NBDC - アーカイブトップ - ヘルプ
データベースの説明 | データ項目の説明 | 利用許諾 | ヘルプ
Dicty_cDB
Contig List | Clone List | cDNA Library List
Atlas
Atlas | Atlas Image List
NBDC - LSDB Archive
Description of this DB | Description of data items | Download | License
Dicty_cDB
Contig List | Clone List | cDNA Library List
Atlas
Atlas | Atlas Image List
Contig-U14401-1
Contig ID Contig-U14401-1
Contig update 2002.12.18
Contig sequence 
>Contig-U14401-1 (Contig-U14401-1Q) /CSM_Contig/Contig-U14401-1Q.Seq.d
NNNNNNNNNNTTNCAAAAGTATCTTCATATATTAAAAGTGAATTAGCAAC
TTNCTNGTATCAGATTATAACCTTTTAATTCAAATGAGCCAATATAACAT
CATCAAAANACCAAGATATGACAAATGTAACTAAAGGTTTATCNGTTTTT
ANGGGTGATTTAAAGATCAAATATGAAGANTTTCANCCATATTTCGATAA
AATTAATGAACTTGATAAAAATGTAACCGATTTAGAGAAAACAGTACAAT
TATTAGATGAATATACTAAAAGATTGGAACAAAAAGTTAAAAATATTGAT
AAAAGTTCTTTACTTCCAACTAAACAAATTCAACCACCACAACCAATACC
ACAACAACAACCAGCACAACCAGCACAACCAACACAACCAACACAACCAG
CACAACAACCATCTCAAGTATCAACAGAAACTAAGCCTCAAGAAAATATA
GAAAATAAATAAAA
Gap no gap
Contig length 464
Chromosome number (1..6, M) 3
Chromosome length 6358359
Start point 803095
End point 802640
Strand (PLUS/MINUS) MINUS
Number of clones 1
Number of EST 1
Link to clone list U14401
List of clone(s) 

est1=CHM504Z,1,455
Translated Amino Acid sequence 
xxxxxkvssyikselatxxyqiitf*fk*ANITSSKXQDMTNVTKGLSVFXGDLKIKYEX
FXPYFDKINELDKNVTDLEKTVQLLDEYTKRLEQKVKNIDKSSLLPTKQIQPPQPIPQQQ
PAQPAQPTQPTQPAQQPSQVSTETKPQENIENK*
Translated Amino Acid sequence (All Frames) 
Frame A:
xxxxxkvssyikselatxxyqiitf*fk*ANITSSKXQDMTNVTKGLSVFXGDLKIKYEX
FXPYFDKINELDKNVTDLEKTVQLLDEYTKRLEQKVKNIDKSSLLPTKQIQPPQPIPQQQ
PAQPAQPTQPTQPAQQPSQVSTETKPQENIENK*


Frame B:
xxxxqkylhilkvn*qlxxirl*pfnsnepi*hhqxtki*qm*lkvyxflxvi*rsnmkx
fxhisiklmnlikm*pi*rkqyny*mnilkdwnkklkilikvlyfqlnkfnhhnqyhnnn
qhnqhnqhnqhnqhnnhlkyqqklslkki*kink


Frame C:
xxxxksifiy*k*isnxlvsdynlliqmsqyniikxprydkcn*rfixfxg*fkdqi*rx
sxifr*n**t**kcnrfrenstiir*iy*kigtks*ky**kfftsn*tnsttttnttttt
sttsttnttnttstttissinrn*asrkyrk*ik
own update 2004. 6.10
Homology vs CSM-cDNA 
Query= Contig-U14401-1 (Contig-U14401-1Q)
/CSM_Contig/Contig-U14401-1Q.Seq.d
         (464 letters)

