Contig-U14269-1
Contig ID Contig-U14269-1
Contig update 2002.12.18
Contig sequence
>Contig-U14269-1 (Contig-U14269-1Q) /CSM_Contig/Contig-U14269-1Q.Seq.d
ATTATCAAGTTTTTGGGAACACTTTGAAACTGATGAATCCTATAAACAAT
TATTTCACAATGCTATGAAAGACTATACTTCATTAATTATTGATAGATTA
ATATCAAAGATTAGCTTATCACCAAATTTTAAAACTGTAGTTGATATTGG
TGGTAGTCATGGTTTTTTAATTGGTAAACTTTTAGAATCAAATCCAAATA
TTCATGGTATTAATTTCGATTTAGAAAATATTATAAATAGTTCAACAAGT
AAAAATGAGAATTTTCAACATCCAAGATTAAAACATGTTTCAGGTGATTT
CTTTAATTCAGTACCAGAAGCTGATTGTTACATTTTGAAATATATACTTC
ATGATTGGTCCGATGAAAAATGTATTACCATTTTAAATAATATTCATAAA
TCTTTAAAACCAAATGGTAAATTATTCATTAATGATTTAGTACTTGATCC
ATCAAATTATACAAAAGAAGCTGTTTTTAAAGATATTCTAATGATGCAAT
ATTTTGATGCTAAAGAAAGAAGTATTAATGAATGGCATCAATTATTTGAA
AAATGTGGTTTTAAAATTGATTCAGTTGATACTTCAATTTCACCACAATT
AATGATTGTTTCAAAAATCAATTCTTCAAATATTAATTTAAATGATTGTA
CAAATTTTAATTCTGAAATTGTTGAAGAAAAATTAAAAAATTCATTACCT
CAATTTGTAAATTGTTAAAAAAAAAATAAATAAAAAAAAAAAAAAAAAAA
AAAAAACTAAT

Gap no gap
Contig length 761
Chromosome number (1..6, M) -
Chromosome length -
Start point -
End point -
Strand (PLUS/MINUS) -
Number of clones 3
Number of EST 3
Link to clone list U14269
List of clone(s)

est1=CHD653Z,1,645
est2=VSD319Z,2,645
est3=SSK861Z,70,763
Translated Amino Acid sequence
LSSFWEHFETDESYKQLFHNAMKDYTSLIIDRLISKISLSPNFKTVVDIGGSHGFLIGKL
LESNPNIHGINFDLENIINSSTSKNENFQHPRLKHVSGDFFNSVPEADCYILKYILHDWS
DEKCITILNNIHKSLKPNGKLFINDLVLDPSNYTKEAVFKDILMMQYFDAKERSINEWHQ
LFEKCGFKIDSVDTSISPQLMIVSKINSSNINLNDCTNFNSEIVEEKLKNSLPQFVNC*k
knk*kkkkkkkn*


Translated Amino Acid sequence (All Frames)
Frame A:
iikflgtl*n**il*tiisqcyerlyfiny**inikd*litkf*ncs*yww*swffnw*t
frikskyswy*frfrkyyk*fnk*k*efstskiktcfr*fl*fstrs*llhfeiyts*lv
r*kmyyhfk*ys*ifktkw*iih**fst*siklykrscf*rysndaif*c*rkky**mas
ii*kmwf*n*fs*yfnfttindcfknqffky*fk*lykf*f*nc*rkikkfitsickllk
kk*ikkkkkkkkl


Frame B:
LSSFWEHFETDESYKQLFHNAMKDYTSLIIDRLISKISLSPNFKTVVDIGGSHGFLIGKL
LESNPNIHGINFDLENIINSSTSKNENFQHPRLKHVSGDFFNSVPEADCYILKYILHDWS
DEKCITILNNIHKSLKPNGKLFINDLVLDPSNYTKEAVFKDILMMQYFDAKERSINEWHQ
LFEKCGFKIDSVDTSISPQLMIVSKINSSNINLNDCTNFNSEIVEEKLKNSLPQFVNC*k
knk*kkkkkkkn*


Frame C:
yqvfgntlklmnpinnyftml*ktilh*llid*yqrlayhqilkl*lilvvvmvf*lvnf
*nqiqifmvlisi*kil*ivqqvkmrifniqd*nmfqvisliqyqklivtf*niyfmigp
mknvlpf*iifinl*nqmvnyslmi*ylihqiiqkklflkif**cnilmlkkevlmngin
ylknvvlkliqlilqfhhn**lfqksilqili*mivqililkllkkn*kihylnl*ivkk
kinkkkkkkkktn


own update 2004. 6.10
Homology vs CSM-cDNA
Query= Contig-U14269-1 (Contig-U14269-1Q)
/CSM_Contig/Contig-U14269-1Q.Seq.d
(761 letters)

Database: CSM
6905 sequences; 5,674,871 total letters


Score E
Sequences producing significant alignments: (bits) Value

Contig-U14269-1 (Contig-U14269-1Q) /CSM_Contig/Conti... 1342 0.0
Contig-U13001-1 (Contig-U13001-1Q) /CSM_Contig/Conti... 44 2e-04
Contig-U01501-1 (Contig-U01501-1Q) /CSM_Contig/Conti... 40 0.003
Contig-U12283-1 (Contig-U12283-1Q) /CSM_Contig/Conti... 38 0.014
Contig-U11181-1 (Contig-U11181-1Q) /CSM_Contig/Conti... 38 0.014
Contig-U06609-1 (Contig-U06609-1Q) /CSM_Contig/Conti... 38 0.014
Contig-U13069-1 (Contig-U13069-1Q) /CSM_Contig/Conti... 36 0.053
Contig-U12533-1 (Contig-U12533-1Q) /CSM_Contig/Conti... 36 0.053
Contig-U12455-1 (Contig-U12455-1Q) /CSM_Contig/Conti... 36 0.053
Contig-U10989-1 (Contig-U10989-1Q) /CSM_Contig/Conti... 36 0.053

