>Contig-U14282-1 (Contig-U14282-1Q) /CSM_Contig/Contig-U14282-1Q.Seq.d
NNNNNNNNNNGATTACATGTCAGGTTTTCCAACACACCCACATCGTGGTT
TCATTACGGTCACCTACATGCTAAAGGGTGAAATGAGACACAACGACAAC
CGTGGTAATCAAGGCCTGCTTAAAGAAGGCTCTGCCCAATTCATGGTGGC
AGGTAGAGGTATAGTCCATAGTGAAATGCCTATAAGAAATCACGAAGATC
AAAGCTTTTTCGCATTTCAGCTTTGGATTAACCTACCATCAGCAAAGAAA
ATGATTGACCCTTCCTATCAGGATTACCATTCAACTGAAATACCAACAAT
TGTCTCCATGGATGATACACATTTCAATAATTACACTGTAAAAATTTTGG
CTGGCCAATTCCAAGACACCATTGGTCCGATTGTAGATGAAAATTTAAAA
ACGTTTTTCTTTGATATCGAATTAAAACCGAATACAAAGTTTACCGATAT
TATTATACCCTCAACTCATAATACCTTTGTTTATGTCTACAATGGTAATG
GCAGATTCGGTGGTCCTGTCTCTCGTAGTAAACTTGTCAAAATTAATCAA
GTCGCTTTATTTTTAAATAATGGTGGTGATGAAAATTCTTTGGAT

est1=CHE331Z,1,586

XXXDYMSGFPTHPHRGFITVTYMLKGEMRHNDNRGNQGLLKEGSAQFMVAGRGIVHSEMP
IRNHEDQSFFAFQLWINLPSAKKMIDPSYQDYHSTEIPTIVSMDDTHFNNYTVKILAGQF
QDTIGPIVDENLKTFFFDIELKPNTKFTDIIIPSTHNTFVYVYNGNGRFGGPVSRSKLVK
INQVALFLNNGGDENSLD

Frame A:
xxxxlhvrfsntptswfhyghlhakg*netqrqpw*srpa*rrlcpihggr*rysp**na
ykksrrsklfrisald*ptiskend*pflsglpfn*ntnnclhg*ytfq*lhcknfgwpi
prhhwsdcr*kfknvfl*yrikteykvyryyytlns*ylclclqw*wqirwscls**tcq
n*ssrfifk*ww**kffg


Frame B:
XXXDYMSGFPTHPHRGFITVTYMLKGEMRHNDNRGNQGLLKEGSAQFMVAGRGIVHSEMP
IRNHEDQSFFAFQLWINLPSAKKMIDPSYQDYHSTEIPTIVSMDDTHFNNYTVKILAGQF
QDTIGPIVDENLKTFFFDIELKPNTKFTDIIIPSTHNTFVYVYNGNGRFGGPVSRSKLVK
INQVALFLNNGGDENSLD


Frame C:
xxxitcqvfqhthivvslrsptc*rvk*dttttvvikaclkkalpnswwqvev*sivkcl
*eitkikafshfsfgltyhqqrk*ltlpiritiqlkyqqlspwmihisiitl*kfwlans
ktplvrl*mki*krfslisn*nriqslpillypqliiplfmstmvmadsvvlslvvnlsk
likslyf*imvvmkilw

Query= Contig-U14282-1 (Contig-U14282-1Q)
/CSM_Contig/Contig-U14282-1Q.Seq.d
         (595 letters)

Database: CSM
           6905 sequences; 5,674,871 total letters


                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

Contig-U14282-1 (Contig-U14282-1Q) /CSM_Contig/Conti...  1160  0.0
Contig-U12034-1 (Contig-U12034-1Q) /CSM_Contig/Conti...    34  0.16
Contig-U11891-1 (Contig-U11891-1Q) /CSM_Contig/Conti...    34  0.16
Contig-U09281-1 (Contig-U09281-1Q) /CSM_Contig/Conti...    34  0.16
Contig-U13734-1 (Contig-U13734-1Q) /CSM_Contig/Conti...    32  0.65
Contig-U13453-1 (Contig-U13453-1Q) /CSM_Contig/Conti...    32  0.65
Contig-U13241-1 (Contig-U13241-1Q) /CSM_Contig/Conti...    32  0.65
Contig-U12566-1 (Contig-U12566-1Q) /CSM_Contig/Conti...    32  0.65
Contig-U12483-1 (Contig-U12483-1Q) /CSM_Contig/Conti...    32  0.65
Contig-U12382-1 (Contig-U12382-1Q) /CSM_Contig/Conti...    32  0.65

>Contig-U14282-1 (Contig-U14282-1Q) /CSM_Contig/Contig-U14282-1Q.Seq.d
          Length = 595

 Score = 1160 bits (585), Expect = 0.0
 Identities = 585/585 (100%)
 Strand = Plus / Plus

                                                                       
Query: 11  gattacatgtcaggttttccaacacacccacatcgtggtttcattacggtcacctacatg 70
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 11  gattacatgtcaggttttccaacacacccacatcgtggtttcattacggtcacctacatg 70

                                                                       
Query: 71  ctaaagggtgaaatgagacacaacgacaaccgtggtaatcaaggcctgcttaaagaaggc 130
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 71  ctaaagggtgaaatgagacacaacgacaaccgtggtaatcaaggcctgcttaaagaaggc 130

                                                                       
Query: 131 tctgcccaattcatggtggcaggtagaggtatagtccatagtgaaatgcctataagaaat 190
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 131 tctgcccaattcatggtggcaggtagaggtatagtccatagtgaaatgcctataagaaat 190

                                                                       
Query: 191 cacgaagatcaaagctttttcgcatttcagctttggattaacctaccatcagcaaagaaa 250
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 191 cacgaagatcaaagctttttcgcatttcagctttggattaacctaccatcagcaaagaaa 250

                                                                       
Query: 251 atgattgacccttcctatcaggattaccattcaactgaaataccaacaattgtctccatg 310
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 251 atgattgacccttcctatcaggattaccattcaactgaaataccaacaattgtctccatg 310

                                                                       
Query: 311 gatgatacacatttcaataattacactgtaaaaattttggctggccaattccaagacacc 370
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 311 gatgatacacatttcaataattacactgtaaaaattttggctggccaattccaagacacc 370

                                                                       
Query: 371 attggtccgattgtagatgaaaatttaaaaacgtttttctttgatatcgaattaaaaccg 430
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 371 attggtccgattgtagatgaaaatttaaaaacgtttttctttgatatcgaattaaaaccg 430

                                                                       
Query: 431 aatacaaagtttaccgatattattataccctcaactcataatacctttgtttatgtctac 490
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 431 aatacaaagtttaccgatattattataccctcaactcataatacctttgtttatgtctac 490

                                                                       
Query: 491 aatggtaatggcagattcggtggtcctgtctctcgtagtaaacttgtcaaaattaatcaa 550
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 491 aatggtaatggcagattcggtggtcctgtctctcgtagtaaacttgtcaaaattaatcaa 550

                                                        
Query: 551 gtcgctttatttttaaataatggtggtgatgaaaattctttggat 595
           |||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 551 gtcgctttatttttaaataatggtggtgatgaaaattctttggat 595


>Contig-U12034-1 (Contig-U12034-1Q) /CSM_Contig/Contig-U12034-1Q.Seq.d
          Length = 1236

 Score = 34.2 bits (17), Expect = 0.16
 Identities = 17/17 (100%)
 Strand = Plus / Minus

                            
Query: 556 tttatttttaaataatg 572
           |||||||||||||||||
Sbjct: 88  tttatttttaaataatg 72


>Contig-U11891-1 (Contig-U11891-1Q) /CSM_Contig/Contig-U11891-1Q.Seq.d
          Length = 1718

 Score = 34.2 bits (17), Expect = 0.16
 Identities = 17/17 (100%)
 Strand = Plus / Minus

                             
Query: 282  caactgaaataccaaca 298
            |||||||||||||||||
Sbjct: 1380 caactgaaataccaaca 1364


  Database: CSM
    Posted date:  Jun 9, 2004  7:35 PM
  Number of letters in database: 5,674,871
  Number of sequences in database:  6905
  
Lambda     K      H
    1.37    0.711     1.31 

Gapped
Lambda     K      H
    1.37    0.711     1.31 


Matrix: blastn matrix:1 -3
Gap Penalties: Existence: 5, Extension: 2
Number of Hits to DB: 6906
Number of Sequences: 6905
Number of extensions: 6906
Number of successful extensions: 664
Number of sequences better than 10.0: 82
length of query: 595
length of database: 5,674,871
effective HSP length: 16
effective length of query: 579
effective length of database: 5,564,391
effective search space: 3221782389
effective search space used: 3221782389
T: 0
A: 40
X1: 6 (11.9 bits)
X2: 15 (29.7 bits)
S1: 12 (24.3 bits)
S2: 15 (30.2 bits)

Query= Contig-U14282-1 (Contig-U14282-1Q) /CSM_Contig/Contig-U14282-1Q.Seq.d
         (595 letters)

Database: ddbj_A
           92,845,959 sequences; 95,242,211,685 total letters

Searching..................................................done

                                                             Score    E
Sequences producing significant alignments:                  (bits) Value  N