Database: CSM
           6905 sequences; 5,674,871 total letters


                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

Contig-U14401-1 (Contig-U14401-1Q) /CSM_Contig/Conti...   567  e-162
Contig-U12625-1 (Contig-U12625-1Q) /CSM_Contig/Conti...    38  0.008
Contig-U12378-1 (Contig-U12378-1Q) /CSM_Contig/Conti...    36  0.032
Contig-U05260-1 (Contig-U05260-1Q) /CSM_Contig/Conti...    36  0.032
Contig-U14258-1 (Contig-U14258-1Q) /CSM_Contig/Conti...    34  0.13
Contig-U13898-1 (Contig-U13898-1Q) /CSM_Contig/Conti...    34  0.13
Contig-U13394-1 (Contig-U13394-1Q) /CSM_Contig/Conti...    34  0.13
Contig-U11722-1 (Contig-U11722-1Q) /CSM_Contig/Conti...    34  0.13
Contig-U11579-1 (Contig-U11579-1Q) /CSM_Contig/Conti...    34  0.13
Contig-U10937-1 (Contig-U10937-1Q) /CSM_Contig/Conti...    34  0.13

>Contig-U14401-1 (Contig-U14401-1Q) /CSM_Contig/Contig-U14401-1Q.Seq.d
          Length = 464

 Score =  567 bits (286), Expect = e-162
 Identities = 307/307 (100%)
 Strand = Plus / Plus

                                                                       
Query: 14  caaaagtatcttcatatattaaaagtgaattagcaacttnctngtatcagattataacct 73
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 14  caaaagtatcttcatatattaaaagtgaattagcaacttnctngtatcagattataacct 73

                                                                       
Query: 74  tttaattcaaatgagccaatataacatcatcaaaanaccaagatatgacaaatgtaacta 133
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 74  tttaattcaaatgagccaatataacatcatcaaaanaccaagatatgacaaatgtaacta 133

                                                                       
Query: 134 aaggtttatcngtttttangggtgatttaaagatcaaatatgaagantttcanccatatt 193
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 134 aaggtttatcngtttttangggtgatttaaagatcaaatatgaagantttcanccatatt 193

                                                                       
Query: 194 tcgataaaattaatgaacttgataaaaatgtaaccgatttagagaaaacagtacaattat 253
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 194 tcgataaaattaatgaacttgataaaaatgtaaccgatttagagaaaacagtacaattat 253

                                                                       
Query: 254 tagatgaatatactaaaagattggaacaaaaagttaaaaatattgataaaagttctttac 313
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 254 tagatgaatatactaaaagattggaacaaaaagttaaaaatattgataaaagttctttac 313

                  
Query: 314 ttccaac 320
           |||||||
Sbjct: 314 ttccaac 320


 Score =  109 bits (55), Expect = 3e-24
 Identities = 55/55 (100%)
 Strand = Plus / Plus

                                                                  
Query: 410 catctcaagtatcaacagaaactaagcctcaagaaaatatagaaaataaataaaa 464
           |||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 410 catctcaagtatcaacagaaactaagcctcaagaaaatatagaaaataaataaaa 464


>Contig-U12625-1 (Contig-U12625-1Q) /CSM_Contig/Contig-U12625-1Q.Seq.d
          Length = 894

 Score = 38.2 bits (19), Expect = 0.008
 Identities = 22/23 (95%)
 Strand = Plus / Plus

                                  
Query: 283 aaagttaaaaatattgataaaag 305
           ||||||||||||||||| |||||
Sbjct: 698 aaagttaaaaatattgaaaaaag 720


>Contig-U12378-1 (Contig-U12378-1Q) /CSM_Contig/Contig-U12378-1Q.Seq.d
          Length = 972

 Score = 36.2 bits (18), Expect = 0.032
 Identities = 18/18 (100%)
 Strand = Plus / Plus

                             
Query: 446 atatagaaaataaataaa 463
           ||||||||||||||||||
Sbjct: 930 atatagaaaataaataaa 947


  Database: CSM
    Posted date:  Jun 9, 2004  7:35 PM
  Number of letters in database: 5,674,871
  Number of sequences in database:  6905
  
