum starvation st... 40 0.001 3
(EJ691915) 1092956005864 Global-Ocean-Sampling_GS-30-02-01-1... 44 0.001 2
(EJ743098) 1092962033565 Global-Ocean-Sampling_GS-30-02-01-1... 44 0.002 2
(CU459141) Acinetobacter baumannii str. AYE, complete genome. 40 0.002 2
(CP000863) Acinetobacter baumannii ACICU, complete genome. 40 0.002 2
(CU468230) Acinetobacter baumannii str. SDF, complete genome. 40 0.002 2
(AR318571) Sequence 1121 from patent US 6562958. 40 0.003 2
(FC469161) CAXH482.fwd CAXH Mnemiopsis leidyi whole animal G... 42 0.003 2
(FF698042) XABT108222.fwd Gateway compatible cien cDNA libra... 50 0.005 2
(EK549904) 1095516111794 Global-Ocean-Sampling_GS-32-01-01-1... 42 0.005 3
(CP000524) Bartonella bacilliformis KC583, complete genome. 38 0.009 2
(EK151036) 1095456051213 Global-Ocean-Sampling_GS-31-01-01-1... 38 0.009 4
(FF612570) G825P5168RC5.T0 Acorn worm normalized gastrula pE... 40 0.012 2
(EG561698) CR05008B02 CR05 cDNA library Catharanthus roseus ... 40 0.018 2
(Y15896) Bacillus subtilis nadA, yrbA, yrbB, yrbC, yrbD, orf... 42 0.025 3
(BD425126) The Nucleotide Sequence of the Haemophilus influe... 38 0.030 3
(DJ375758) Identification of Essential Genes in Prokaryotes. 38 0.031 3
(CJ393767) Molgula tectiformis cDNA, gonad clone:mtgd020h04,... 36 0.036 3
(DN796023) MVSG989 S.sclerotiorum lambda phage ESTs Library ... 38 0.039 3
(Z73899) Caenorhabditis elegans Cosmid ZK829. 40 0.052 4
(AW571142) ra14g10.y2 Bird-Rao Meloidogyne incognita J2 Melo... 42 0.055 2
(ES640447) NVPEK55TR NVPA Nasonia vitripennis cDNA, mRNA seq... 52 0.058 1
(DB728796) Apis mellifera head cDNA, RIKEN full-length enric... 52 0.058 1
(BY890964) Cryptomeria japonica cDNA clone: CMFL036_O18, 5'e... 52 0.058 1
(BX571856) Staphylococcus aureus subsp. aureus strain MRSA25... 38 0.065 19
(EK361713) 1095469049685 Global-Ocean-Sampling_GS-31-01-01-1... 38 0.068 3
(EJ156448) 1092344031601 Global-Ocean-Sampling_GS-27-01-01-1... 36 0.075 3
(EK077830) 1092961071206 Global-Ocean-Sampling_GS-31-01-01-1... 40 0.077 2
(EJ531913) 1092955235764 Global-Ocean-Sampling_GS-29-01-01-1... 42 0.089 2
(EK403283) 1095469552447 Global-Ocean-Sampling_GS-31-01-01-1... 42 0.091 2
(CQ652620) Sequence 9577 from Patent WO0234771. 38 0.11 3
(AX608486) Sequence 6415 from Patent WO02092818. 38 0.11 3
(DJ375419) Identification of Essential Genes in Prokaryotes. 44 0.11 3
(CP000903) Bacillus weihenstephanensis KBAB4, complete genome. 36 0.11 2
(CQ646584) Sequence 3541 from Patent WO0234771. 38 0.11 3
(CP000521) Acinetobacter baumannii ATCC 17978, complete genome. 34 0.11 2
(EU795091) Uncultured bacterium ARCTIC40_B_04 genomic sequence. 44 0.14 5
(EH091725) Sl_SlB_05H06_T7 SLB Selaginella lepidophylla cDNA... 32 0.15 4
(EJ756770) 1092963088271 Global-Ocean-Sampling_GS-30-02-01-1... 40 0.17 2
(EJ778690) 1093011490750 Global-Ocean-Sampling_GS-30-02-01-1... 40 0.17 2
(CW991260) CC0093 Sanger Institute Gene Trap Library pGT0lxf... 50 0.23 1
(FK886270) EST_crog_evp_909944 crog_evp Caligus rogercressey... 50 0.23 1
(FF732185) XABT46373.fwd Gateway compatible cien cDNA librar... 50 0.23 1
(EL576895) Physarum10045 Physarum polycephalum starvation st... 40 0.23 2
(FF328232) 280435911 Pea aphid whole body normalized full le... 44 0.26 2
(EJ488223) 1095403517689 Global-Ocean-Sampling_GS-28-01-01-1... 34 0.26 3
(BX571857) Staphylococcus aureus strain MSSA476, complete ge... 38 0.27 20
(EX643698) 256650661 Pea aphid whole body normalized full le... 44 0.27 2
(EJ708914) 1092956064969 Global-Ocean-Sampling_GS-30-02-01-1... 38 0.28 2
(EK530805) 1095516008057 Global-Ocean-Sampling_GS-32-01-01-1... 42 0.28 2
(FF293107) 279288871 Pea aphid whole body normalized full le... 44 0.29 2
(EJ463109) 1093041165535 Global-Ocean-Sampling_GS-28-01-01-1... 38 0.29 2
(FC293707) CAGN7235.fwd CAGN Nematostella vectensis Nemve mi... 48 0.29 2
>(BJ398144) Dictyostelium discoideum cDNA clone:dds11o02, 3' end,
single read.
Length = 567
Score = 1124 bits (567), Expect = 0.0
Identities = 567/567 (100%)
Strand = Plus / Minus
Query: 697 agcgatgtatagaacattgcgttggatcgatcgttgcattaaagctcataagaagccaga 756
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 567 agcgatgtatagaacattgcgttggatcgatcgttgcattaaagctcataagaagccaga 508
Query: 757 cactcaaaatattttcgccatcgttcagggcggcctcgactcgagattgcgtgatatctg 816
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 507 cactcaaaatattttcgccatcgttcagggcggcctcgactcgagattgcgtgatatctg 448
Query: 817 catggaggggttgatggcaagagagttccctggctatgccattggcggcttgagtggcgg 876
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 447 catggaggggttgatggcaagagagttccctggctatgccattggcggcttgagtggcgg 388
Query: 877 cgaatcaaaagacatgttttggcgtgtggtccatcaatgcacttcaaaactaccagagaa 936
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 387 cgaatcaaaagacatgttttggcgtgtggtccatcaatgcacttcaaaactaccagagaa 328
Query: 937 caaaccacgttatctcatgggtgtcggctacgcattggatttggtggtttgctcagcatt 996
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 327 caaaccacgttatctcatgggtgtcggctacgcattggatttggtggtttgctcagcatt 268
Query: 997 gggtgtcgatatgtttgattgtgtattcccatcgcgtactgccagatttggaactgcttt 1056
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 267 gggtgtcgatatgtttgattgtgtattcccatcgcgtactgccagatttggaactgcttt 208
Query: 1057 ggtcgcttctggatctttaaatttaaaatcatcagaatatgcatttgatttcactccaat 1116
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 207 ggtcgcttctggatctttaaatttaaaatcatcagaatatgcatttgatttcactccaat 148
Query: 1117 cgattcagaatgtacttgtatggtttgtaagaattacaccaaagcttatttacatattgt 1176
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 147 cgattcagaatgtacttgtatggtttgtaagaattacaccaaagcttatttacatattgt 88
Query: 1177 agctggtaaagaagcaattggtggtcaattactcacttttcataatattcattaccaaat 1236
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 87 agctggtaaagaagcaattggtggtcaattactcacttttcataatattcattaccaaat 28
Query: 1237 gtctttaatgtctcaaattcgtcaatc 1263