(BJ376884) Dictyostelium discoideum cDNA clone:ddc30n07, 3' ...  1158   0.0    1
(X54452) D.discoideum culmination spiA (Dd31) gene.               204   3e-48  1
(EJ402347) 1093012063792 Global-Ocean-Sampling_GS-28-01-01-1...    52   0.003  2
(EJ125482) 1092343392552 Global-Ocean-Sampling_GS-27-01-01-1...    42   0.020  3
(EB409756) Gf_AcGl1_09A01_SP6 AcGl1 Gryllus firmus cDNA clon...    48   0.36   1
(EJ296957) 1095388050895 Global-Ocean-Sampling_GS-27-01-01-1...    36   0.85   3
(CU459181) Zebrafish DNA sequence from clone CH73-378M16 in ...    44   1.7    3
(CU463314) Zebrafish DNA sequence from clone CH73-147D24 in ...    44   1.8    4
(ER531637) 1093015763899 Global-Ocean-Sampling_GS-35-01-01-1...    42   2.5    2
(CU151885) Zebrafish DNA sequence *** SEQUENCING IN PROGRESS...    44   5.6    2
(EJ907524) 1093018521600 Global-Ocean-Sampling_GS-30-02-01-1...    44   5.6    1
(EJ884596) 1093018411680 Global-Ocean-Sampling_GS-30-02-01-1...    44   5.6    1
(EJ628940) 1092963282861 Global-Ocean-Sampling_GS-29-01-01-1...    44   5.6    1
(EB244188) PEG003-C-221611-501 Normalized Pedal-Pleural Gang...    44   5.6    1
(DT636400) EST1151331 Normalized pine embryo library, Lib_D ...    44   5.6    1
(DT635840) EST1150771 Normalized pine embryo library, Lib_D ...    44   5.6    1
(DT634253) EST1149184 Normalized pine embryo library, Lib_D ...    44   5.6    1
(DR691052) EST1081138 Normalized pine embryo library, Lib_D ...    44   5.6    1
(DR690390) EST1080476 Normalized pine embryo library, Lib_D ...    44   5.6    1
(DR690175) EST1080261 Normalized pine embryo library, Lib_D ...    44   5.6    1
(DR688687) EST1078772 Normalized pine embryo library, Lib_D ...    44   5.6    1
(DR687566) EST1077648 Normalized pine embryo library, Lib_D ...    44   5.6    1
(DR388357) RTHG1_27_F03.g1_A029 Roots plus added mercury Pin...    44   5.6    1
(DR068749) RTDK1_2_E02.g1_A029 Roots, dark Pinus taeda cDNA ...    44   5.6    1
(DR021127) STRS1_42_B10.g1_A034 Shoot tip pitch canker susce...    44   5.6    1
(CX648958) COLD1_32_B08.b1_A029 Root cold Pinus taeda cDNA c...    44   5.6    1
(CX648161) COLD1_26_H10.g1_A029 Root cold Pinus taeda cDNA c...    44   5.6    1
(CX648082) COLD1_26_H10.b1_A029 Root cold Pinus taeda cDNA c...    44   5.6    1
(CX648003) COLD1_25_H10.g1_A029 Root cold Pinus taeda cDNA c...    44   5.6    1
(CF476988) RTWW3_5_D09.b1_A022 Well-watered loblolly pine ro...    44   5.6    1
(CD331662) StrPu537.004485 Sea urchin embryo 20hr blastula s...    44   5.6    1
(BQ697191) NXPV_050_F02_F NXPV (Nsf Xylem Planings wood Vert...    44   5.6    1
(BQ696965) NXPV_047_D11_F NXPV (Nsf Xylem Planings wood Vert...    44   5.6    1
(BM492250) NXRV_022_G01_F NXRV (Nsf Xylem Root wood Vertical...    44   5.6    1
(BI397557) NXPV_100_G11_F NXPV (Nsf Xylem Planings wood Vert...    44   5.6    1
(FG615132) FEGLCD004_02-D09-F PD_BX library Pinus densiflora...    44   5.6    1
(CP000879) Petrotoga mobilis SJ95, complete genome.                44   5.6    1

>(BJ376884) Dictyostelium discoideum cDNA clone:ddc30n07, 3' end,
           single read.
          Length = 586

 Score = 1158 bits (584), Expect = 0.0
 Identities = 584/584 (100%)
 Strand = Plus / Minus


Query: 12  attacatgtcaggttttccaacacacccacatcgtggtttcattacggtcacctacatgc 71
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 585 attacatgtcaggttttccaacacacccacatcgtggtttcattacggtcacctacatgc 526


Query: 72  taaagggtgaaatgagacacaacgacaaccgtggtaatcaaggcctgcttaaagaaggct 131
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 525 taaagggtgaaatgagacacaacgacaaccgtggtaatcaaggcctgcttaaagaaggct 466


Query: 132 ctgcccaattcatggtggcaggtagaggtatagtccatagtgaaatgcctataagaaatc 191
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 465 ctgcccaattcatggtggcaggtagaggtatagtccatagtgaaatgcctataagaaatc 406


Query: 192 acgaagatcaaagctttttcgcatttcagctttggattaacctaccatcagcaaagaaaa 251
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 405 acgaagatcaaagctttttcgcatttcagctttggattaacctaccatcagcaaagaaaa 346


Query: 252 tgattgacccttcctatcaggattaccattcaactgaaataccaacaattgtctccatgg 311
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 345 tgattgacccttcctatcaggattaccattcaactgaaataccaacaattgtctccatgg 286


Query: 312 atgatacacatttcaataattacactgtaaaaattttggctggccaattccaagacacca 371
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 285 atgatacacatttcaataattacactgtaaaaattttggctggccaattccaagacacca 226


Query: 372 ttggtccgattgtagatgaaaatttaaaaacgtttttctttgatatcgaattaaaaccga 431
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 225 ttggtccgattgtagatgaaaatttaaaaacgtttttctttgatatcgaattaaaaccga 166


Query: 432 atacaaagtttaccgatattattataccctcaactcataatacctttgtttatgtctaca 491
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 165 atacaaagtttaccgatattattataccctcaactcataatacctttgtttatgtctaca 106


Query: 492 atggtaatggcagattcggtggtcctgtctctcgtagtaaacttgtcaaaattaatcaag 551
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 105 atggtaatggcagattcggtggtcctgtctctcgtagtaaacttgtcaaaattaatcaag 46


Query: 552 tcgctttatttttaaataatggtggtgatgaaaattctttggat 595
           ||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 45  tcgctttatttttaaataatggtggtgatgaaaattctttggat 2

Lambda     K      H
    1.37    0.711     1.31

Matrix: blastn matrix:1 -3
Number of Sequences: 92845959
Number of Hits to DB: 676,638,593
Number of extensions: 38843640
Number of successful extensions: 2962936
Number of sequences better than 10.0: 37
Length of query: 595
Length of database: 95,242,211,685
Length adjustment: 23
Effective length of query: 572
Effective length of database: 93,106,754,628
Effective search space: 53257063647216
Effective search space used: 53257063647216
X1: 11 (21.8 bits)
S2: 22 (44.1 bits)

Query= Contig-U14282-1 (Contig-U14282-1Q) /CSM_Contig/Contig-U14282-1Q.Seq.d
         (595 letters)