Lambda     K      H
    1.37    0.711     1.31 

Gapped
Lambda     K      H
    1.37    0.711     1.31 


Matrix: blastn matrix:1 -3
Gap Penalties: Existence: 5, Extension: 2
Number of Hits to DB: 8758
Number of Sequences: 6905
Number of extensions: 8758
Number of successful extensions: 1014
Number of sequences better than 10.0: 239
length of query: 464
length of database: 5,674,871
effective HSP length: 16
effective length of query: 448
effective length of database: 5,564,391
effective search space: 2492847168
effective search space used: 2492847168
T: 0
A: 40
X1: 6 (11.9 bits)
X2: 15 (29.7 bits)
S1: 12 (24.3 bits)
S2: 14 (28.2 bits)
dna update 2008.12.21
Homology vs DNA 
Query= Contig-U14401-1 (Contig-U14401-1Q) /CSM_Contig/Contig-U14401-1Q.Seq.d
         (464 letters)

Database: ddbj_A
           92,845,959 sequences; 95,242,211,685 total letters

Searching..................................................done

                                                             Score    E
Sequences producing significant alignments:                  (bits) Value  N

(BJ383736) Dictyostelium discoideum cDNA clone:ddc47g01, 3' ...   557   e-178  2
(AC149629) Dasypus novemcinctus clone VMRC5-517D14, WORKING ...    54   0.005  1
(AC149628) Dasypus novemcinctus clone VMRC5-138M11, WORKING ...    54   0.005  1
(EJ358131) 1092963673390 Global-Ocean-Sampling_GS-28-01-01-1...    40   0.12   2
(AC158156) Mus musculus chromosome 3, clone RP23-145F12, com...    48   0.28   1
(AC127550) Mus musculus BAC clone RP24-535F16 from chromosom...    48   0.28   1
(AZ931363) 474.dhz65a09.s1 Saccharomyces unisporus NRRL Y-15...    48   0.28   1
(AC095436) Rattus norvegicus clone CH230-7A3, WORKING DRAFT ...    40   0.36   3
(AF063866) Melanoplus sanguinipes entomopoxvirus, complete g...    36   0.61   7
(EL602973) He_pwd_0141F02_M13R Heliconius erato pooled wing ...    32   0.96   3
(CR382300) Zebrafish DNA sequence from clone DKEY-25E11 in l...    46   1.1    1
(AC146688) Gallus gallus BAC clone CH261-24P18 from chromoso...    46   1.1    1
(AC107365) Danio rerio, clone -241I7, complete sequence.           46   1.1    1
(AL672233) Mouse DNA sequence from clone RP23-54I20 on chrom...    46   1.1    1
(AM431732) Vitis vinifera, whole genome shotgun sequence, co...    46   1.1    1
(AY043292) Tribolium castaneum strain GA-2 HOMC gene cluster...    46   1.1    1
(CR925819) Zebrafish DNA sequence *** SEQUENCING IN PROGRESS...    46   1.1    1
(AC021628) Mus musculus clone RP23-164K14, *** SEQUENCING IN...    46   1.1    1
(AC021579) Mus musculus chromosome 11 clone RP23-61C14 map 1...    46   1.1    1
(EK402430) 1095469545259 Global-Ocean-Sampling_GS-31-01-01-1...    46   1.1    1
(AE015927) Clostridium tetani E88, complete genome.                46   1.1    1
(AC006790) Caenorhabditis elegans cosmid Y49F6B, complete se...    42   1.5    2
(AE014827) Plasmodium falciparum 3D7 chromosome 14 section 1...    36   2.3    8
(CR855862) Zebrafish DNA sequence from clone DKEY-208O10 in ...    36   3.0    3
(AC178654) Strongylocentrotus purpuratus clone R3-11O14, WOR...    38   3.6    3
(AP001099) Homo sapiens genomic DNA, chromosome 18 clone:RP1...    40   4.0    2
(CR149660) Reverse strand read from insert in 3'HPRT inserti...    38   4.3    2
(CT573356) Zebrafish DNA sequence from clone CH211-276F18 in...    44   4.3    1
(BV406882) S229P6459FH6.T0 GermanShepherd Canis familiaris S...    44   4.3    1
(AC121842) Mus musculus BAC clone RP24-80L24 from chromosome...    44   4.3    1
(AM483494) Vitis vinifera contig VV78X061816.10, whole genom...    44   4.3    1
(AM477685) Vitis vinifera contig VV79X001154.3, whole genome...    44   4.3    1
(AM462754) Vitis vinifera contig VV78X106561.8, whole genome...    44   4.3    1
(AP003057) Homo sapiens genomic DNA, chromosome 11q clone:RP...    44   4.3    1