|||||||||||||||||||||||||||
Sbjct: 27 gtctttaatgtctcaaattcgtcaatc 1
Lambda K H
1.37 0.711 1.31
Matrix: blastn matrix:1 -3
Number of Sequences: 92845959
Number of Hits to DB: 1,240,776,971
Number of extensions: 69893167
Number of successful extensions: 5505419
Number of sequences better than 10.0: 179
Length of query: 1396
Length of database: 95,242,211,685
Length adjustment: 24
Effective length of query: 1372
Effective length of database: 97,308,875,965
Effective search space: 133507777823980
Effective search space used: 133507777823980
X1: 11 (21.8 bits)
S2: 22 (44.1 bits)
|
| Homology vs Protein |
Query= Contig-U14512-1 (Contig-U14512-1Q) /CSM_Contig/Contig-U14512-1Q.Seq.d
(1396 letters)
Database: nrp_B
3,236,559 sequences; 1,051,180,864 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AP005399_23(AP005399|pid:none) Oryza sativa Japonica Group genom... 531 e-149
CP000581_330(CP000581|pid:none) Ostreococcus lucimarinus CCE9901... 492 e-137
CR954201_301(CR954201|pid:none) Ostreococcus tauri strain OTTH05... 487 e-136
BC054695_1(BC054695|pid:none) Danio rerio queuine tRNA-ribosyltr... 484 e-135
BT076370_1(BT076370|pid:none) Caligus rogercresseyi clone crog-e... 471 e-131
BC062509_1(BC062509|pid:none) Xenopus tropicalis hypothetical pr... 469 e-130
BC097803_1(BC097803|pid:none) Xenopus laevis hypothetical protei... 468 e-130
CR760939_1(CR760939|pid:none) Xenopus tropicalis finished cDNA, ... 468 e-130
AF302784_1(AF302784|pid:none) Homo sapiens clone IMAGE:611146 tR... 466 e-130
(Q9BXR0) RecName: Full=Queuine tRNA-ribosyltransferase; ... 466 e-130
AF302783_1(AF302783|pid:none) Homo sapiens clone IMAGE:72154 tRN... 466 e-130
AK314308_1(AK314308|pid:none) Homo sapiens cDNA, FLJ95065, highl... 466 e-129
CR382132_378(CR382132|pid:none) Yarrowia lipolytica strain CLIB1... 465 e-129
BT039994_1(BT039994|pid:none) Zea mays full-length cDNA clone ZM... 459 e-127
CP001574_552(CP001574|pid:none) Micromonas sp. RCC299 chromosome... 451 e-125
BC015350_1(BC015350|pid:none) Homo sapiens queuine tRNA-ribosylt... 446 e-123
(O94460) RecName: Full=Probable queuine tRNA-ribosyltransferase;... 446 e-123
AM920428_645(AM920428|pid:none) Penicillium chrysogenum Wisconsi... 428 e-118
AM270310_3(AM270310|pid:none) Aspergillus niger contig An14c0020... 424 e-117
AP007172_56(AP007172|pid:none) Aspergillus oryzae RIB40 genomic ... 424 e-117
(Q23623) RecName: Full=Probable queuine tRNA-ribosyltransferase;... 403 e-111
AC084047_51(AC084047|pid:none) Trypanosoma brucei chromosome 6 c... 386 e-106
AM494954_88(AM494954|pid:none) Leishmania braziliensis chromosom... 377 e-103
AM502248_214(AM502248|pid:none) Leishmania infantum chromosome 30. 377 e-103
CU633897_201(CU633897|pid:none) Podospora anserina genomic DNA c... 371 e-101
AM180355_2876(AM180355|pid:none) Clostridium difficile 630 compl... 338 3e-91
CP000853_1692(CP000853|pid:none) Alkaliphilus oremlandii OhILAs,... 338 4e-91
CP000817_3757(CP000817|pid:none) Lysinibacillus sphaericus C3-41... 333 1e-89
CP001638_2271(CP001638|pid:none) Geobacillus sp. WCH70, complete... 333 1e-89
AP008955_1871(AP008955|pid:none) Brevibacillus brevis NBRC 10059... 332 2e-89
AP008934_1120(AP008934|pid:none) Staphylococcus saprophyticus su... 332 2e-89
(B7GFN1) RecName: Full=Queuine tRNA-ribosyltransferase; ... 331 4e-89
AM295250_1242(AM295250|pid:none) Staphylococcus carnosus subsp. ... 330 8e-89
(A7Z766) RecName: Full=Queuine tRNA-ribosyltransferase; ... 330 8e-89
CP000227_4101(CP000227|pid:none) Bacillus cereus Q1, complete ge... 330 8e-89
(A0RJ24) RecName: Full=Queuine tRNA-ribosyltransferase; ... 330 8e-89
(A7GT99) RecName: Full=Queuine tRNA-ribosyltransferase; ... 330 8e-89
(B7HE51) RecName: Full=Queuine tRNA-ribosyltransferase; ... 330 8e-89
CP001098_1216(CP001098|pid:none) Halothermothrix orenii H 168, c... 330 1e-88
(Q92BI4) RecName: Full=Queuine tRNA-ribosyltransferase; ... 329 2e-88
(A9VIP3) RecName: Full=Queuine tRNA-ribosyltransferase; ... 329 2e-88
CP001175_1020(CP001175|pid:none) Listeria monocytogenes HCC23, c... 328 3e-88
(Q5KWR4) RecName: Full=Queuine tRNA-ribosyltransferase; ... 328 4e-88
(Q837E7) RecName: Full=Queuine tRNA-ribosyltransferase; ... 327 5e-88
(Q71ZE0) RecName: Full=Queuine tRNA-ribosyltransferase; ... 327 6e-88
CP000936_1975(CP000936|pid:none) Streptococcus pneumoniae Hungar... 327 6e-88
(Q03ER2) RecName: Full=Queuine tRNA-ribosyltransferase; ... 327 6e-88
(A0AIX9) RecName: Full=Queuine tRNA-ribosyltransferase; ... 327 8e-88
CP001615_2675(CP001615|pid:none) Exiguobacterium sp. AT1b, compl... 327 8e-88
(A5ITG3) RecName: Full=Queuine tRNA-ribosyltransferase; ... 327 8e-88
CP000924_999(CP000924|pid:none) Thermoanaerobacter pseudethanoli... 326 1e-87
(Q03IQ5) RecName: Full=Queuine tRNA-ribosyltransferase; ... 325 2e-87
(Q5LY05) RecName: Full=Queuine tRNA-ribosyltransferase; ... 325 2e-87
(Q5M2K9) RecName: Full=Queuine tRNA-ribosyltransferase; ... 325 2e-87
FM177140_827(FM177140|pid:none) Lactobacillus casei BL23 complet... 325 2e-87
(Q9RRB5) RecName: Full=Queuine tRNA-ribosyltransferase; ... 325 2e-87
CP001022_2059(CP001022|pid:none) Exiguobacterium sibiricum 255-1... 325 2e-87
CP000920_1897(CP000920|pid:none) Streptococcus pneumoniae P1031,... 324 4e-87
CP000359_327(CP000359|pid:none) Deinococcus geothermalis DSM 113... 324 4e-87
(A4IRA9) RecName: Full=Queuine tRNA-ribosyltransferase; ... 324 5e-87
CP000423_741(CP000423|pid:none) Lactobacillus casei ATCC 334, co... 324 5e-87
CP000918_2008(CP000918|pid:none) Streptococcus pneumoniae 70585,... 323 7e-87
(A4VW51) RecName: Full=Queuine tRNA-ribosyltransferase; ... 323 1e-86
(Q72H19) RecName: Full=Queuine tRNA-ribosyltransferase; ... 322 2e-86
CP001124_2410(CP001124|pid:none) Geobacter bemidjiensis Bem, com... 322 2e-86
(Q9KDI5) RecName: Full=Queuine tRNA-ribosyltransferase; ... 322 2e-86