Database: nrp_B
           3,236,559 sequences; 1,051,180,864 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CP000967_3683(CP000967|pid:none) Xanthomonas oryzae pv. oryzae P...   164   2e-39
AE008922_2670(AE008922|pid:none) Xanthomonas campestris pv. camp...   162   5e-39
CU633749_859(CU633749|pid:none) Cupriavidus taiwanensis str. LMG...   157   2e-37
AM260479_933(AM260479|pid:none) Ralstonia eutropha H16 chromosom...   157   2e-37
CP001111_2980(CP001111|pid:none) Stenotrophomonas maltophilia R5...   157   2e-37
CP000450_685(CP000450|pid:none) Nitrosomonas eutropha C91, compl...   156   4e-37
CU861906_547(CU861906|pid:none) Ralstonia solanacearum strain Mo...   153   4e-36
CP000090_2476(CP000090|pid:none) Ralstonia eutropha JMP134 chrom...   153   4e-36
CU914168_585(CU914168|pid:none) Ralstonia solanacearum strain IP...   151   2e-35
AE016825_1920(AE016825|pid:none) Chromobacterium violaceum ATCC ...   151   2e-35
CR555306_2201(CR555306|pid:none) Azoarcus sp. EbN1 complete geno...   150   3e-35
CP001339_1046(CP001339|pid:none) Thioalkalivibrio sp. HL-EbGR7, ...   150   3e-35
CP001068_412(CP001068|pid:none) Ralstonia pickettii 12J chromoso...   149   6e-35
AL646052_541(AL646052|pid:none) Ralstonia solanacearum GMI1000 c...   147   2e-34
CP001132_2752(CP001132|pid:none) Acidithiobacillus ferrooxidans ...   144   1e-33
CP001616_2875(CP001616|pid:none) Tolumonas auensis DSM 9187, com...   142   5e-33
CP001103_1851(CP001103|pid:none) Alteromonas macleodii 'Deep eco...   142   7e-33
CP001013_304(CP001013|pid:none) Leptothrix cholodnii SP-6, compl...   142   9e-33
CP000267_793(CP000267|pid:none) Rhodoferax ferrireducens T118, c...   141   1e-32
FM178379_1200(FM178379|pid:none) Aliivibrio salmonicida LFI1238 ...   140   2e-32
CP000116_1112(CP000116|pid:none) Thiobacillus denitrificans ATCC...   140   3e-32
BA000045_2532(BA000045|pid:none) Gloeobacter violaceus PCC 7421 ...   140   3e-32
CP000655_485(CP000655|pid:none) Polynucleobacter necessarius sub...   139   5e-32
CP000449_440(CP000449|pid:none) Maricaulis maris MCS10, complete...   139   5e-32
CP000934_2367(CP000934|pid:none) Cellvibrio japonicus Ueda107, c...   138   1e-31
CP000473_6083(CP000473|pid:none) Solibacter usitatus Ellin6076, ...   136   4e-31
CP000830_2130(CP000830|pid:none) Dinoroseobacter shibae DFL 12, ...   136   4e-31
CP000360_4585(CP000360|pid:none) Acidobacteria bacterium Ellin34...   135   7e-31
AE008384_2897(AE008384|pid:none) Methanosarcina mazei strain Goe...   135   9e-31
CP001099_1649(CP001099|pid:none) Chlorobaculum parvum NCIB 8327,...   135   9e-31
CP001338_619(CP001338|pid:none) Candidatus Methanosphaerula palu...   134   1e-30
CP000109_2000(CP000109|pid:none) Thiomicrospira crunogena XCL-2,...   134   1e-30
CP001614_144(CP001614|pid:none) Teredinibacter turnerae T7901, c...   134   2e-30
CP000058_1551(CP000058|pid:none) Pseudomonas syringae pv. phaseo...   133   3e-30
AE008384_2907(AE008384|pid:none) Methanosarcina mazei strain Goe...   133   4e-30
CP000304_1410(CP000304|pid:none) Pseudomonas stutzeri A1501, com...   133   4e-30
(P58112) RecName: Full=Pirin-like protein CC_0481;  &AE005673_48...   132   7e-30
CP000471_767(CP000471|pid:none) Magnetococcus sp. MC-1, complete...   132   7e-30
CP000252_1766(CP000252|pid:none) Syntrophus aciditrophicus SB, c...   132   9e-30
CP001097_539(CP001097|pid:none) Chlorobium limicola DSM 245, com...   131   1e-29
CP001055_330(CP001055|pid:none) Elusimicrobium minutum Pei191, c...   131   1e-29
AE017354_13(AE017354|pid:none) Legionella pneumophila subsp. pne...   130   2e-29
AE009441_1853(AE009441|pid:none) Pyrobaculum aerophilum str. IM2...   130   2e-29
AY658741_1(AY658741|pid:none) Synthetic construct Peudomonas aer...   130   3e-29
AM286690_25(AM286690|pid:none) Alcanivorax borkumensis SK2, comp...   130   3e-29
CP000675_14(CP000675|pid:none) Legionella pneumophila str. Corby...   129   5e-29
CP000113_4715(CP000113|pid:none) Myxococcus xanthus DK 1622, com...   129   5e-29
CP001108_1628(CP001108|pid:none) Prosthecochloris aestuarii DSM ...   128   1e-28
CP000633_288(CP000633|pid:none) Agrobacterium vitis S4 chromosom...   126   4e-28
AM180252_289(AM180252|pid:none) Lawsonia intracellularis PHE/MN1...   125   7e-28
AP009153_3608(AP009153|pid:none) Gemmatimonas aurantiaca T-27 DN...   124   2e-27
BT041591_1(BT041591|pid:none) Zea mays full-length cDNA clone ZM...   124   2e-27
CP000377_2159(CP000377|pid:none) Silicibacter sp. TM1040, comple...   124   2e-27
BT035232_1(BT035232|pid:none) Zea mays full-length cDNA clone ZM...   124   2e-27
AE010300_3852(AE010300|pid:none) Leptospira interrogans serovar ...   124   2e-27
CP000282_3733(CP000282|pid:none) Saccharophagus degradans 2-40, ...   123   3e-27
CP000155_208(CP000155|pid:none) Hahella chejuensis KCTC 2396, co...   122   6e-27
BT052224_1(BT052224|pid:none) Medicago truncatula clone MTYF9_FA...   122   7e-27
EU970511_1(EU970511|pid:none) Zea mays clone 346788 pirin-like p...   122   1e-26
CP001358_994(CP001358|pid:none) Desulfovibrio desulfuricans subs...   122   1e-26
(Q9ZW82) RecName: Full=Pirin-like protein At2g43120;  &AK228809_...   121   1e-26
BT035101_1(BT035101|pid:none) Zea mays full-length cDNA clone ZM...   121   2e-26
CP000561_1448(CP000561|pid:none) Pyrobaculum calidifontis JCM 11...   121   2e-26
AC092852_26(AC092852|pid:none) Oryza sativa chromosome 3 BAC OSJ...   120   3e-26
CP001101_1727(CP001101|pid:none) Chlorobium phaeobacteroides BS1...   120   3e-26
CP000348_352(CP000348|pid:none) Leptospira borgpetersenii serova...   120   4e-26
AE017180_821(AE017180|pid:none) Geobacter sulfurreducens PCA, co...   119   5e-26
CP001052_1366(CP001052|pid:none) Burkholderia phytofirmans PsJN ...   119   5e-26
CP000769_3111(CP000769|pid:none) Anaeromyxobacter sp. Fw109-5, c...   119   5e-26
(Q9LX45) RecName: Full=Putative pirin-like protein At3g59260;  &...   119   5e-26
CP001131_1655(CP001131|pid:none) Anaeromyxobacter sp. K, complet...   119   6e-26
CP000251_2197(CP000251|pid:none) Anaeromyxobacter dehalogenans 2...   118   1e-25
AP009049_2163(AP009049|pid:none) Clostridium kluyveri NBRC 12016...   118   1e-25
CP001359_1723(CP001359|pid:none) Anaeromyxobacter dehalogenans 2...   118   1e-25
CP000626_271(CP000626|pid:none) Vibrio cholerae O395 chromosome ...   118   1e-25
EF087865_1(EF087865|pid:none) Picea sitchensis clone WS02914_E04...   117   2e-25
FM954973_1366(FM954973|pid:none) Vibrio splendidus LGP32 chromos...   117   2e-25
CP001234_901(CP001234|pid:none) Vibrio cholerae M66-2 chromosome...   117   2e-25
CP001197_2769(CP001197|pid:none) Desulfovibrio vulgaris str. 'Mi...   117   2e-25
AM270379_12(AM270379|pid:none) Aspergillus niger contig An16c027...   117   2e-25
BX284747_10(BX284747|pid:none) Neurospora crassa DNA linkage gro...   117   2e-25
CP000660_1143(CP000660|pid:none) Pyrobaculum arsenaticum DSM 135...   116   4e-25
FM992688_544(FM992688|pid:none) Candida dubliniensis CD36 chromo...   116   5e-25
CU638743_446(CU638743|pid:none) Podospora anserina genomic DNA c...   116   5e-25
BT062570_1(BT062570|pid:none) Zea mays full-length cDNA clone ZM...   115   1e-24
(Q9HLU2) Pirin-like protein Ta0133.  &AL445063_131(AL445063|pid:...   114   3e-24
AP009385_2138(AP009385|pid:none) Burkholderia multivorans ATCC 1...   113   5e-24
CP000270_1297(CP000270|pid:none) Burkholderia xenovorans LB400 c...   113   5e-24
CP000083_1720(CP000083|pid:none) Colwellia psychrerythraea 34H, ...   112   6e-24
CP000682_1079(CP000682|pid:none) Metallosphaera sedula DSM 5348,...   112   6e-24
AE017261_1149(AE017261|pid:none) Picrophilus torridus DSM 9790, ...   112   6e-24
EU967785_1(EU967785|pid:none) Zea mays clone 306052 pirin-like p...   112   1e-23
AM920435_919(AM920435|pid:none) Penicillium chrysogenum Wisconsi...   111   1e-23
CP000077_2153(CP000077|pid:none) Sulfolobus acidocaldarius DSM 6...   111   2e-23
CP000790_1677(CP000790|pid:none) Vibrio harveyi ATCC BAA-1116 ch...   110   3e-23
CR382124_47(CR382124|pid:none) Kluyveromyces lactis strain NRRL ...   110   3e-23
AE016796_1137(AE016796|pid:none) Vibrio vulnificus CMCP6 chromos...   110   3e-23
CP000958_2207(CP000958|pid:none) Burkholderia cenocepacia MC0-3 ...   110   4e-23
AM747720_2291(AM747720|pid:none) Burkholderia cenocepacia J2315 ...   110   4e-23