(AC098485) Homo sapiens BAC clone CTD-2053I13 from 2, comple...    44   4.3    1
(AC011403) Homo sapiens chromosome 5 clone CTB-3P13, complet...    44   4.3    1
(AC125693) Rattus norvegicus clone CH230-137N5, WORKING DRAF...    44   4.3    1
(AC073169) Homo sapiens chromosome 11 clone RP11-87E1 map 11...    44   4.3    1
(AC179995) Strongylocentrotus purpuratus clone R3-3036I24, W...    44   4.3    1
(AC176024) Strongylocentrotus purpuratus clone R3-3024L3, WO...    44   4.3    1
(AC009550) Homo sapiens clone RP11-382M14, WORKING DRAFT SEQ...    44   4.3    1
(ER455531) 1092963867420 Global-Ocean-Sampling_GS-35-01-01-1...    44   4.3    1
(ER454906) 1092963864156 Global-Ocean-Sampling_GS-35-01-01-1...    44   4.3    1
(EI451367) PV_GBa0051A12.f PV_GBa Phaseolus vulgaris genomic...    44   4.3    1
(ED398362) AUAC-aap28a08.g1 Ascaris suum whole genome shotgu...    44   4.3    1
(ED381331) AUAC-aab28f03.g1 Ascaris suum whole genome shotgu...    44   4.3    1
(DU094590) 109545 Tomato HindIII BAC Library Solanum lycoper...    44   4.3    1
(CT508806) A BAC library has been constructed from cultivar ...    44   4.3    1
(BZ516068) BOMRT17TR BO_2_3_KB Brassica oleracea genomic clo...    44   4.3    1
(BX240588) Danio rerio genomic clone DKEY-288B14, genomic su...    44   4.3    1
(BX208028) Danio rerio genomic clone DKEY-240I14, genomic su...    44   4.3    1
(BX132903) Danio rerio genomic clone DKEY-95J23, genomic sur...    44   4.3    1
(EL401792) CFFS13002.b1_D12.ab1 CFF(LMS) safflower Carthamus...    44   4.3    1
(EL392918) CFFM4441.b1_A08.ab1 CFF(LMS) safflower Carthamus ...    44   4.3    1
(EL385963) CFFM2340.b1_G09.ab1 CFF(LMS) safflower Carthamus ...    44   4.3    1
(EL385324) CFFM22465.b1_A02.ab1 CFF(LMS) safflower Carthamus...    44   4.3    1
(EL383699) CFFM20958.b1_K08.ab1 CFF(LMS) safflower Carthamus...    44   4.3    1
(EL378923) CFFM16199.b1_M17.ab1 CFF(LMS) safflower Carthamus...    44   4.3    1
(EL376160) CFFM13453.b1_I03.ab1 CFF(LMS) safflower Carthamus...    44   4.3    1
(DB771889) Apis mellifera head cDNA, RIKEN full-length enric...    44   4.3    1
(CJ746364) Ipomoea nil cDNA clone:jmsf34f11, 5' end.               44   4.3    1
(CJ745754) Ipomoea nil cDNA clone:jmsf32k03, 5' end.               44   4.3    1
(AA889554) ak20e02.s1 Soares_testis_NHT Homo sapiens cDNA cl...    44   4.3    1
(FG430522) 010421KABA014509HT (KABA) A. deliciosa petal Acti...    44   4.3    1
(AC117878) Rattus norvegicus clone CH230-36E16, WORKING DRAF...    40   4.6    5
(BJ384698) Dictyostelium discoideum cDNA clone:ddc50l10, 3' ...    34   5.2    2
(EJ727484) 1092959668343 Global-Ocean-Sampling_GS-30-02-01-1...    40   6.0    2
(EK070771) 1092960190307 Global-Ocean-Sampling_GS-31-01-01-1...    36   6.5    2
(EK346792) 1095467555568 Global-Ocean-Sampling_GS-31-01-01-1...    38   6.7    2
(EJ714764) 1092957964754 Global-Ocean-Sampling_GS-30-02-01-1...    40   6.7    2
(AC016459) Homo sapiens clone RP11-6L2, WORKING DRAFT SEQUEN...    40   6.8    3
(EJ123666) 1092343384621 Global-Ocean-Sampling_GS-27-01-01-1...    40   7.0    2
(EK070354) 1092960185336 Global-Ocean-Sampling_GS-31-01-01-1...    38   7.2    2
(EK009196) 1092955146622 Global-Ocean-Sampling_GS-31-01-01-1...    38   7.2    2
(EK010909) 1092955179262 Global-Ocean-Sampling_GS-31-01-01-1...    38   7.5    2
(CT842159) Pig DNA sequence from clone CH242-270B4 on chromo...    32   7.8    2
(AC090348) Homo sapiens chromosome 18, clone RP11-834M2, com...    36   8.2    4
(CU633684) Pig DNA sequence *** SEQUENCING IN PROGRESS *** f...    38   8.4    4
(AC182545) Dasypus novemcinctus clone VMRC5-1E20, WORKING DR...    34   9.1    4
(BX927397) Zebrafish DNA sequence from clone DKEY-87H7 in li...    36   9.2    3
(AC216154) Equus caballus clone CH241-249J14, WORKING DRAFT ...    34   9.4    4