CP001114_2284(CP001114|pid:none) Deinococcus deserti VCD115, com... 322 2e-86
(Q5SLI7) RecName: Full=Queuine tRNA-ribosyltransferase; ... 322 3e-86
FM204883_247(FM204883|pid:none) Streptococcus equi subsp. equi 4... 321 5e-86
CP001129_180(CP001129|pid:none) Streptococcus equi subsp. zooepi... 320 6e-86
AM946015_1668(AM946015|pid:none) Streptococcus uberis 0140J comp... 319 2e-85
(A3DE13) RecName: Full=Queuine tRNA-ribosyltransferase; ... 319 2e-85
(A4J541) RecName: Full=Queuine tRNA-ribosyltransferase; ... 318 2e-85
(B5XJL3) RecName: Full=Queuine tRNA-ribosyltransferase; ... 318 3e-85
CP000233_1108(CP000233|pid:none) Lactobacillus salivarius UCC118... 318 4e-85
(Q3K2Y7) RecName: Full=Queuine tRNA-ribosyltransferase; ... 317 9e-85
X04616_15(X04616|pid:none) Synechococcus sp. PCC 7942 pmg1 (part... 316 1e-84
(Q8GAA6) RecName: Full=Queuine tRNA-ribosyltransferase; ... 316 1e-84
AP008231_1063(AP008231|pid:none) Synechococcus elongatus PCC 630... 316 1e-84
CP000113_4573(CP000113|pid:none) Myxococcus xanthus DK 1622, com... 315 3e-84
AP009552_1188(AP009552|pid:none) Microcystis aeruginosa NIES-843... 315 3e-84
(Q67Q92) RecName: Full=Queuine tRNA-ribosyltransferase; ... 314 4e-84
(Q5WHR2) RecName: Full=Queuine tRNA-ribosyltransferase; ... 314 4e-84
(A2RHN5) RecName: Full=Queuine tRNA-ribosyltransferase; ... 313 1e-83
AM778932_24(AM778932|pid:none) Microcystis aeruginosa PCC 7806 g... 312 2e-83
AP008230_2463(AP008230|pid:none) Desulfitobacterium hafniense Y5... 312 2e-83
CP000934_1420(CP000934|pid:none) Cellvibrio japonicus Ueda107, c... 312 2e-83
(Q032U4) RecName: Full=Queuine tRNA-ribosyltransferase; ... 311 4e-83
(Q55983) RecName: Full=Queuine tRNA-ribosyltransferase; ... 311 4e-83
(Q47AX3) RecName: Full=Queuine tRNA-ribosyltransferase; ... 311 4e-83
CP001287_2688(CP001287|pid:none) Cyanothece sp. PCC 8801, comple... 310 6e-83
CP000482_1771(CP000482|pid:none) Pelobacter propionicus DSM 2379... 309 1e-82
CP001089_1988(CP001089|pid:none) Geobacter lovleyi SZ, complete ... 308 2e-82
CP000749_2617(CP000749|pid:none) Marinomonas sp. MWYL1, complete... 308 3e-82
CP000930_1769(CP000930|pid:none) Heliobacterium modesticaldum Ic... 308 3e-82
CU468230_480(CU468230|pid:none) Acinetobacter baumannii str. SDF... 307 7e-82
CP000863_3164(CP000863|pid:none) Acinetobacter baumannii ACICU, ... 306 1e-81
(Q15WI4) RecName: Full=Queuine tRNA-ribosyltransferase; ... 306 2e-81
(A6Q3Y5) RecName: Full=Queuine tRNA-ribosyltransferase; ... 305 2e-81
(Q3SH61) RecName: Full=Queuine tRNA-ribosyltransferase; ... 305 2e-81
(A6Q906) RecName: Full=Queuine tRNA-ribosyltransferase; ... 305 3e-81
AY967124_1(AY967124|pid:none) Synthetic construct isolate FTT112... 305 3e-81
CP001344_712(CP001344|pid:none) Cyanothece sp. PCC 7425, complet... 305 3e-81
CP000083_1081(CP000083|pid:none) Colwellia psychrerythraea 34H, ... 304 4e-81
(Q5QVL2) RecName: Full=Queuine tRNA-ribosyltransferase; ... 304 6e-81
(A5FSU3) RecName: Full=Queuine tRNA-ribosyltransferase; ... 304 6e-81
(Q3ZWC1) RecName: Full=Queuine tRNA-ribosyltransferase; ... 303 1e-80
AY774236_1(AY774236|pid:none) Synthetic construct Francisella tu... 303 1e-80
(A0Q6X1) RecName: Full=Queuine tRNA-ribosyltransferase; ... 303 1e-80
(Q7NMG4) RecName: Full=Queuine tRNA-ribosyltransferase; ... 303 1e-80
(A1TZN7) RecName: Full=Queuine tRNA-ribosyltransferase; ... 302 2e-80
AE017180_2604(AE017180|pid:none) Geobacter sulfurreducens PCA, c... 302 2e-80
CP001393_350(CP001393|pid:none) Anaerocellum thermophilum DSM 67... 302 2e-80
(Q8YVT9) RecName: Full=Queuine tRNA-ribosyltransferase; ... 301 3e-80
AE016795_423(AE016795|pid:none) Vibrio vulnificus CMCP6 chromoso... 301 4e-80
CP000086_1265(CP000086|pid:none) Burkholderia thailandensis E264... 301 5e-80
CP000812_440(CP000812|pid:none) Thermotoga lettingae TMO, comple... 301 5e-80
(A5D3G6) RecName: Full=Queuine tRNA-ribosyltransferase; ... 300 6e-80
(B6EK65) RecName: Full=Queuine tRNA-ribosyltransferase; ... 300 6e-80
(B8E2N5) RecName: Full=Queuine tRNA-ribosyltransferase; ... 300 8e-80
CT978603_2311(CT978603|pid:none) Synechococcus sp. RCC307 genomi... 300 1e-79
CP000323_1696(CP000323|pid:none) Psychrobacter cryohalolentis K5... 300 1e-79
(A3N087) RecName: Full=Queuine tRNA-ribosyltransferase; ... 300 1e-79
(A1VJ15) RecName: Full=Queuine tRNA-ribosyltransferase; ... 300 1e-79
(Q5F9U5) RecName: Full=Queuine tRNA-ribosyltransferase; ... 299 2e-79
CP000915_1023(CP000915|pid:none) Francisella tularensis subsp. m... 299 2e-79
CP000155_4253(CP000155|pid:none) Hahella chejuensis KCTC 2396, c... 299 2e-79
(Q9KTY9) RecName: Full=Queuine tRNA-ribosyltransferase; ... 299 2e-79
CP000875_628(CP000875|pid:none) Herpetosiphon aurantiacus ATCC 2... 298 2e-79
(A5F3H2) RecName: Full=Queuine tRNA-ribosyltransferase; ... 298 2e-79
(Q2Y6A3) RecName: Full=Queuine tRNA-ribosyltransferase; ... 298 3e-79
CP000270_471(CP000270|pid:none) Burkholderia xenovorans LB400 ch... 298 4e-79
CP000572_3314(CP000572|pid:none) Burkholderia pseudomallei 1106a... 298 4e-79
(P44594) RecName: Full=Queuine tRNA-ribosyltransferase; ... 298 4e-79
CP000951_2735(CP000951|pid:none) Synechococcus sp. PCC 7002, com... 298 4e-79
(A1SWU0) RecName: Full=Queuine tRNA-ribosyltransferase; ... 298 4e-79
CP000570_3284(CP000570|pid:none) Burkholderia pseudomallei 668 c... 297 5e-79
CP001408_3448(CP001408|pid:none) Burkholderia pseudomallei MSHR3... 297 5e-79
(Q9JVA4) RecName: Full=Queuine tRNA-ribosyltransferase; ... 297 5e-79
(Q87S36) RecName: Full=Queuine tRNA-ribosyltransferase; ... 297 5e-79
(Q5E3D2) RecName: Full=Queuine tRNA-ribosyltransferase; ... 297 5e-79
BX571965_2896(BX571965|pid:none) Burkholderia pseudomallei strai... 297 5e-79
(A7MT83) RecName: Full=Queuine tRNA-ribosyltransferase; ... 297 7e-79
CP000142_1332(CP000142|pid:none) Pelobacter carbinolicus DSM 238... 297 7e-79
(Q30S46) RecName: Full=Queuine tRNA-ribosyltransferase; ... 297 7e-79