CP001348_2672(CP001348|pid:none) Clostridium cellulolyticum H10,...   110   4e-23
CP000380_387(CP000380|pid:none) Burkholderia cenocepacia AU 1054...   109   5e-23
AP008230_2869(AP008230|pid:none) Desulfitobacterium hafniense Y5...   108   1e-22
CP000151_2342(CP000151|pid:none) Burkholderia sp. 383 chromosome...   108   1e-22
BC045224_1(BC045224|pid:none) Xenopus laevis hypothetical protei...   108   1e-22
CP000614_2259(CP000614|pid:none) Burkholderia vietnamiensis G4 c...   108   1e-22
CP001503_2412(CP001503|pid:none) Burkholderia glumae BGR1 chromo...   108   1e-22
CP001025_2096(CP001025|pid:none) Burkholderia ambifaria MC40-6 c...   107   2e-22
CR382137_810(CR382137|pid:none) Debaryomyces hansenii strain CBS...   107   2e-22
CP001399_404(CP001399|pid:none) Sulfolobus islandicus L.S.2.15, ...   107   2e-22
CR541822_1(CR541822|pid:none) Homo sapiens full open reading fra...   107   2e-22
DQ000498_1(DQ000498|pid:none) Synthetic construct clone PSF:2029...   107   2e-22
CP001160_277(CP001160|pid:none) Thalassiosira pseudonana CCMP133...   107   2e-22
(O00625) RecName: Full=Pirin;  &AX399859_1(AX399859|pid:none) &A...   107   2e-22
CP001403_386(CP001403|pid:none) Sulfolobus islandicus Y.G.57.14,...   107   2e-22
BA000023_2572(BA000023|pid:none) Sulfolobus tokodaii str. 7 DNA,...   107   2e-22
BC088499_1(BC088499|pid:none) Xenopus tropicalis pirin, mRNA (cD...   106   6e-22
BT035379_1(BT035379|pid:none) Zea mays full-length cDNA clone ZM...   105   9e-22
BT038637_1(BT038637|pid:none) Zea mays full-length cDNA clone ZM...   105   9e-22
CR380952_67(CR380952|pid:none) Candida glabrata strain CBS138 ch...   104   2e-21
AE017351_175(AE017351|pid:none) Cryptococcus neoformans var. neo...   103   3e-21
AL954747_2145(AL954747|pid:none) Nitrosomonas europaea ATCC 1971...   103   4e-21
CR380955_348(CR380955|pid:none) Candida glabrata strain CBS138 c...   103   4e-21
CP000724_1406(CP000724|pid:none) Alkaliphilus metalliredigens QY...   103   5e-21
BT038257_1(BT038257|pid:none) Zea mays full-length cDNA clone ZM...   103   5e-21
CU928167_463(CU928167|pid:none) Kluyveromyces thermotolerans str...   102   8e-21
BA000043_1651(BA000043|pid:none) Geobacillus kaustophilus HTA426...   102   1e-20
CP000472_3854(CP000472|pid:none) Shewanella piezotolerans WP3, c...   102   1e-20
CU468230_2465(CU468230|pid:none) Acinetobacter baumannii str. SD...   101   1e-20
AL671706_6(AL671706|pid:none) Mouse DNA sequence from clone RP23...   101   2e-20
CP000581_476(CP000581|pid:none) Ostreococcus lucimarinus CCE9901...   100   2e-20
CP000026_1721(CP000026|pid:none) Salmonella enterica subsp. ente...   100   4e-20
CR543861_3095(CR543861|pid:none) Acinetobacter sp. ADP1 complete...   100   4e-20
AK082922_1(AK082922|pid:none) Mus musculus 7 days embryo whole b...   100   4e-20
CP000521_892(CP000521|pid:none) Acinetobacter baumannii ATCC 179...   100   5e-20
CP000853_831(CP000853|pid:none) Alkaliphilus oremlandii OhILAs, ...   100   5e-20
CP001127_995(CP001127|pid:none) Salmonella enterica subsp. enter...   100   5e-20
CP000302_2931(CP000302|pid:none) Shewanella denitrificans OS217,...    99   7e-20
CR954209_258(CR954209|pid:none) Ostreococcus tauri strain OTTH05...    99   7e-20
CP000753_848(CP000753|pid:none) Shewanella baltica OS185, comple...    99   7e-20
CP000503_830(CP000503|pid:none) Shewanella sp. W3-18-1, complete...    99   9e-20
CP000589_241(CP000589|pid:none) Ostreococcus lucimarinus CCE9901...    99   9e-20
CR382128_185(CR382128|pid:none) Yarrowia lipolytica strain CLIB1...    99   9e-20
CP000557_1480(CP000557|pid:none) Geobacillus thermodenitrificans...    99   9e-20
CP000481_1944(CP000481|pid:none) Acidothermus cellulolyticus 11B...    99   1e-19
CP001120_976(CP001120|pid:none) Salmonella enterica subsp. enter...    99   1e-19
AE006468_922(AE006468|pid:none) Salmonella enterica subsp. enter...    99   1e-19
CP000606_699(CP000606|pid:none) Shewanella loihica PV-4, complet...    98   2e-19
CP000880_1938(CP000880|pid:none) Salmonella enterica subsp. ariz...    98   2e-19
BX294149_202(BX294149|pid:none) Rhodopirellula baltica SH 1 comp...    97   3e-19
CP000563_3409(CP000563|pid:none) Shewanella baltica OS155, compl...    97   3e-19
CP000555_2637(CP000555|pid:none) Methylibium petroleiphilum PM1,...    97   3e-19
CP001321_1262(CP001321|pid:none) Haemophilus parasuis SH0165, co...    96   7e-19
CP000446_742(CP000446|pid:none) Shewanella sp. MR-4, complete ge...    96   1e-18
CP000822_2138(CP000822|pid:none) Citrobacter koseri ATCC BAA-895...    95   1e-18
CP001022_2613(CP001022|pid:none) Exiguobacterium sibiricum 255-1...    95   1e-18
CP000509_1305(CP000509|pid:none) Nocardioides sp. JS614, complet...    95   1e-18
BA000016_790(BA000016|pid:none) Clostridium perfringens str. 13 ...    95   2e-18
AM942759_3428(AM942759|pid:none) Proteus mirabilis strain HI4320...    95   2e-18
AE009952_2138(AE009952|pid:none) Yersinia pestis KIM, complete g...    95   2e-18
AB0262(AB0262) conserved hypothetical protein YPO2149 [imported]...    95   2e-18
AP008957_4955(AP008957|pid:none) Rhodococcus erythropolis PR4 DN...    94   2e-18
AE014299_883(AE014299|pid:none) Shewanella oneidensis MR-1, comp...    94   3e-18
AL939117_255(AL939117|pid:none) Streptomyces coelicolor A3(2) co...    94   4e-18
CP000891_897(CP000891|pid:none) Shewanella baltica OS195, comple...    94   4e-18
CP000749_2629(CP000749|pid:none) Marinomonas sp. MWYL1, complete...    94   4e-18
CP000656_736(CP000656|pid:none) Mycobacterium gilvum PYR-GCK, co...    93   5e-18
BX842646_282(BX842646|pid:none) Bdellovibrio bacteriovorus compl...    93   5e-18
CP000758_545(CP000758|pid:none) Ochrobactrum anthropi ATCC 49188...    93   5e-18
CP000284_2568(CP000284|pid:none) Methylobacillus flagellatus KT,...    93   6e-18
CU458896_2424(CU458896|pid:none) Mycobacterium abscessus chromos...    93   6e-18
CP000821_3762(CP000821|pid:none) Shewanella sediminis HAW-EB3, c...    93   6e-18
CP000820_5393(CP000820|pid:none) Frankia sp. EAN1pec, complete g...    92   8e-18
AP011115_4153(AP011115|pid:none) Rhodococcus opacus B4 DNA, comp...    92   8e-18
CP000911_438(CP000911|pid:none) Brucella suis ATCC 23445 chromos...    92   8e-18
CP000447_3191(CP000447|pid:none) Shewanella frigidimarina NCIMB ...    92   1e-17
CP000269_3306(CP000269|pid:none) Janthinobacterium sp. Marseille...    92   1e-17
CP000316_4687(CP000316|pid:none) Polaromonas sp. JS666, complete...    92   1e-17
CP000383_2959(CP000383|pid:none) Cytophaga hutchinsonii ATCC 334...    92   1e-17
AE017223_429(AE017223|pid:none) Brucella abortus biovar 1 str. 9...    91   2e-17
CP000384_84(CP000384|pid:none) Mycobacterium sp. MCS, complete g...    91   2e-17
CU633749_1180(CU633749|pid:none) Cupriavidus taiwanensis str. LM...    91   3e-17
CP000155_5252(CP000155|pid:none) Hahella chejuensis KCTC 2396, c...    90   5e-17
CP000559_439(CP000559|pid:none) Methanocorpusculum labreanum Z, ...    89   7e-17
AM286415_2162(AM286415|pid:none) Yersinia enterocolitica subsp. ...    89   7e-17
AB481387_1(AB481387|pid:none) Micromonospora rosaria gene for pi...    89   7e-17
CP001280_2501(CP001280|pid:none) Methylocella silvestris BL2, co...    89   7e-17
CP000091_1214(CP000091|pid:none) Ralstonia eutropha JMP134 chrom...    89   7e-17
CP000285_1767(CP000285|pid:none) Chromohalobacter salexigens DSM...    89   9e-17
CP000507_2984(CP000507|pid:none) Shewanella amazonensis SB2B, co...    89   9e-17
BA000030_4399(BA000030|pid:none) Streptomyces avermitilis MA-468...    89   1e-16
CP000628_901(CP000628|pid:none) Agrobacterium radiobacter K84 ch...    89   1e-16
CP000438_1760(CP000438|pid:none) Pseudomonas aeruginosa UCBPP-PA...    89   1e-16
CP000647_1024(CP000647|pid:none) Klebsiella pneumoniae subsp. pn...    89   1e-16
CU207366_1734(CU207366|pid:none) Gramella forsetii KT0803 comple...    88   2e-16
CP000510_2481(CP000510|pid:none) Psychromonas ingrahamii 37, com...    88   2e-16
CP000076_4019(CP000076|pid:none) Pseudomonas fluorescens Pf-5, c...    87   3e-16
CP000926_2527(CP000926|pid:none) Pseudomonas putida GB-1, comple...    87   3e-16
CP000759_1226(CP000759|pid:none) Ochrobactrum anthropi ATCC 4918...    86   6e-16
CP000133_898(CP000133|pid:none) Rhizobium etli CFN 42, complete ...    86   6e-16