>(BJ383736) Dictyostelium discoideum cDNA clone:ddc47g01, 3' end,
           single read.
          Length = 455

 Score =  557 bits (281), Expect(2) = e-178
 Identities = 302/302 (100%)
 Strand = Plus / Minus


Query: 14  caaaagtatcttcatatattaaaagtgaattagcaacttnctngtatcagattataacct 73
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 452 caaaagtatcttcatatattaaaagtgaattagcaacttnctngtatcagattataacct 393


Query: 74  tttaattcaaatgagccaatataacatcatcaaaanaccaagatatgacaaatgtaacta 133
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 392 tttaattcaaatgagccaatataacatcatcaaaanaccaagatatgacaaatgtaacta 333


Query: 134 aaggtttatcngtttttangggtgatttaaagatcaaatatgaagantttcanccatatt 193
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 332 aaggtttatcngtttttangggtgatttaaagatcaaatatgaagantttcanccatatt 273


Query: 194 tcgataaaattaatgaacttgataaaaatgtaaccgatttagagaaaacagtacaattat 253
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 272 tcgataaaattaatgaacttgataaaaatgtaaccgatttagagaaaacagtacaattat 213


Query: 254 tagatgaatatactaaaagattggaacaaaaagttaaaaatattgataaaagttctttac 313
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 212 tagatgaatatactaaaagattggaacaaaaagttaaaaatattgataaaagttctttac 153


Query: 314 tt 315
           ||
Sbjct: 152 tt 151

 Score =  105 bits (53), Expect(2) = e-178
 Identities = 53/53 (100%)
 Strand = Plus / Minus


Query: 412 tctcaagtatcaacagaaactaagcctcaagaaaatatagaaaataaataaaa 464
           |||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 54  tctcaagtatcaacagaaactaagcctcaagaaaatatagaaaataaataaaa 2

Lambda     K      H
    1.37    0.711     1.31

Matrix: blastn matrix:1 -3
Number of Sequences: 92845959
Number of Hits to DB: 455,394,108
Number of extensions: 34812910
Number of successful extensions: 2962431
Number of sequences better than 10.0: 81
Length of query: 464
Length of database: 95,242,211,685
Length adjustment: 23
Effective length of query: 441
Effective length of database: 93,106,754,628
Effective search space: 41060078790948
Effective search space used: 41060078790948
X1: 11 (21.8 bits)
S2: 21 (42.1 bits)
protein update 2009. 7.11
Homology vs Protein 
Query= Contig-U14401-1 (Contig-U14401-1Q) /CSM_Contig/Contig-U14401-1Q.Seq.d
         (464 letters)