CP000127_2256(CP000127|pid:none) Nitrosococcus oceani ATCC 19707... 297 7e-79
(A4G1Z3) RecName: Full=Queuine tRNA-ribosyltransferase; ... 296 9e-79
CP000932_550(CP000932|pid:none) Campylobacter lari RM2100, compl... 296 1e-78
CP000141_1475(CP000141|pid:none) Carboxydothermus hydrogenoforma... 296 2e-78
(P57831) RecName: Full=Queuine tRNA-ribosyltransferase; ... 296 2e-78
FM954972_535(FM954972|pid:none) Vibrio splendidus LGP32 chromoso... 296 2e-78
(A6SUU4) RecName: Full=Queuine tRNA-ribosyltransferase; ... 296 2e-78
(A1KSY1) RecName: Full=Queuine tRNA-ribosyltransferase; ... 295 3e-78
CP000240_500(CP000240|pid:none) Synechococcus sp. JA-2-3B'a(2-13... 295 3e-78
(A8H2K8) RecName: Full=Queuine tRNA-ribosyltransferase; ... 295 3e-78
AM910985_115(AM910985|pid:none) Plasmodium knowlesi strain H chr... 295 4e-78
CP001229_1194(CP001229|pid:none) Sulfurihydrogenibium azorense A... 295 4e-78
(Q8CWM7) RecName: Full=Queuine tRNA-ribosyltransferase; ... 294 6e-78
CP001321_306(CP001321|pid:none) Haemophilus parasuis SH0165, com... 293 8e-78
(A8LRQ1) RecName: Full=Queuine tRNA-ribosyltransferase; ... 293 8e-78
CP000142_2034(CP000142|pid:none) Pelobacter carbinolicus DSM 238... 293 8e-78
(A0LFR2) RecName: Full=Queuine tRNA-ribosyltransferase; ... 293 8e-78
(Q9K096) RecName: Full=Queuine tRNA-ribosyltransferase; ... 293 8e-78
(B0TND4) RecName: Full=Queuine tRNA-ribosyltransferase; ... 293 8e-78
(A8GUA5) RecName: Full=Queuine tRNA-ribosyltransferase; ... 293 8e-78
CP000489_1869(CP000489|pid:none) Paracoccus denitrificans PD1222... 293 1e-77
CP000095_330(CP000095|pid:none) Prochlorococcus marinus str. NAT... 293 1e-77
(A5EW66) RecName: Full=Queuine tRNA-ribosyltransferase; ... 293 1e-77
(Q1GIL3) RecName: Full=Queuine tRNA-ribosyltransferase; ... 293 1e-77
AM902716_3659(AM902716|pid:none) Bordetella petrii strain DSM 12... 293 1e-77
(Q0I4R8) RecName: Full=Queuine tRNA-ribosyltransferase; ... 293 1e-77
(Q1H403) RecName: Full=Queuine tRNA-ribosyltransferase; ... 293 1e-77
CP001072_275(CP001072|pid:none) Helicobacter pylori Shi470, comp... 292 2e-77
(O08314) RecName: Full=Queuine tRNA-ribosyltransferase; ... 291 3e-77
CP000614_667(CP000614|pid:none) Burkholderia vietnamiensis G4 ch... 291 3e-77
CP001130_218(CP001130|pid:none) Hydrogenobaculum sp. Y04AAS1, co... 291 3e-77
(A8EZT7) RecName: Full=Queuine tRNA-ribosyltransferase; ... 291 4e-77
(A1K3W9) RecName: Full=Queuine tRNA-ribosyltransferase; ... 291 5e-77
CP000774_3038(CP000774|pid:none) Parvibaculum lavamentivorans DS... 290 7e-77
FP236842_2654(FP236842|pid:none) Erwinia pyrifoliae strain Ep1/9... 290 7e-77
BX640426_174(BX640426|pid:none) Bordetella parapertussis strain ... 290 7e-77
CP000947_298(CP000947|pid:none) Haemophilus somnus 2336, complet... 290 9e-77
CP000879_392(CP000879|pid:none) Petrotoga mobilis SJ95, complete... 290 9e-77
(Q5P720) RecName: Full=Queuine tRNA-ribosyltransferase; ... 290 9e-77
CU633749_2528(CU633749|pid:none) Cupriavidus taiwanensis str. LM... 290 1e-76
AP009385_565(AP009385|pid:none) Burkholderia multivorans ATCC 17... 290 1e-76
CP000471_597(CP000471|pid:none) Magnetococcus sp. MC-1, complete... 290 1e-76
(Q1RH25) RecName: Full=Queuine tRNA-ribosyltransferase; ... 289 1e-76
CP001025_631(CP001025|pid:none) Burkholderia ambifaria MC40-6 ch... 289 1e-76
(Q12PD9) RecName: Full=Queuine tRNA-ribosyltransferase; ... 289 1e-76
BX640441_63(BX640441|pid:none) Bordetella bronchiseptica strain ... 289 2e-76
(B5ZA47) RecName: Full=Queuine tRNA-ribosyltransferase; ... 289 2e-76
CP000815_478(CP000815|pid:none) Paulinella chromatophora chromat... 289 2e-76
(A6WQ52) RecName: Full=Queuine tRNA-ribosyltransferase; ... 288 3e-76
CP000661_1145(CP000661|pid:none) Rhodobacter sphaeroides ATCC 17... 288 3e-76
(A3D6B1) RecName: Full=Queuine tRNA-ribosyltransferase; ... 288 3e-76
CP001635_5010(CP001635|pid:none) Variovorax paradoxus S110 chrom... 288 3e-76
(Q6D855) RecName: Full=Queuine tRNA-ribosyltransferase; ... 288 3e-76
CP000440_608(CP000440|pid:none) Burkholderia ambifaria AMMD chro... 288 4e-76
EF089399_38(EF089399|pid:none) Uncultured marine bacterium EB0_3... 288 4e-76
(A6VN75) RecName: Full=Queuine tRNA-ribosyltransferase; ... 288 4e-76
(Q7M8N8) RecName: Full=Queuine tRNA-ribosyltransferase; ... 288 4e-76
CP001472_2054(CP001472|pid:none) Acidobacterium capsulatum ATCC ... 288 4e-76
(Q92GM6) RecName: Full=Queuine tRNA-ribosyltransferase; ... 288 4e-76
CP001614_2325(CP001614|pid:none) Teredinibacter turnerae T7901, ... 287 6e-76
(Q7MB01) RecName: Full=Queuine tRNA-ribosyltransferase; ... 287 6e-76
CP000390_1397(CP000390|pid:none) Mesorhizobium sp. BNC1, complet... 287 6e-76
(Q7NYC7) RecName: Full=Queuine tRNA-ribosyltransferase; ... 287 7e-76
(A7ZD89) RecName: Full=Queuine tRNA-ribosyltransferase; ... 287 7e-76
AP009384_2307(AP009384|pid:none) Azorhizobium caulinodans ORS 57... 287 7e-76
(Q65S94) RecName: Full=Queuine tRNA-ribosyltransferase; ... 287 7e-76
(A1S7P2) RecName: Full=Queuine tRNA-ribosyltransferase; ... 287 7e-76
(Q5LQ80) RecName: Full=Queuine tRNA-ribosyltransferase; ... 286 1e-75
(Q31CR1) RecName: Full=Queuine tRNA-ribosyltransferase; ... 286 1e-75
(Q7TUM6) RecName: Full=Queuine tRNA-ribosyltransferase; ... 286 1e-75
(A8F2K6) RecName: Full=Queuine tRNA-ribosyltransferase; ... 286 1e-75
CP001001_19(CP001001|pid:none) Methylobacterium radiotolerans JC... 286 1e-75
(Q07ZM2) RecName: Full=Queuine tRNA-ribosyltransferase; ... 286 1e-75
CP001096_2821(CP001096|pid:none) Rhodopseudomonas palustris TIE-... 286 1e-75
CP001281_3234(CP001281|pid:none) Thauera sp. MZ1T, complete geno... 286 1e-75
AM167904_843(AM167904|pid:none) Bordetella avium 197N complete g... 286 1e-75
Y12061_3(Y12061|pid:none) Helicobacter pylori aroB, tgt genes an... 286 1e-75
CP000453_1205(CP000453|pid:none) Alkalilimnicola ehrlichii MLHE-... 286 2e-75