CP000127_1399(CP000127|pid:none) Nitrosococcus oceani ATCC 19707...    86   1e-15
CP000884_3930(CP000884|pid:none) Delftia acidovorans SPH-1, comp...    85   1e-15
CP000325_3906(CP000325|pid:none) Mycobacterium ulcerans Agy99, c...    85   1e-15
CU207366_1122(CU207366|pid:none) Gramella forsetii KT0803 comple...    85   1e-15
(Q9I163) RecName: Full=Pirin-like protein PA2418;  &AE004091_241...    85   1e-15
CP000113_2167(CP000113|pid:none) Myxococcus xanthus DK 1622, com...    85   2e-15
AM181176_3560(AM181176|pid:none) Pseudomonas fluorescens SBW25 c...    85   2e-15
CP000884_907(CP000884|pid:none) Delftia acidovorans SPH-1, compl...    84   2e-15
CP000283_149(CP000283|pid:none) Rhodopseudomonas palustris BisB5...    84   3e-15
CP000438_2670(CP000438|pid:none) Pseudomonas aeruginosa UCBPP-PA...    84   4e-15
AY596297_1308(AY596297|pid:none) Haloarcula marismortui ATCC 430...    84   4e-15
CP001111_2189(CP001111|pid:none) Stenotrophomonas maltophilia R5...    83   5e-15
CP000494_19(CP000494|pid:none) Bradyrhizobium sp. BTAi1, complet...    83   5e-15
CP001392_3255(CP001392|pid:none) Diaphorobacter sp. TPSY, comple...    83   7e-15
CP000572_2787(CP000572|pid:none) Burkholderia pseudomallei 1106a...    83   7e-15
AM743169_2572(AM743169|pid:none) Stenotrophomonas maltophilia K2...    83   7e-15
CP001349_2025(CP001349|pid:none) Methylobacterium nodulans ORS 2...    83   7e-15
BX572594_239(BX572594|pid:none) Rhodopseudomonas palustris CGA00...    82   1e-14
CP000539_3815(CP000539|pid:none) Acidovorax sp. JS42, complete g...    82   1e-14
AM236080_984(AM236080|pid:none) Rhizobium leguminosarum bv. vici...    82   1e-14
CP000614_1053(CP000614|pid:none) Burkholderia vietnamiensis G4 c...    82   1e-14
BX640419_308(BX640419|pid:none) Bordetella pertussis strain Toha...    82   1e-14
CP000383_670(CP000383|pid:none) Cytophaga hutchinsonii ATCC 3340...    81   2e-14
AM942759_2181(AM942759|pid:none) Proteus mirabilis strain HI4320...    81   2e-14
BA000040_813(BA000040|pid:none) Bradyrhizobium japonicum USDA 11...    81   2e-14
CP001029_4823(CP001029|pid:none) Methylobacterium populi BJ001, ...    81   2e-14
CP000086_1719(CP000086|pid:none) Burkholderia thailandensis E264...    80   3e-14
CP000282_638(CP000282|pid:none) Saccharophagus degradans 2-40, c...    80   3e-14
CP001025_1022(CP001025|pid:none) Burkholderia ambifaria MC40-6 c...    80   3e-14
CP000440_1026(CP000440|pid:none) Burkholderia ambifaria AMMD chr...    80   3e-14
CP000629_2217(CP000629|pid:none) Agrobacterium radiobacter K84 c...    80   3e-14
AP009385_1069(AP009385|pid:none) Burkholderia multivorans ATCC 1...    80   3e-14
AM902716_7(AM902716|pid:none) Bordetella petrii strain DSM 12804...    80   4e-14
AE015451_3372(AE015451|pid:none) Pseudomonas putida KT2440 compl...    80   4e-14
AF416331_43(AF416331|pid:none) Ruegeria sp. PR1b plasmid pSD25, ...    80   4e-14
AM746676_3386(AM746676|pid:none) Sorangium cellulosum 'So ce 56'...    80   6e-14
CP000301_342(CP000301|pid:none) Rhodopseudomonas palustris BisB1...    80   6e-14
AE017340_2319(AE017340|pid:none) Idiomarina loihiensis L2TR, com...    80   6e-14
CP000250_702(CP000250|pid:none) Rhodopseudomonas palustris HaA2,...    79   7e-14
CP000738_490(CP000738|pid:none) Sinorhizobium medicae WSM419, co...    79   7e-14
CP001196_1780(CP001196|pid:none) Oligotropha carboxidovorans OM5...    79   9e-14
CP000319_9(CP000319|pid:none) Nitrobacter hamburgensis X14, comp...    79   1e-13
AM747720_1028(AM747720|pid:none) Burkholderia cenocepacia J2315 ...    79   1e-13
CP001503_948(CP001503|pid:none) Burkholderia glumae BGR1 chromos...    78   2e-13
CP000463_545(CP000463|pid:none) Rhodopseudomonas palustris BisA5...    78   2e-13
CP001074_1808(CP001074|pid:none) Rhizobium etli CIAT 652, comple...    78   2e-13
CP001389_488(CP001389|pid:none) Rhizobium sp. NGR234, complete g...    77   5e-13
CP000937_101(CP000937|pid:none) Francisella philomiragia subsp. ...    76   6e-13
BA000012_5888(BA000012|pid:none) Mesorhizobium loti MAFF303099 D...    76   6e-13
CP001172_3315(CP001172|pid:none) Acinetobacter baumannii AB307-0...    76   8e-13
CP000378_667(CP000378|pid:none) Burkholderia cenocepacia AU 1054...    75   1e-12
CP000863_159(CP000863|pid:none) Acinetobacter baumannii ACICU, c...    75   1e-12
CP001339_280(CP001339|pid:none) Thioalkalivibrio sp. HL-EbGR7, c...    75   1e-12
BX842649_107(BX842649|pid:none) Bdellovibrio bacteriovorus compl...    75   2e-12
CP000269_3501(CP000269|pid:none) Janthinobacterium sp. Marseille...    75   2e-12
CP001196_524(CP001196|pid:none) Oligotropha carboxidovorans OM5 ...    74   2e-12
CP000521_132(CP000521|pid:none) Acinetobacter baumannii ATCC 179...    74   2e-12
CU468230_134(CU468230|pid:none) Acinetobacter baumannii str. SDF...    74   2e-12
CP000943_1842(CP000943|pid:none) Methylobacterium sp. 4-46, comp...    74   2e-12
CP000031_2539(CP000031|pid:none) Ruegeria pomeroyi DSS-3, comple...    74   2e-12
CR555306_1273(CR555306|pid:none) Azoarcus sp. EbN1 complete geno...    74   2e-12
CP000685_3466(CP000685|pid:none) Flavobacterium johnsoniae UW101...    74   3e-12
CU207366_1125(CU207366|pid:none) Gramella forsetii KT0803 comple...    74   3e-12
EU416202_1(EU416202|pid:none) Uncultured bacterium clone fsx11 p...    74   4e-12
CP000058_2093(CP000058|pid:none) Pseudomonas syringae pv. phaseo...    73   5e-12
CP000115_219(CP000115|pid:none) Nitrobacter winogradskyi Nb-255,...    73   5e-12
CP000316_2844(CP000316|pid:none) Polaromonas sp. JS666, complete...    73   5e-12
CP000431_1921(CP000431|pid:none) Rhodococcus jostii RHA1, comple...    73   7e-12
CP001037_1777(CP001037|pid:none) Nostoc punctiforme PCC 73102, c...    73   7e-12
AM746676_6625(AM746676|pid:none) Sorangium cellulosum 'So ce 56'...    73   7e-12
EU970021_1(EU970021|pid:none) Zea mays clone 338638 unknown mRNA.      72   9e-12
CP001025_2459(CP001025|pid:none) Burkholderia ambifaria MC40-6 c...    72   9e-12
CP001124_3064(CP001124|pid:none) Geobacter bemidjiensis Bem, com...    72   9e-12
C84862(C84862)probable probable pirin protein [imported] - Arabi...    72   9e-12
CP000885_1823(CP000885|pid:none) Clostridium phytofermentans ISD...    72   1e-11
CP000158_1471(CP000158|pid:none) Hyphomonas neptunium ATCC 15444...    72   1e-11
CP001298_106(CP001298|pid:none) Methylobacterium chloromethanicu...    72   2e-11
AM902716_2291(AM902716|pid:none) Bordetella petrii strain DSM 12...    72   2e-11
CP000113_4244(CP000113|pid:none) Myxococcus xanthus DK 1622, com...    71   2e-11
BX640432_64(BX640432|pid:none) Bordetella parapertussis strain 1...    71   2e-11
CP000284_1829(CP000284|pid:none) Methylobacillus flagellatus KT,...    71   2e-11
CP000270_3652(CP000270|pid:none) Burkholderia xenovorans LB400 c...    71   2e-11
AD1939(AD1939) hypothetical protein alr1063 [imported] - Nostoc ...    71   3e-11
CP001291_914(CP001291|pid:none) Cyanothece sp. PCC 7424, complet...    71   3e-11
AE016958_3617(AE016958|pid:none) Mycobacterium avium subsp. para...    71   3e-11
CP000479_4819(CP000479|pid:none) Mycobacterium avium 104, comple...    71   3e-11
CP000680_1550(CP000680|pid:none) Pseudomonas mendocina ymp, comp...    71   3e-11
AE017282_2146(AE017282|pid:none) Methylococcus capsulatus str. B...    70   3e-11
CP000348_784(CP000348|pid:none) Leptospira borgpetersenii serova...    70   3e-11
AM889285_848(AM889285|pid:none) Gluconacetobacter diazotrophicus...    70   3e-11
BX640415_275(BX640415|pid:none) Bordetella pertussis strain Toha...    70   3e-11
CP001013_420(CP001013|pid:none) Leptothrix cholodnii SP-6, compl...    70   3e-11
CP000494_2502(CP000494|pid:none) Bradyrhizobium sp. BTAi1, compl...    70   3e-11
BA000012_764(BA000012|pid:none) Mesorhizobium loti MAFF303099 DN...    70   4e-11
CP000439_1251(CP000439|pid:none) Francisella tularensis subsp. n...    69   8e-11
AY967247_1(AY967247|pid:none) Synthetic construct isolate FTT126...    69   8e-11
CP000509_639(CP000509|pid:none) Nocardioides sp. JS614, complete...    69   8e-11
CP000854_420(CP000854|pid:none) Mycobacterium marinum M, complet...    69   8e-11
CP000285_50(CP000285|pid:none) Chromohalobacter salexigens DSM 3...    69   8e-11
AJ749949_1266(AJ749949|pid:none) Francisella tularensis subsp. t...    69   8e-11