Database: nrp_B
           3,236,559 sequences; 1,051,180,864 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

(Q54Y67) RecName: Full=Probable biogenesis of lysosome-related o...   179   3e-44
(A7RZS0) RecName: Full=Probable biogenesis of lysosome-related o...    58   9e-08
BT047140_1(BT047140|pid:none) Salmo salar clone ssal-rgb2-617-05...    58   9e-08
BX897740_1(BX897740|pid:none) Zebrafish DNA sequence from clone ...    57   2e-07
(Q66KB9) RecName: Full=Biogenesis of lysosome-related organelles...    57   3e-07
BT075414_1(BT075414|pid:none) Osmerus mordax clone omor-rgc-506-...    56   3e-07
(Q6QNY1) RecName: Full=Biogenesis of lysosome-related organelles...    54   2e-06
(Q4R7C8) Biogenesis of lysosome-related organelles complex 1 sub...    54   2e-06
(Q32WR5) RecName: Full=Biogenesis of lysosome-related organelles...    54   2e-06
(Q9CWG9) RecName: Full=Biogenesis of lysosome-related organelles...    54   2e-06
AY278457_1(AY278457|pid:none) Homo sapiens 11 kDa centrosome ass...    54   2e-06
DQ363500_1(DQ363500|pid:none) Ictalurus punctatus isolate SOOH10...    50   2e-05
AC084197_17(AC084197|pid:none) Caenorhabditis elegans cosmid Y73...    47   3e-04
AK111037_1(AK111037|pid:none) Oryza sativa Japonica Group cDNA c...    46   5e-04
EU958940_1(EU958940|pid:none) Zea mays clone 208427 phytoene deh...    45   0.001
AK340308_1(AK340308|pid:none) Acyrthosiphon pisum ACYPI008364 mR...    44   0.002
DQ311161_1(DQ311161|pid:none) Bombyx mori E2F transcription fact...    37   0.21
BA000023_2271(BA000023|pid:none) Sulfolobus tokodaii str. 7 DNA,...    36   0.47
CP000493_959(CP000493|pid:none) Hyperthermus butylicus DSM 5456,...    34   1.8
AL844509_184(AL844509|pid:none) Plasmodium falciparum 3D7 chromo...    34   1.8
AM412317_766(AM412317|pid:none) Clostridium botulinum A str. ATC...    33   3.1
CP000742_90(CP000742|pid:none) Methanococcus vannielii SB, compl...    33   3.1
T25223(T25223) hypothetical protein T24B8.2 - Caenorhabditis ele...    33   3.1
CP000505_523(CP000505|pid:none) Thermofilum pendens Hrk 5, compl...    33   4.0
CP000764_1101(CP000764|pid:none) Bacillus cereus subsp. cytotoxi...    33   4.0
DQ491002_341(DQ491002|pid:none) Paramecium bursaria Chlorella vi...    33   4.0
(Q57986) RecName: Full=Ferrous iron transport protein B homolog;...    33   4.0
FN357340_51(FN357340|pid:none) Schistosoma mansoni genome sequen...    32   5.2
CP000679_1239(CP000679|pid:none) Caldicellulosiruptor saccharoly...    32   5.2
DQ389164_1(DQ389164|pid:none) Oryza sativa Japonica Group dual p...    32   6.8
BC064236_1(BC064236|pid:none) Xenopus tropicalis tumor susceptib...    32   6.8
AE009951_566(AE009951|pid:none) Fusobacterium nucleatum subsp. n...    32   6.8
AP008972_152(AP008972|pid:none) Finegoldia magna ATCC 29328 plas...    32   6.8
AM910987_178(AM910987|pid:none) Plasmodium knowlesi strain H chr...    32   8.9
FJ660625_1(FJ660625|pid:none) Oryza sativa Japonica Group cultiv...    32   8.9
CP001080_1627(CP001080|pid:none) Sulfurihydrogenibium sp. YO3AOP...    32   8.9
CP000505_1264(CP000505|pid:none) Thermofilum pendens Hrk 5, comp...    32   8.9
FM992688_419(FM992688|pid:none) Candida dubliniensis CD36 chromo...    32   8.9
AK071121_1(AK071121|pid:none) Oryza sativa Japonica Group cDNA c...    32   8.9
CP001185_1493(CP001185|pid:none) Thermosipho africanus TCF52B, c...    32   8.9
CP001047_207(CP001047|pid:none) Mycoplasma arthritidis 158L3-1, ...    32   8.9
(Q53RB0) RecName: Full=Probable lipoxygenase 4;          EC=1.13...    32   8.9