CP001358_2002(CP001358|pid:none) Desulfovibrio desulfuricans sub... 286 2e-75
(A8GPN2) RecName: Full=Queuine tRNA-ribosyltransferase; ... 286 2e-75
(Q8ECM3) RecName: Full=Queuine tRNA-ribosyltransferase; ... 286 2e-75
(A3QFF5) RecName: Full=Queuine tRNA-ribosyltransferase; ... 285 2e-75
(A8GTF4) RecName: Full=Queuine tRNA-ribosyltransferase; ... 285 2e-75
(Q1LJ59) RecName: Full=Queuine tRNA-ribosyltransferase; ... 285 3e-75
(Q0T7I3) RecName: Full=Queuine tRNA-ribosyltransferase; ... 285 3e-75
AM942759_75(AM942759|pid:none) Proteus mirabilis strain HI4320, ... 285 3e-75
CP001349_2566(CP001349|pid:none) Methylobacterium nodulans ORS 2... 285 3e-75
(Q8Z8Y0) RecName: Full=Queuine tRNA-ribosyltransferase; ... 285 3e-75
(Q3ILB8) RecName: Full=Queuine tRNA-ribosyltransferase; ... 285 3e-75
(Q5PFT6) RecName: Full=Queuine tRNA-ribosyltransferase; ... 285 3e-75
CP000738_1258(CP000738|pid:none) Sinorhizobium medicae WSM419, c... 285 4e-75
(A1A876) RecName: Full=Queuine tRNA-ribosyltransferase; ... 285 4e-75
(Q17YB5) RecName: Full=Queuine tRNA-ribosyltransferase; ... 285 4e-75
(Q57SF8) RecName: Full=Queuine tRNA-ribosyltransferase; ... 284 5e-75
(Q9A7Y1) RecName: Full=Queuine tRNA-ribosyltransferase; ... 284 5e-75
(A4W779) RecName: Full=Queuine tRNA-ribosyltransferase; ... 284 6e-75
CP000362_2741(CP000362|pid:none) Roseobacter denitrificans OCh 1... 284 6e-75
CP000878_299(CP000878|pid:none) Prochlorococcus marinus str. MIT... 284 6e-75
CP000758_2160(CP000758|pid:none) Ochrobactrum anthropi ATCC 4918... 284 6e-75
(Q98M57) RecName: Full=Queuine tRNA-ribosyltransferase; ... 284 6e-75
AM933172_384(AM933172|pid:none) Salmonella enterica subsp. enter... 284 6e-75
CP000148_2373(CP000148|pid:none) Geobacter metallireducens GS-15... 284 6e-75
(Q8YHB2) RecName: Full=Queuine tRNA-ribosyltransferase; ... 284 6e-75
(A0KJ20) RecName: Full=Queuine tRNA-ribosyltransferase; ... 283 8e-75
BX572601_150(BX572601|pid:none) Rhodopseudomonas palustris CGA00... 283 8e-75
(Q8UES8) RecName: Full=Queuine tRNA-ribosyltransferase; ... 283 8e-75
(Q7VDR5) RecName: Full=Queuine tRNA-ribosyltransferase; ... 283 8e-75
CP000698_3201(CP000698|pid:none) Geobacter uraniireducens Rf4, c... 283 1e-74
(Q3J2H4) RecName: Full=Queuine tRNA-ribosyltransferase; ... 283 1e-74
CP000628_1801(CP000628|pid:none) Agrobacterium radiobacter K84 c... 283 1e-74
(O67331) RecName: Full=Queuine tRNA-ribosyltransferase; ... 283 1e-74
(A3PJT9) RecName: Full=Queuine tRNA-ribosyltransferase; ... 283 1e-74
CP001150_1163(CP001150|pid:none) Rhodobacter sphaeroides KD131 c... 283 1e-74
CP001013_1558(CP001013|pid:none) Leptothrix cholodnii SP-6, comp... 283 1e-74
(Q3B088) RecName: Full=Queuine tRNA-ribosyltransferase; ... 283 1e-74
M63939_1(M63939|pid:none) E.coli tRNA-guanine-transglycosylase (... 283 1e-74
(A3PAZ2) RecName: Full=Queuine tRNA-ribosyltransferase; ... 283 1e-74
(Q8XVW4) RecName: Full=Queuine tRNA-ribosyltransferase; ... 283 1e-74
CP001277_80(CP001277|pid:none) Candidatus Hamiltonella defensa 5... 282 2e-74
CP001068_2913(CP001068|pid:none) Ralstonia pickettii 12J chromos... 281 3e-74
CP000769_2383(CP000769|pid:none) Anaeromyxobacter sp. Fw109-5, c... 281 3e-74
CP000859_84(CP000859|pid:none) Desulfococcus oleovorans Hxd3, co... 281 3e-74
(A1WFH2) RecName: Full=Queuine tRNA-ribosyltransferase; ... 281 3e-74
CP000267_615(CP000267|pid:none) Rhodoferax ferrireducens T118, c... 281 3e-74
BA000040_4683(BA000040|pid:none) Bradyrhizobium japonicum USDA 1... 281 4e-74
(A8G2T1) RecName: Full=Queuine tRNA-ribosyltransferase; ... 281 4e-74
CP001389_1547(CP001389|pid:none) Rhizobium sp. NGR234, complete ... 281 4e-74
AM746676_1654(AM746676|pid:none) Sorangium cellulosum 'So ce 56'... 281 5e-74
(A4TPH6) RecName: Full=Queuine tRNA-ribosyltransferase; ... 281 5e-74
(B7IDU1) RecName: Full=Queuine tRNA-ribosyltransferase; ... 280 7e-74
CP001074_2131(CP001074|pid:none) Rhizobium etli CIAT 652, comple... 280 7e-74
(Q7VHX2) RecName: Full=Queuine tRNA-ribosyltransferase; ... 280 7e-74
CP000860_1299(CP000860|pid:none) Candidatus Desulforudis audaxvi... 280 7e-74
(A0RPL5) RecName: Full=Queuine tRNA-ribosyltransferase; ... 280 9e-74
CP000076_4903(CP000076|pid:none) Pseudomonas fluorescens Pf-5, c... 280 9e-74
CP000283_2592(CP000283|pid:none) Rhodopseudomonas palustris BisB... 280 9e-74
(A1TVN0) RecName: Full=Queuine tRNA-ribosyltransferase; ... 280 1e-73
CP001392_3087(CP001392|pid:none) Diaphorobacter sp. TPSY, comple... 280 1e-73
(A8GAM5) RecName: Full=Queuine tRNA-ribosyltransferase; ... 280 1e-73
AM181176_4960(AM181176|pid:none) Pseudomonas fluorescens SBW25 c... 279 2e-73
CP001071_271(CP001071|pid:none) Akkermansia muciniphila ATCC BAA... 279 2e-73
(A7I2I6) RecName: Full=Queuine tRNA-ribosyltransferase; ... 279 2e-73
CU459003_3385(CU459003|pid:none) Magnetospirillum gryphiswaldens... 279 2e-73
(A5N204) RecName: Full=Queuine tRNA-ribosyltransferase; ... 279 2e-73
CP001154_2743(CP001154|pid:none) Laribacter hongkongensis HLHK9,... 278 3e-73
CP000943_5243(CP000943|pid:none) Methylobacterium sp. 4-46, comp... 278 3e-73
(Q887B0) RecName: Full=Queuine tRNA-ribosyltransferase; ... 278 4e-73
CP000884_548(CP000884|pid:none) Delftia acidovorans SPH-1, compl... 277 6e-73
CP000699_131(CP000699|pid:none) Sphingomonas wittichii RW1, comp... 277 6e-73
CP001158_119(CP001158|pid:none) Buchnera aphidicola str. Tuc7 (A... 277 6e-73
CP000916_1144(CP000916|pid:none) Thermotoga neapolitana DSM 4359... 277 6e-73
AY597274_3(AY597274|pid:none) Pseudomonas viridiflava strain RMX... 277 6e-73
CP001197_2734(CP001197|pid:none) Desulfovibrio vulgaris str. 'Mi... 277 8e-73
CP000777_2208(CP000777|pid:none) Leptospira biflexa serovar Pato... 276 1e-72
CP001359_1391(CP001359|pid:none) Anaeromyxobacter dehalogenans 2... 276 1e-72
CP001196_2188(CP001196|pid:none) Oligotropha carboxidovorans OM5... 276 1e-72