CP000774_2359(CP000774|pid:none) Parvibaculum lavamentivorans DS...    69   1e-10
CP001150_1312(CP001150|pid:none) Rhodobacter sphaeroides KD131 c...    69   1e-10
CP000143_1581(CP000143|pid:none) Rhodobacter sphaeroides 2.4.1 c...    69   1e-10
CP000435_2733(CP000435|pid:none) Synechococcus sp. CC9311, compl...    69   1e-10
CP000577_1624(CP000577|pid:none) Rhodobacter sphaeroides ATCC 17...    69   1e-10
CP000884_918(CP000884|pid:none) Delftia acidovorans SPH-1, compl...    69   1e-10
CP000949_2956(CP000949|pid:none) Pseudomonas putida W619, comple...    69   1e-10
CP000926_3280(CP000926|pid:none) Pseudomonas putida GB-1, comple...    69   1e-10
CP000248_1629(CP000248|pid:none) Novosphingobium aromaticivorans...    69   1e-10
CP000083_1256(CP000083|pid:none) Colwellia psychrerythraea 34H, ...    68   2e-10
CP000361_139(CP000361|pid:none) Arcobacter butzleri RM4018, comp...    68   2e-10
CP000441_1500(CP000441|pid:none) Burkholderia ambifaria AMMD chr...    68   2e-10
AE015451_2539(AE015451|pid:none) Pseudomonas putida KT2440 compl...    68   2e-10
CR543861_2473(CR543861|pid:none) Acinetobacter sp. ADP1 complete...    68   2e-10
CP000157_1678(CP000157|pid:none) Erythrobacter litoralis HTCC259...    68   2e-10
CP000712_3102(CP000712|pid:none) Pseudomonas putida F1, complete...    68   2e-10
CP000362_2626(CP000362|pid:none) Roseobacter denitrificans OCh 1...    68   2e-10
CU633749_2149(CU633749|pid:none) Cupriavidus taiwanensis str. LM...    67   3e-10
(Q9I4C8) RecName: Full=Pirin-like protein PA1210;  &AE004091_121...    67   3e-10
CP000094_2669(CP000094|pid:none) Pseudomonas fluorescens Pf0-1, ...    67   3e-10
AM920689_1472(AM920689|pid:none) Xanthomonas campestris pv. camp...    67   3e-10
CP000680_2466(CP000680|pid:none) Pseudomonas mendocina ymp, comp...    67   3e-10
CP000438_3885(CP000438|pid:none) Pseudomonas aeruginosa UCBPP-PA...    67   3e-10
AE008922_2667(AE008922|pid:none) Xanthomonas campestris pv. camp...    67   3e-10
AY658127_1(AY658127|pid:none) Synthetic construct Peudomonas aer...    67   3e-10
CP000151_2708(CP000151|pid:none) Burkholderia sp. 383 chromosome...    67   4e-10
CP000826_2826(CP000826|pid:none) Serratia proteamaculans 568, co...    67   4e-10
BX569695_181(BX569695|pid:none) Synechococcus sp. WH8102 complet...    67   4e-10
CP000539_2185(CP000539|pid:none) Acidovorax sp. JS42, complete g...    67   4e-10
CU695239_161(CU695239|pid:none) Ralstonia solanacearum strain Mo...    67   4e-10
CP000383_1642(CP000383|pid:none) Cytophaga hutchinsonii ATCC 334...    67   4e-10
GN124330_1(GN124330|pid:none) Sequence 7226 from Patent WO200903...    67   5e-10
CP001614_296(CP001614|pid:none) Teredinibacter turnerae T7901, c...    67   5e-10
AJ313328_3(AJ313328|pid:none) Ralstonia metallidurans rpoH gene,...    67   5e-10
CP001281_2977(CP001281|pid:none) Thauera sp. MZ1T, complete geno...    67   5e-10
CP000555_588(CP000555|pid:none) Methylibium petroleiphilum PM1, ...    67   5e-10
CR543861_145(CR543861|pid:none) Acinetobacter sp. ADP1 complete ...    67   5e-10
CP000951_2674(CP000951|pid:none) Synechococcus sp. PCC 7002, com...    66   6e-10
AM920689_42(AM920689|pid:none) Xanthomonas campestris pv. campes...    66   6e-10
AJ564722_1(AJ564722|pid:none) Nonomuraea sp. ATCC 39727 partial ...    66   6e-10
CP000158_959(CP000158|pid:none) Hyphomonas neptunium ATCC 15444,...    66   6e-10
CP001016_2077(CP001016|pid:none) Beijerinckia indica subsp. indi...    66   6e-10
AE008922_37(AE008922|pid:none) Xanthomonas campestris pv. campes...    66   6e-10
GN124352_1(GN124352|pid:none) Sequence 7248 from Patent WO200903...    66   6e-10
CP000480_44(CP000480|pid:none) Mycobacterium smegmatis str. MC2 ...    66   6e-10
AE016823_2292(AE016823|pid:none) Leptospira interrogans serovar ...    66   6e-10
CP000697_1298(CP000697|pid:none) Acidiphilium cryptum JF-5, comp...    66   6e-10
CP000962_891(CP000962|pid:none) Clostridium botulinum A3 str. Lo...    66   8e-10
AP007255_3997(AP007255|pid:none) Magnetospirillum magneticum AMB...    66   8e-10
CP000469_61(CP000469|pid:none) Shewanella sp. ANA-3, complete ge...    65   1e-09
CP000563_4229(CP000563|pid:none) Shewanella baltica OS155, compl...    65   1e-09
CP000557_2999(CP000557|pid:none) Geobacillus thermodenitrificans...    65   1e-09
CP001083_824(CP001083|pid:none) Clostridium botulinum Ba4 str. 6...    65   1e-09
AP009385_2475(AP009385|pid:none) Burkholderia multivorans ATCC 1...    65   1e-09
AM167904_1922(AM167904|pid:none) Bordetella avium 197N complete ...    65   1e-09
CP000958_1361(CP000958|pid:none) Burkholderia cenocepacia MC0-3 ...    65   1e-09
AP009493_657(AP009493|pid:none) Streptomyces griseus subsp. gris...    65   1e-09
CP000356_556(CP000356|pid:none) Sphingopyxis alaskensis RB2256, ...    65   1e-09
CP000521_1186(CP000521|pid:none) Acinetobacter baumannii ATCC 17...    65   1e-09
CP000086_716(CP000086|pid:none) Burkholderia thailandensis E264 ...    65   1e-09
CP000740_174(CP000740|pid:none) Sinorhizobium medicae WSM419 pla...    65   1e-09
CP000753_53(CP000753|pid:none) Shewanella baltica OS185, complet...    65   1e-09
AL646053_444(AL646053|pid:none) Ralstonia solanacearum GMI1000 m...    65   1e-09
CP000446_54(CP000446|pid:none) Shewanella sp. MR-4, complete gen...    65   1e-09
CP000009_1576(CP000009|pid:none) Gluconobacter oxydans 621H, com...    65   1e-09
CP001172_2372(CP001172|pid:none) Acinetobacter baumannii AB307-0...    65   1e-09
CP000378_1941(CP000378|pid:none) Burkholderia cenocepacia AU 105...    65   2e-09
CP000958_2569(CP000958|pid:none) Burkholderia cenocepacia MC0-3 ...    65   2e-09
CP000507_1385(CP000507|pid:none) Shewanella amazonensis SB2B, co...    65   2e-09
CP000076_3183(CP000076|pid:none) Pseudomonas fluorescens Pf-5, c...    65   2e-09
AM747720_2774(AM747720|pid:none) Burkholderia cenocepacia J2315 ...    65   2e-09
CP000529_2900(CP000529|pid:none) Polaromonas naphthalenivorans C...    65   2e-09
CP000699_2791(CP000699|pid:none) Sphingomonas wittichii RW1, com...    65   2e-09
CP000150_849(CP000150|pid:none) Burkholderia sp. 383 chromosome ...    65   2e-09
CT971583_2408(CT971583|pid:none) Synechococcus WH7803 complete g...    65   2e-09
AM286415_3860(AM286415|pid:none) Yersinia enterocolitica subsp. ...    64   2e-09
CR543861_2259(CR543861|pid:none) Acinetobacter sp. ADP1 complete...    64   2e-09
AP008231_2394(AP008231|pid:none) Synechococcus elongatus PCC 630...    64   2e-09
CP000010_318(CP000010|pid:none) Burkholderia mallei ATCC 23344 c...    64   3e-09
AM039952_3032(AM039952|pid:none) Xanthomonas campestris pv. vesi...    64   3e-09
CP000511_147(CP000511|pid:none) Mycobacterium vanbaalenii PYR-1,...    64   3e-09
GN124344_1(GN124344|pid:none) Sequence 7240 from Patent WO200903...    64   3e-09
(Q9I4D3) RecName: Full=Pirin-like protein PA1205;  &A83496(A8349...    64   3e-09
AE008923_2830(AE008923|pid:none) Xanthomonas axonopodis pv. citr...    64   3e-09
BA000043_3094(BA000043|pid:none) Geobacillus kaustophilus HTA426...    64   3e-09
BX571965_866(BX571965|pid:none) Burkholderia pseudomallei strain...    64   3e-09
CP000947_470(CP000947|pid:none) Haemophilus somnus 2336, complet...    64   3e-09
CP000685_1729(CP000685|pid:none) Flavobacterium johnsoniae UW101...    64   4e-09
(Q9XBR7) RecName: Full=Pirin-like protein ZMO1337;  &AE008692_13...    64   4e-09
CU914168_409(CU914168|pid:none) Ralstonia solanacearum strain IP...    64   4e-09
CP000494_1556(CP000494|pid:none) Bradyrhizobium sp. BTAi1, compl...    64   4e-09
CU861906_368(CU861906|pid:none) Ralstonia solanacearum strain Mo...    64   4e-09
AM238664_922(AM238664|pid:none) Streptomyces ambofaciens ATCC 23...    63   5e-09
CP000903_4747(CP000903|pid:none) Bacillus weihenstephanensis KBA...    63   5e-09
CP000151_1345(CP000151|pid:none) Burkholderia sp. 383 chromosome...    63   5e-09
CP000490_664(CP000490|pid:none) Paracoccus denitrificans PD1222 ...    63   5e-09
AM747720_1390(AM747720|pid:none) Burkholderia cenocepacia J2315 ...    63   5e-09
GN124340_1(GN124340|pid:none) Sequence 7236 from Patent WO200903...    63   5e-09
CP001635_5176(CP001635|pid:none) Variovorax paradoxus S110 chrom...    63   5e-09
CP001096_974(CP001096|pid:none) Rhodopseudomonas palustris TIE-1...    63   7e-09
AE016877_4798(AE016877|pid:none) Bacillus cereus ATCC 14579, com...    63   7e-09