>(Q54Y67) RecName: Full=Probable biogenesis of lysosome-related
           organelles complex 1 subunit 2;          Short=BLOC
           subunit 2;
          Length = 242

 Score =  179 bits (453), Expect = 3e-44
 Identities = 103/150 (68%), Positives = 106/150 (70%), Gaps = 2/150 (1%)
 Frame = +1

Query: 16  KVSSYIKSELATXX--YQIITF*FK*ANITSSKXQDMTNVTKGLSVFXGDLKIKYEXFXP 189
           KVSSYIKSELAT    Y ++    +  NITSSK QDMTNVTKGLSVF GDLKIKYE F P
Sbjct: 96  KVSSYIKSELATTVSDYNLL---IQMNNITSSKYQDMTNVTKGLSVFMGDLKIKYEEFQP 152

Query: 190 YFDKINELDKNVTDLEKTVQLLDEYTKRLEQKVKNIDKSSLLPTKXXXXXXXXXXXXXXX 369
           YFDKINELDKNVTDLEKTVQLLDEYTKRLEQKVKNIDKSSLLPTK
Sbjct: 153 YFDKINELDKNVTDLEKTVQLLDEYTKRLEQKVKNIDKSSLLPTKQIQPPQPIPQQQPAQ 212

Query: 370 XXXXXXXXXXXXXXSQVSTETKPQENIENK 459
                         SQVSTETKPQENIENK
Sbjct: 213 PAQPTQPTQPAQQPSQVSTETKPQENIENK 242

Lambda     K      H
   0.318    0.134    0.401

Gapped
Lambda     K      H
   0.267   0.0410    0.140

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3236559
Number of Hits to DB: 409,172,856
Number of extensions: 5304417
Number of successful extensions: 17540
Number of sequences better than 10.0: 42
Number of HSP's gapped: 17519
Number of HSP's successfully gapped: 42
Length of query: 154
Length of database: 1,051,180,864
Length adjustment: 116
Effective length of query: 38
Effective length of database: 675,740,020
Effective search space: 25678120760
Effective search space used: 25678120760
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 29 (15.8 bits)
PSORT 

 psg: 0.74  gvh: 0.20  alm: 0.54  top: 0.53  tms: 0.00  mit: 0.22  mip: 0.00
 nuc: 0.00  erl: 0.00  erm: 0.00  pox: 0.00  px2: 0.00  vac: 0.00  rnp: 0.00
 act: 0.00  caa: 0.00  yqr: 0.00  tyr: 0.00  leu: 0.00  gpi: 0.00  myr: 0.00
 dna: 0.00  rib: 0.00  bac: 0.00  m1a: 0.00  m1b: 0.00  m2 : 0.00  mNt: 0.00
 m3a: 0.00  m3b: 0.00  m_ : 1.00 

	 48.0 %: nuclear
	 28.0 %: cytoplasmic
	 12.0 %: cytoskeletal
	  8.0 %: mitochondrial
	  4.0 %: vacuolar

>> prediction for Contig-U14401-1 is nuc
VS (DIR, S) 0
VH (FL, L) 0
VF (FL, S) 0
AH (FL, L) 0
AF (FL, S) 0
SL (DIR, L) 0
SS (DIR, S) 0
SH (FL, L) 0
SF (FL, S) 0
CH (FL, L) 1
CF (FL, S) 0
FCL (DIR, L) 0
FC (DIR, S) 0
FC-IC (SUB) 0