CP000250_2859(CP000250|pid:none) Rhodopseudomonas palustris HaA2... 276 1e-72
CP000908_3031(CP000908|pid:none) Methylobacterium extorquens PA1... 276 1e-72
CP001131_1296(CP001131|pid:none) Anaeromyxobacter sp. K, complet... 276 2e-72
CP000414_326(CP000414|pid:none) Leuconostoc mesenteroides subsp.... 276 2e-72
(A2BP70) RecName: Full=Queuine tRNA-ribosyltransferase; ... 276 2e-72
CP001191_1736(CP001191|pid:none) Rhizobium leguminosarum bv. tri... 276 2e-72
(Q8KA09) RecName: Full=Queuine tRNA-ribosyltransferase; ... 276 2e-72
CP001029_3225(CP001029|pid:none) Methylobacterium populi BJ001, ... 275 2e-72
(Q9PNT0) RecName: Full=Queuine tRNA-ribosyltransferase; ... 275 3e-72
(Q8XJ16) RecName: Full=Queuine tRNA-ribosyltransferase; ... 275 4e-72
(Q0SRN5) RecName: Full=Queuine tRNA-ribosyltransferase; ... 275 4e-72
(Q30XF7) RecName: Full=Queuine tRNA-ribosyltransferase; ... 274 6e-72
CP000927_2181(CP000927|pid:none) Caulobacter sp. K31, complete g... 274 6e-72
CP000251_1423(CP000251|pid:none) Anaeromyxobacter dehalogenans 2... 274 6e-72
(A5IM22) RecName: Full=Queuine tRNA-ribosyltransferase; ... 273 8e-72
AJ937771_12(AJ937771|pid:none) Uncultured Flavobacteriaceae bact... 273 8e-72
(A7GHT6) RecName: Full=Queuine tRNA-ribosyltransferase; ... 273 8e-72
CP000304_2984(CP000304|pid:none) Pseudomonas stutzeri A1501, com... 273 8e-72
CP000969_1206(CP000969|pid:none) Thermotoga sp. RQ2, complete ge... 273 1e-71
(Q5HUF2) RecName: Full=Queuine tRNA-ribosyltransferase; ... 273 1e-71
CP000075_1227(CP000075|pid:none) Pseudomonas syringae pv. syring... 273 1e-71
AP009153_627(AP009153|pid:none) Gemmatimonas aurantiaca T-27 DNA... 273 1e-71
(Q1GR26) RecName: Full=Queuine tRNA-ribosyltransferase; ... 273 1e-71
CP000524_700(CP000524|pid:none) Bartonella bacilliformis KC583, ... 273 1e-71
CP001016_2289(CP001016|pid:none) Beijerinckia indica subsp. indi... 273 1e-71
CP001111_1615(CP001111|pid:none) Stenotrophomonas maltophilia R5... 272 2e-71
CP000769_1309(CP000769|pid:none) Anaeromyxobacter sp. Fw109-5, c... 272 2e-71
(Q97GT3) RecName: Full=Queuine tRNA-ribosyltransferase; ... 272 2e-71
CU234118_3769(CU234118|pid:none) Bradyrhizobium sp. ORS278,compl... 272 2e-71
DQ489736_370(DQ489736|pid:none) Leuconostoc citreum KM20, comple... 272 2e-71
CP000712_848(CP000712|pid:none) Pseudomonas putida F1, complete ... 272 2e-71
(Q88PL7) RecName: Full=Queuine tRNA-ribosyltransferase; ... 272 2e-71
(Q72E53) RecName: Full=Queuine tRNA-ribosyltransferase; ... 272 2e-71
(Q7UWK9) RecName: Full=Queuine tRNA-ribosyltransferase; ... 272 2e-71
FJ946987_45(FJ946987|pid:none) Pseudomonas syringae pv. tabaci s... 271 3e-71
(A7H331) RecName: Full=Queuine tRNA-ribosyltransferase; ... 271 3e-71
CP000158_1116(CP000158|pid:none) Hyphomonas neptunium ATCC 15444... 271 3e-71
CP000411_1157(CP000411|pid:none) Oenococcus oeni PSU-1, complete... 271 4e-71
(Q7TTX7) RecName: Full=Queuine tRNA-ribosyltransferase; ... 271 5e-71
CP001275_781(CP001275|pid:none) Thermomicrobium roseum DSM 5159,... 270 9e-71
CP001078_889(CP001078|pid:none) Clostridium botulinum E3 str. Al... 270 9e-71
CU207366_588(CU207366|pid:none) Gramella forsetii KT0803 complet... 269 2e-70
(Q8PJL7) RecName: Full=Queuine tRNA-ribosyltransferase; ... 269 2e-70
(B2FN00) RecName: Full=Queuine tRNA-ribosyltransferase; ... 269 2e-70
AE003849_223(AE003849|pid:none) Xylella fastidiosa 9a5c, complet... 268 3e-70
(A7GYD5) RecName: Full=Queuine tRNA-ribosyltransferase; ... 268 5e-70
(Q2G639) RecName: Full=Queuine tRNA-ribosyltransferase; ... 267 6e-70
CP001357_1261(CP001357|pid:none) Brachyspira hyodysenteriae WA1,... 266 1e-69
CP000494_4100(CP000494|pid:none) Bradyrhizobium sp. BTAi1, compl... 266 1e-69
(A9HBJ2) RecName: Full=Queuine tRNA-ribosyltransferase; ... 266 1e-69
CP000941_170(CP000941|pid:none) Xylella fastidiosa M12, complete... 266 1e-69
CP001230_1842(CP001230|pid:none) Persephonella marina EX-H1, com... 266 2e-69
DQ295241_7(DQ295241|pid:none) Uncultured marine bacterium Ant39E... 265 4e-69
CP000607_1206(CP000607|pid:none) Chlorobium phaeovibrioides DSM ... 265 4e-69
CP001101_919(CP001101|pid:none) Chlorobium phaeobacteroides BS1,... 264 7e-69
(Q72TL3) RecName: Full=Queuine tRNA-ribosyltransferase; ... 264 7e-69
CP000697_1322(CP000697|pid:none) Acidiphilium cryptum JF-5, comp... 263 9e-69
(Q2P2X0) RecName: Full=Queuine tRNA-ribosyltransferase; ... 262 3e-68
CP000009_1390(CP000009|pid:none) Gluconobacter oxydans 621H, com... 261 4e-68
CP001055_496(CP001055|pid:none) Elusimicrobium minutum Pei191, c... 261 4e-68
CP001104_721(CP001104|pid:none) Eubacterium eligens ATCC 27750, ... 261 6e-68
AP006841_2301(AP006841|pid:none) Bacteroides fragilis YCH46 DNA,... 259 2e-67
AE015928_835(AE015928|pid:none) Bacteroides thetaiotaomicron VPI... 259 2e-67
CP001032_174(CP001032|pid:none) Opitutus terrae PB90-1, complete... 257 6e-67
CP000108_704(CP000108|pid:none) Chlorobium chlorochromatii CaD3,... 256 1e-66
AE015924_436(AE015924|pid:none) Porphyromonas gingivalis W83, co... 254 7e-66
CP001099_755(CP001099|pid:none) Chlorobaculum parvum NCIB 8327, ... 251 3e-65
AE006470_1377(AE006470|pid:none) Chlorobium tepidum TLS, complet... 250 8e-65
CU458896_272(CU458896|pid:none) Mycobacterium abscessus chromoso... 247 6e-64
AP008957_344(AP008957|pid:none) Rhodococcus erythropolis PR4 DNA... 247 6e-64
CP000384_4930(CP000384|pid:none) Mycobacterium sp. MCS, complete... 246 1e-63
CP000804_1611(CP000804|pid:none) Roseiflexus castenholzii DSM 13... 246 1e-63
CP000048_783(CP000048|pid:none) Borrelia hermsii DAH, complete g... 246 1e-63
AP006618_268(AP006618|pid:none) Nocardia farcinica IFM 10152 DNA... 246 2e-63
CP000976_779(CP000976|pid:none) Borrelia duttonii Ly, complete g... 246 2e-63
(A5USV3) RecName: Full=Queuine tRNA-ribosyltransferase; ... 245 2e-63
CP000395_821(CP000395|pid:none) Borrelia afzelii PKo, complete g... 245 3e-63