CP000283_4328(CP000283|pid:none) Rhodopseudomonas palustris BisB...    63   7e-09
AB101202_2(AB101202|pid:none) Acinetobacter baumannii genes invo...    63   7e-09
BA000030_7362(BA000030|pid:none) Streptomyces avermitilis MA-468...    63   7e-09
CT573213_1654(CT573213|pid:none) Frankia alni str. ACN14A chromo...    63   7e-09
AL939105_163(AL939105|pid:none) Streptomyces coelicolor A3(2) co...    63   7e-09
BX572595_279(BX572595|pid:none) Rhodopseudomonas palustris CGA00...    63   7e-09
AP009152_80(AP009152|pid:none) Kocuria rhizophila DC2201 DNA, co...    63   7e-09
CP000863_2594(CP000863|pid:none) Acinetobacter baumannii ACICU, ...    63   7e-09
AE016825_1283(AE016825|pid:none) Chromobacterium violaceum ATCC ...    63   7e-09
CP000250_4476(CP000250|pid:none) Rhodopseudomonas palustris HaA2...    63   7e-09
CP000304_2664(CP000304|pid:none) Pseudomonas stutzeri A1501, com...    63   7e-09
CP000384_5281(CP000384|pid:none) Mycobacterium sp. MCS, complete...    63   7e-09
AE013598_1436(AE013598|pid:none) Xanthomonas oryzae pv. oryzae K...    62   9e-09
CP000269_531(CP000269|pid:none) Janthinobacterium sp. Marseille,...    62   9e-09
CP001616_557(CP001616|pid:none) Tolumonas auensis DSM 9187, comp...    62   9e-09
CP000656_685(CP000656|pid:none) Mycobacterium gilvum PYR-GCK, co...    62   9e-09
CP000394_1966(CP000394|pid:none) Granulibacter bethesdensis CGDN...    62   9e-09
CP001287_3420(CP001287|pid:none) Cyanothece sp. PCC 8801, comple...    62   9e-09
CP000853_2021(CP000853|pid:none) Alkaliphilus oremlandii OhILAs,...    62   1e-08
CP000511_62(CP000511|pid:none) Mycobacterium vanbaalenii PYR-1, ...    62   1e-08
CP000512_738(CP000512|pid:none) Acidovorax citrulli AAC00-1, com...    62   1e-08
CP000158_532(CP000158|pid:none) Hyphomonas neptunium ATCC 15444,...    62   1e-08
CP000699_4535(CP000699|pid:none) Sphingomonas wittichii RW1, com...    62   2e-08
CP001504_1587(CP001504|pid:none) Burkholderia glumae BGR1 chromo...    62   2e-08
CP000681_2647(CP000681|pid:none) Shewanella putrefaciens CN-32, ...    62   2e-08
CP000806_2765(CP000806|pid:none) Cyanothece sp. ATCC 51142 circu...    62   2e-08
AP009385_1298(AP009385|pid:none) Burkholderia multivorans ATCC 1...    62   2e-08
CP001111_1502(CP001111|pid:none) Stenotrophomonas maltophilia R5...    62   2e-08
CP001341_2520(CP001341|pid:none) Arthrobacter chlorophenolicus A...    62   2e-08
CP000480_207(CP000480|pid:none) Mycobacterium smegmatis str. MC2...    62   2e-08
CP000713_2283(CP000713|pid:none) Psychrobacter sp. PRwf-1, compl...    62   2e-08
CP000778_252(CP000778|pid:none) Leptospira biflexa serovar Patoc...    61   2e-08
CT030148_103(CT030148|pid:none) Kuenenia stuttgartiensis genome ...    61   2e-08
CP000440_1261(CP000440|pid:none) Burkholderia ambifaria AMMD chr...    61   2e-08
AE017355_4702(AE017355|pid:none) Bacillus thuringiensis serovar ...    61   2e-08
CP000563_2943(CP000563|pid:none) Shewanella baltica OS155, compl...    61   2e-08
CP000227_4734(CP000227|pid:none) Bacillus cereus Q1, complete ge...    61   2e-08
AL939107_25(AL939107|pid:none) Streptomyces coelicolor A3(2) com...    61   2e-08
AD3184(AD3184) pirin-like protein [imported] - Agrobacterium tum...    61   2e-08
AM942759_2989(AM942759|pid:none) Proteus mirabilis strain HI4320...    61   2e-08
CP001359_427(CP001359|pid:none) Anaeromyxobacter dehalogenans 2C...    61   2e-08
CP000393_74(CP000393|pid:none) Trichodesmium erythraeum IMS101, ...    61   2e-08
CP000884_1556(CP000884|pid:none) Delftia acidovorans SPH-1, comp...    61   2e-08
CP000117_4394(CP000117|pid:none) Anabaena variabilis ATCC 29413,...    61   3e-08
AE017194_5149(AE017194|pid:none) Bacillus cereus ATCC 10987, com...    61   3e-08
CP001407_4970(CP001407|pid:none) Bacillus cereus 03BB102, comple...    61   3e-08
BX571966_445(BX571966|pid:none) Burkholderia pseudomallei strain...    61   3e-08
GN124336_1(GN124336|pid:none) Sequence 7232 from Patent WO200903...    61   3e-08
CP000570_1087(CP000570|pid:none) Burkholderia pseudomallei 668 c...    61   3e-08
CP000764_3446(CP000764|pid:none) Bacillus cereus subsp. cytotoxi...    61   3e-08
CP000485_4350(CP000485|pid:none) Bacillus thuringiensis str. Al ...    61   3e-08
CP001037_5198(CP001037|pid:none) Nostoc punctiforme PCC 73102, c...    61   3e-08
AP009552_1288(AP009552|pid:none) Microcystis aeruginosa NIES-843...    61   3e-08
CP000572_1091(CP000572|pid:none) Burkholderia pseudomallei 1106a...    61   3e-08
(P58113) RecName: Full=Pirin-like protein CC_1473;  &A87432(A874...    60   3e-08
CR626927_1318(CR626927|pid:none) Bacteroides fragilis NCTC 9343,...    60   3e-08
CP000086_887(CP000086|pid:none) Burkholderia thailandensis E264 ...    60   3e-08
CP000380_280(CP000380|pid:none) Burkholderia cenocepacia AU 1054...    60   3e-08
CP000569_1469(CP000569|pid:none) Actinobacillus pleuropneumoniae...    60   3e-08
CP001635_3079(CP001635|pid:none) Variovorax paradoxus S110 chrom...    60   3e-08
AP006841_1456(AP006841|pid:none) Bacteroides fragilis YCH46 DNA,...    60   3e-08
AE016825_3253(AE016825|pid:none) Chromobacterium violaceum ATCC ...    60   3e-08
CP001052_1086(CP001052|pid:none) Burkholderia phytofirmans PsJN ...    60   5e-08
CP000552_1530(CP000552|pid:none) Prochlorococcus marinus str. MI...    60   5e-08
CP001154_3229(CP001154|pid:none) Laribacter hongkongensis HLHK9,...    60   5e-08
AM747722_92(AM747722|pid:none) Burkholderia cenocepacia J2315 ch...    60   6e-08
CP000442_502(CP000442|pid:none) Burkholderia ambifaria AMMD chro...    60   6e-08
CT978603_1569(CT978603|pid:none) Synechococcus sp. RCC307 genomi...    60   6e-08
CU458896_3912(CU458896|pid:none) Mycobacterium abscessus chromos...    60   6e-08
CP000555_2880(CP000555|pid:none) Methylibium petroleiphilum PM1,...    60   6e-08
CT573213_893(CT573213|pid:none) Frankia alni str. ACN14A chromos...    60   6e-08
CP001344_4095(CP001344|pid:none) Cyanothece sp. PCC 7425, comple...    60   6e-08
AM420293_3856(AM420293|pid:none) Saccharopolyspora erythraea NRR...    59   8e-08
CP000124_1238(CP000124|pid:none) Burkholderia pseudomallei 1710b...    59   8e-08
CP000656_777(CP000656|pid:none) Mycobacterium gilvum PYR-GCK, co...    59   8e-08
AM920689_2562(AM920689|pid:none) Xanthomonas campestris pv. camp...    59   8e-08
AM778930_65(AM778930|pid:none) Microcystis aeruginosa PCC 7806 g...    59   8e-08
GN124348_1(GN124348|pid:none) Sequence 7244 from Patent WO200903...    59   1e-07
CP000576_1554(CP000576|pid:none) Prochlorococcus marinus str. MI...    59   1e-07
GN124326_1(GN124326|pid:none) Sequence 7222 from Patent WO200903...    59   1e-07
CP001138_3487(CP001138|pid:none) Salmonella enterica subsp. ente...    59   1e-07
AM181176_3628(AM181176|pid:none) Pseudomonas fluorescens SBW25 c...    59   1e-07
CP000103_1796(CP000103|pid:none) Nitrosospira multiformis ATCC 2...    59   1e-07
BA000035_2273(BA000035|pid:none) Corynebacterium efficiens YS-31...    59   1e-07
BX571859_101(BX571859|pid:none) Photorhabdus luminescens subsp. ...    59   1e-07
CP000248_2899(CP000248|pid:none) Novosphingobium aromaticivorans...    59   1e-07
CP000469_1211(CP000469|pid:none) Shewanella sp. ANA-3, complete ...    59   1e-07
AE015928_1576(AE015928|pid:none) Bacteroides thetaiotaomicron VP...    59   1e-07
CP001131_429(CP001131|pid:none) Anaeromyxobacter sp. K, complete...    59   1e-07
CP000085_1961(CP000085|pid:none) Burkholderia thailandensis E264...    59   1e-07
AL939132_187(AL939132|pid:none) Streptomyces coelicolor A3(2) co...    59   1e-07
CP001252_1329(CP001252|pid:none) Shewanella baltica OS223, compl...    59   1e-07
CP000891_3136(CP000891|pid:none) Shewanella baltica OS195, compl...    59   1e-07
CP000150_1103(CP000150|pid:none) Burkholderia sp. 383 chromosome...    59   1e-07
CP001071_1798(CP001071|pid:none) Akkermansia muciniphila ATCC BA...    59   1e-07
CP000139_2540(CP000139|pid:none) Bacteroides vulgatus ATCC 8482,...    58   2e-07
CP000094_1954(CP000094|pid:none) Pseudomonas fluorescens Pf0-1, ...    58   2e-07
CP000075_3607(CP000075|pid:none) Pseudomonas syringae pv. syring...    58   2e-07
CP000383_336(CP000383|pid:none) Cytophaga hutchinsonii ATCC 3340...    58   2e-07
CP000474_2699(CP000474|pid:none) Arthrobacter aurescens TC1, com...    58   2e-07