CP000656_1214(CP000656|pid:none) Mycobacterium gilvum PYR-GCK, c... 241 5e-62
CP000431_4130(CP000431|pid:none) Rhodococcus jostii RHA1, comple... 239 2e-61
CP000511_5494(CP000511|pid:none) Mycobacterium vanbaalenii PYR-1... 238 4e-61
CP001628_290(CP001628|pid:none) Micrococcus luteus NCTC 2665, co... 234 6e-60
AL844506_170(AL844506|pid:none) Plasmodium falciparum 3D7 chromo... 233 1e-59
(Q6MD31) RecName: Full=Queuine tRNA-ribosyltransferase; ... 231 5e-59
CU914168_2484(CU914168|pid:none) Ralstonia solanacearum strain I... 231 6e-59
EF537570_1(EF537570|pid:none) Borrelia burgdorferi strain N40 tR... 230 1e-58
BA000036_232(BA000036|pid:none) Corynebacterium glutamicum ATCC ... 229 2e-58
AE014184_152(AE014184|pid:none) Tropheryma whipplei str. Twist, ... 228 5e-58
CP000235_287(CP000235|pid:none) Anaplasma phagocytophilum HZ, co... 227 7e-58
BX251412_48(BX251412|pid:none) Tropheryma whipplei TW08/27, comp... 227 7e-58
AE014295_1186(AE014295|pid:none) Bifidobacterium longum NCC2705,... 227 9e-58
CP000474_704(CP000474|pid:none) Arthrobacter aurescens TC1, comp... 226 1e-57
CP000454_597(CP000454|pid:none) Arthrobacter sp. FB24, complete ... 226 2e-57
AP009152_298(AP009152|pid:none) Kocuria rhizophila DC2201 DNA, c... 226 2e-57
CP000910_3451(CP000910|pid:none) Renibacterium salmoninarum ATCC... 226 2e-57
AP009044_309(AP009044|pid:none) Corynebacterium glutamicum R DNA... 225 3e-57
CU694390_78(CU694390|pid:none) Ralstonia solanacearum strain Mol... 224 4e-57
(O51749) RecName: Full=Queuine tRNA-ribosyltransferase; ... 224 4e-57
CP001095_94(CP001095|pid:none) Bifidobacterium longum subsp. inf... 223 1e-56
EF537566_1(EF537566|pid:none) Borrelia burgdorferi strain 109a t... 222 2e-56
EF537568_1(EF537568|pid:none) Borrelia burgdorferi strain IP1 tR... 222 3e-56
AE017354_2676(AE017354|pid:none) Legionella pneumophila subsp. p... 221 4e-56
CP000107_560(CP000107|pid:none) Ehrlichia canis str. Jake, compl... 221 5e-56
EF537565_1(EF537565|pid:none) Borrelia burgdorferi strain 64b tR... 221 5e-56
EF537563_1(EF537563|pid:none) Borrelia burgdorferi strain Bol15 ... 221 6e-56
EF537572_1(EF537572|pid:none) Borrelia burgdorferi strain Ri5 tR... 221 6e-56
EF537560_1(EF537560|pid:none) Borrelia burgdorferi ZS7 tRNA-guan... 221 6e-56
EF537561_1(EF537561|pid:none) Borrelia burgdorferi strain Lx36 t... 221 6e-56
CP000675_2907(CP000675|pid:none) Legionella pneumophila str. Cor... 221 6e-56
CR925678_604(CR925678|pid:none) Ehrlichia ruminantium str. Welge... 220 8e-56
EF537564_1(EF537564|pid:none) Borrelia burgdorferi strain PKa2 t... 220 1e-55
CP001325_419(CP001325|pid:none) Micromonas sp. RCC299 chromosome... 220 1e-55
EF537569_1(EF537569|pid:none) Borrelia burgdorferi strain JD1 tR... 219 1e-55
CP001079_593(CP001079|pid:none) Anaplasma marginale str. Florida... 219 2e-55
CP001325_433(CP001325|pid:none) Micromonas sp. RCC299 chromosome... 219 2e-55
AY811825_1(AY811825|pid:none) Schistosoma japonicum SJCHGC03457 ... 219 2e-55
CP000733_1058(CP000733|pid:none) Coxiella burnetii Dugway 5J108-... 215 4e-54
CP000890_758(CP000890|pid:none) Coxiella burnetii RSA 331, compl... 214 5e-54
CR767821_597(CR767821|pid:none) Ehrlichia ruminantium strain Wel... 214 6e-54
CP001391_618(CP001391|pid:none) Wolbachia sp. wRi, complete geno... 214 8e-54
(Q822U8) RecName: Full=Queuine tRNA-ribosyltransferase; ... 210 9e-53
CP000613_2504(CP000613|pid:none) Rhodospirillum centenum SW, com... 209 2e-52
(Q254U7) RecName: Full=Queuine tRNA-ribosyltransferase; ... 209 3e-52
CP000237_16(CP000237|pid:none) Neorickettsia sennetsu strain Miy... 205 3e-51
AK294166_1(AK294166|pid:none) Homo sapiens cDNA FLJ52927 complet... 205 3e-51
AE017196_658(AE017196|pid:none) Wolbachia endosymbiont of Drosop... 203 1e-50
(Q9PKK0) RecName: Full=Queuine tRNA-ribosyltransferase; ... 201 4e-50
(Q9Z8W5) RecName: Full=Queuine tRNA-ribosyltransferase; ... 200 9e-50
AB083212_2(AB083212|pid:none) Pseudomonas aeruginosa merR, tRNA ... 199 2e-49
CP000477_126(CP000477|pid:none) Methanosaeta thermophila PT, com... 197 1e-48
AX588280_1(AX588280|pid:none) Sequence 155 from Patent WO0208389... 195 3e-48
FN357430_15(FN357430|pid:none) Schistosoma mansoni genome sequen... 195 4e-48
CP000588_165(CP000588|pid:none) Ostreococcus lucimarinus CCE9901... 191 5e-47
AC116960_54(AC116960|pid:none) Dictyostelium discoideum chromoso... 189 3e-46
CP000909_2787(CP000909|pid:none) Chloroflexus aurantiacus J-10-f... 184 5e-45
AM467514_1(AM467514|pid:none) Vitis vinifera contig VV78X001603.... 170 1e-40
AB052852_1(AB052852|pid:none) Enterococcus faecium gene for tRNA... 166 1e-39
CP000804_3179(CP000804|pid:none) Roseiflexus castenholzii DSM 13... 159 3e-37
CP000686_1932(CP000686|pid:none) Roseiflexus sp. RS-1, complete ... 159 3e-37
CP000249_3338(CP000249|pid:none) Frankia sp. CcI3, complete geno... 156 1e-36
AJ628421_35(AJ628421|pid:none) Micromonospora olivasterospora fo... 151 5e-35
AJ628149_12(AJ628149|pid:none) Micromonospora echinospora genomi... 151 5e-35
AJ575934_24(AJ575934|pid:none) Micromonospora purpurea DOS biosy... 144 8e-33
AF370379_1(AF370379|pid:none) Homo sapiens FP3235 mRNA, complete... 144 1e-32
AE008917_1002(AE008917|pid:none) Brucella melitensis 16M chromos... 143 1e-32
AY083905_4(AY083905|pid:none) Zymomonas mobilis strain CP4 putat... 142 2e-32
AC079852_7(AC079852|pid:none) Oryza sativa chromosome 10 clone O... 132 4e-29
AE014188_401(AE014188|pid:none) Plasmodium falciparum 3D7 chromo... 132 4e-29
AY826892_1(AY826892|pid:none) Heterocapsa triquetra clone HTQTR1... 125 4e-27
CP000887_879(CP000887|pid:none) Brucella abortus S19 chromosome ... 125 4e-27
AM910996_587(AM910996|pid:none) Plasmodium knowlesi strain H chr... 124 8e-27
AP007281_515(AP007281|pid:none) Lactobacillus reuteri JCM 1112 D... 116 2e-24
BT070866_1(BT070866|pid:none) Picea sitchensis clone WS02757_C13... 115 5e-24