>CP000967_3683(CP000967|pid:none) Xanthomonas oryzae pv. oryzae
           PXO99A, complete genome.
          Length = 285

 Score =  164 bits (415), Expect = 2e-39
 Identities = 83/178 (46%), Positives = 109/178 (61%), Gaps = 1/178 (0%)
 Frame = +2

Query: 11  DYMSGFPTHPHRGFITVTYMLKGEMRHNDNRGNQGLLKEGSAQFMVAGRGIVHSEMPIRN 190
           DY++GFP+HPHRGF TVTYML G MRH DN GN+GLL  GS Q+M AGRG++HSEMP
Sbjct: 56  DYLAGFPSHPHRGFETVTYMLDGRMRHKDNHGNEGLLTPGSVQWMTAGRGLIHSEMP--E 113

Query: 191 HEDQSFFAFQLWINLPSAKKMIDPSYQDYHSTEIPTIVSMDDTHFNNYTVKILAGQFQDT 370
            E      FQLW+NLP+  KM DP YQ+Y    IP             TVK++AG   +
Sbjct: 114 QESGRMRGFQLWVNLPARDKMTDPKYQEYAPDHIPVAHPAP-----GVTVKVIAGAVGEV 168

Query: 371 IGPIVDENLKTFFFDIELKPNTKFTDIIIPSTHNTFVYVYNGNGRFG-GPVSRSKLVK 541
           +GPIV    +  + DI L+PN ++ D ++P+ HN F Y + G    G G  +R+ L +
Sbjct: 169 VGPIVQPATRPVYLDIMLEPNVEWDD-LLPNGHNAFAYAFEGALTVGEGDAARALLAQ 225

Lambda     K      H
   0.318    0.134    0.401

Gapped
Lambda     K      H
   0.267   0.0410    0.140

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3236559
Number of Hits to DB: 1,081,689,100
Number of extensions: 23514740
Number of successful extensions: 45346
Number of sequences better than 10.0: 580
Number of HSP's gapped: 44890
Number of HSP's successfully gapped: 582
Length of query: 198
Length of database: 1,051,180,864
Length adjustment: 122
Effective length of query: 76
Effective length of database: 656,320,666
Effective search space: 49880370616
Effective search space used: 49880370616
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 30 (16.2 bits)

 psg: 0.75  gvh: 0.33  alm: 0.49  top: 0.53  tms: 0.00  mit: 0.22  mip: 0.03
 nuc: 0.00  erl: 0.00  erm: 0.00  pox: 0.00  px2: 0.00  vac: 0.00  rnp: 0.00
 act: 0.00  caa: 0.00  yqr: 0.00  tyr: 0.00  leu: 0.00  gpi: 0.00  myr: 0.00
 dna: 0.00  rib: 0.00  bac: 0.00  m1a: 0.00  m1b: 0.00  m2 : 0.00  mNt: 0.00
 m3a: 0.00  m3b: 0.00  m_ : 1.00 

	 44.0 %: cytoplasmic
	 36.0 %: nuclear
	 12.0 %: cytoskeletal
	  8.0 %: mitochondrial

>> prediction for Contig-U14282-1 is cyt