AB120321_3(AB120321|pid:none) Pseudomonas aeruginosa orfI, orfQ,... 104 7e-21
BC045519_1(BC045519|pid:none) Danio rerio queuine tRNA-ribosyltr... 102 3e-20
AJ719488_1(AJ719488|pid:none) Gallus gallus mRNA for hypothetica... 102 4e-20
(A6UVD8) RecName: Full=7-cyano-7-deazaguanine tRNA-ribosyltransf... 100 2e-19
(Q2NGY4) RecName: Full=7-cyano-7-deazaguanine tRNA-ribosyltransf... 100 2e-19
(Q5R998) RecName: Full=Queuine tRNA-ribosyltransferase domain-co... 99 3e-19
(Q9H974) RecName: Full=Queuine tRNA-ribosyltransferase domain-co... 99 3e-19
CR457296_1(CR457296|pid:none) Homo sapiens full open reading fra... 99 4e-19
AY826891_1(AY826891|pid:none) Pavlova lutheri clone PLQTR1 chlor... 99 5e-19
(A6VJR4) RecName: Full=7-cyano-7-deazaguanine tRNA-ribosyltransf... 98 8e-19
BC135739_1(BC135739|pid:none) Xenopus tropicalis queuine tRNA-ri... 98 8e-19
FM985972_1(FM985972|pid:none) Mus musculus mRNA for queuine tRNA... 97 1e-18
AK296938_1(AK296938|pid:none) Homo sapiens cDNA FLJ51987 complet... 97 2e-18
AK299313_1(AK299313|pid:none) Homo sapiens cDNA FLJ54300 complet... 97 2e-18
(Q8PXW5) RecName: Full=7-cyano-7-deazaguanine tRNA-ribosyltransf... 97 2e-18
(A4FYL8) RecName: Full=7-cyano-7-deazaguanine tRNA-ribosyltransf... 94 9e-18
BT075768_1(BT075768|pid:none) Caligus rogercresseyi clone crog-e... 93 2e-17
(Q8THU2) RecName: Full=7-cyano-7-deazaguanine tRNA-ribosyltransf... 93 2e-17
PC7023(PC7023)hypothetical 167 protein - Acholeplasma laidlawii ... 92 6e-17
(O26278) RecName: Full=7-cyano-7-deazaguanine tRNA-ribosyltransf... 91 1e-16
(Q6DF96) RecName: Full=Queuine tRNA-ribosyltransferase domain-co... 89 4e-16
CP000582_411(CP000582|pid:none) Ostreococcus lucimarinus CCE9901... 88 9e-16
CP001338_1741(CP001338|pid:none) Candidatus Methanosphaerula pal... 87 1e-15
CP000493_452(CP000493|pid:none) Hyperthermus butylicus DSM 5456,... 87 1e-15
CP000477_1623(CP000477|pid:none) Methanosaeta thermophila PT, co... 87 2e-15
(Q46DI6) RecName: Full=7-cyano-7-deazaguanine tRNA-ribosyltransf... 86 2e-15
DQ104433_1(DQ104433|pid:none) Methanosarcina barkeri strain MS a... 85 6e-15
BC083089_1(BC083089|pid:none) Mus musculus queuine tRNA-ribosylt... 81 8e-14
CP001365_2131(CP001365|pid:none) Halorubrum lacusprofundi ATCC 4... 80 1e-13
(Q8TYV3) RecName: Full=7-cyano-7-deazaguanine tRNA-ribosyltransf... 79 4e-13
(Q9UZN0) RecName: Full=7-cyano-7-deazaguanine tRNA-ribosyltransf... 77 1e-12
CP000968_1347(CP000968|pid:none) Candidatus Korarchaeum cryptofi... 76 3e-12
CP000562_1282(CP000562|pid:none) Methanoculleus marisnigri JR1, ... 76 3e-12
CP000780_1307(CP000780|pid:none) Candidatus Methanoregula boonei... 75 6e-12
(Q8TH08) RecName: Full=7-cyano-7-deazaguanine tRNA-ribosyltransf... 75 6e-12
(Q9C4M3) RecName: Full=7-cyano-7-deazaguanine tRNA-ribosyltransf... 74 1e-11
(Q9YAC2) RecName: Full=7-cyano-7-deazaguanine tRNA-ribosyltransf... 74 1e-11
AM472379_2(AM472379|pid:none) Vitis vinifera contig VV79X008371.... 74 1e-11
CP001329_109(CP001329|pid:none) Micromonas sp. RCC299 chromosome... 73 3e-11
CP000866_1532(CP000866|pid:none) Nitrosopumilus maritimus SCM1, ... 72 5e-11
(Q2FUA5) RecName: Full=7-cyano-7-deazaguanine tRNA-ribosyltransf... 71 8e-11
CR954202_607(CR954202|pid:none) Ostreococcus tauri strain OTTH05... 71 8e-11
CP000852_24(CP000852|pid:none) Caldivirga maquilingensis IC-167,... 71 8e-11
(O29667) RecName: Full=7-cyano-7-deazaguanine tRNA-ribosyltransf... 70 1e-10
X56175_2(X56175|pid:none) Escherichia coli secD and secF genes f... 70 1e-10
(Q9HI54) RecName: Full=7-cyano-7-deazaguanine tRNA-ribosyltransf... 70 2e-10
EU960805_1(EU960805|pid:none) Zea mays clone 228758 unknown mRNA. 70 2e-10
>AP005399_23(AP005399|pid:none) Oryza sativa Japonica Group genomic
DNA, chromosome 9, PAC clone:P0676H02.
&AP005574_11(AP005574|pid:none)
&AP008215_887(AP008215|pid:none)
Length = 417
Score = 531 bits (1369), Expect = e-149
Identities = 245/377 (64%), Positives = 304/377 (80%)
Frame = +2
Query: 227 LQFEIVGKWGKARAAKLTLPHHQCSTPMFMPVGTQGTVKGLTSQQLVDLNCGVVLGNTYH 406
L+FE++G++ +ARAA+LTLPH C TP+FMPVGTQGT+KGLT+ QL ++ C ++LGNTYH
Sbjct: 3 LRFEVLGRFNRARAARLTLPHFTCQTPLFMPVGTQGTIKGLTTDQLEEIGCQIILGNTYH 62
Query: 407 LGHRPGPEVMDSVGGLHKFMNYPRAMLTDSGGFQMVSLLQLAEITEQGVQFQSPHDGSTM 586
L RPG +++D +GGLHKFMN+ RA+LTDSGGFQMVSLL LA+ITE+GV FQSP DG M
Sbjct: 63 LELRPGSQLIDDLGGLHKFMNWKRALLTDSGGFQMVSLLHLADITEEGVTFQSPVDGKPM 122
Query: 587 VLTPELSMGIQNSIGADIMMALDDVVSSTTVGPRVEQAMYRTLRWIDRCIKAHKKPDTQN 766
+LTPE S+ IQN+IGADI+MALDDVV +T GPR+E+AMYRTLRWIDRCI AHKKPD QN
Sbjct: 123 LLTPEESIHIQNNIGADIIMALDDVVKTTITGPRIEEAMYRTLRWIDRCIAAHKKPDVQN 182
Query: 767 IFAIVQGGLDSRLRDICMEGLMAREFPGYAIGGLSGGESKDMFWRVVHQCTSKLPENKPR 946
+F IVQGGLD LRDIC++GL+ R PGYAIGGL+GGE KD FWRVV QCT+ LPE+KPR
Sbjct: 183 LFGIVQGGLDPVLRDICVKGLVERNLPGYAIGGLAGGEDKDSFWRVVAQCTAGLPEDKPR 242
Query: 947 YLMGVGYALDLVVCSALGVDMFDCVFPSRTARFGTALVASGSLNLKSSEYAFDFTPIDSE 1126
Y+MGVGY LD+VVCSALG DM+DCV+P+RTARFGTALV G L LK + A D PID
Sbjct: 243 YVMGVGYPLDIVVCSALGADMYDCVYPTRTARFGTALVPEGVLKLKQNAMATDERPIDPT 302
Query: 1127 CTCMVCKNYTKAYLHIVAGKEAIGGQLLTFHNIHYQMSLMSQIRQSIIDQTFPNFVKSFI 1306
C CMVCKNYT+AYLH + K+A+G QLL++HN+ + M L + SI++ FP FV+ F+
Sbjct: 303 CPCMVCKNYTRAYLHCLVTKDAMGSQLLSYHNLSFMMRLSRDLHMSILEGRFPEFVRGFL 362
Query: 1307 NKQYPNNDCPQWALDAL 1357
Q+P D P+W +A+
Sbjct: 363 RMQFPKGDVPKWVRNAM 379
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3236559
Number of Hits to DB: 2,529,689,106
Number of extensions: 56951999
Number of successful extensions: 171302
Number of sequences better than 10.0: 565
Number of HSP's gapped: 170260
Number of HSP's successfully gapped: 587
Length of query: 465
Length of database: 1,051,180,864
Length adjustment: 132
Effective length of query: 333
Effective length of database: 623,955,076
Effective search space: 207777040308
Effective search space used: 207777040308
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 32 (16.9 bits)
|