>Contig-U14269-1 (Contig-U14269-1Q) /CSM_Contig/Contig-U14269-1Q.Seq.d
Length = 761

Score = 1342 bits (677), Expect = 0.0
Identities = 677/677 (100%)
Strand = Plus / Plus


Query: 1 attatcaagtttttgggaacactttgaaactgatgaatcctataaacaattatttcacaa 60
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1 attatcaagtttttgggaacactttgaaactgatgaatcctataaacaattatttcacaa 60


Query: 61 tgctatgaaagactatacttcattaattattgatagattaatatcaaagattagcttatc 120
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 61 tgctatgaaagactatacttcattaattattgatagattaatatcaaagattagcttatc 120


Query: 121 accaaattttaaaactgtagttgatattggtggtagtcatggttttttaattggtaaact 180
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 121 accaaattttaaaactgtagttgatattggtggtagtcatggttttttaattggtaaact 180


Query: 181 tttagaatcaaatccaaatattcatggtattaatttcgatttagaaaatattataaatag 240
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 181 tttagaatcaaatccaaatattcatggtattaatttcgatttagaaaatattataaatag 240


Query: 241 ttcaacaagtaaaaatgagaattttcaacatccaagattaaaacatgtttcaggtgattt 300
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 241 ttcaacaagtaaaaatgagaattttcaacatccaagattaaaacatgtttcaggtgattt 300


Query: 301 ctttaattcagtaccagaagctgattgttacattttgaaatatatacttcatgattggtc 360
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 301 ctttaattcagtaccagaagctgattgttacattttgaaatatatacttcatgattggtc 360


Query: 361 cgatgaaaaatgtattaccattttaaataatattcataaatctttaaaaccaaatggtaa 420
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 361 cgatgaaaaatgtattaccattttaaataatattcataaatctttaaaaccaaatggtaa 420


Query: 421 attattcattaatgatttagtacttgatccatcaaattatacaaaagaagctgtttttaa 480
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 421 attattcattaatgatttagtacttgatccatcaaattatacaaaagaagctgtttttaa 480


Query: 481 agatattctaatgatgcaatattttgatgctaaagaaagaagtattaatgaatggcatca 540
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 481 agatattctaatgatgcaatattttgatgctaaagaaagaagtattaatgaatggcatca 540


Query: 541 attatttgaaaaatgtggttttaaaattgattcagttgatacttcaatttcaccacaatt 600
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 541 attatttgaaaaatgtggttttaaaattgattcagttgatacttcaatttcaccacaatt 600


Query: 601 aatgattgtttcaaaaatcaattcttcaaatattaatttaaatgattgtacaaattttaa 660
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 601 aatgattgtttcaaaaatcaattcttcaaatattaatttaaatgattgtacaaattttaa 660


Query: 661 ttctgaaattgttgaag 677
|||||||||||||||||
Sbjct: 661 ttctgaaattgttgaag 677


>Contig-U13001-1 (Contig-U13001-1Q) /CSM_Contig/Contig-U13001-1Q.Seq.d
Length = 1857

Score = 44.1 bits (22), Expect = 2e-04
Identities = 22/22 (100%)
Strand = Plus / Plus


Query: 625 ttcaaatattaatttaaatgat 646
||||||||||||||||||||||
Sbjct: 261 ttcaaatattaatttaaatgat 282


>Contig-U01501-1 (Contig-U01501-1Q) /CSM_Contig/Contig-U01501-1Q.Seq.d
Length = 1233

Score = 40.1 bits (20), Expect = 0.003
Identities = 20/20 (100%)
Strand = Plus / Minus


Query: 656 tttaattctgaaattgttga 675
||||||||||||||||||||
Sbjct: 755 tttaattctgaaattgttga 736


Database: CSM
Posted date: Jun 9, 2004 7:35 PM
Number of letters in database: 5,674,871
Number of sequences in database: 6905

Lambda K H
1.37 0.711 1.31

Gapped
Lambda K H
1.37 0.711 1.31


Matrix: blastn matrix:1 -3
Gap Penalties: Existence: 5, Extension: 2
Number of Hits to DB: 16,688
Number of Sequences: 6905
Number of extensions: 16688
Number of successful extensions: 1972
Number of sequences better than 10.0: 218
length of query: 761
length of database: 5,674,871
effective HSP length: 16
effective length of query: 745
effective length of database: 5,564,391
effective search space: 4145471295
effective search space used: 4145471295
T: 0
A: 40
X1: 6 (11.9 bits)
X2: 15 (29.7 bits)
S1: 12 (24.3 bits)
S2: 15 (30.2 bits)
dna update 2008.12.20
Homology vs DNA
Query= Contig-U14269-1 (Contig-U14269-1Q) /CSM_Contig/Contig-U14269-1Q.Seq.d
(761 letters)

Database: ddbj_A
92,845,959 sequences; 95,242,211,685 total letters

Searching..................................................done

Score E
Sequences producing significant alignments: (bits) Value N

(AU263832) Dictyostelium discoideum vegetative cDNA clone:VS... 1243 0.0 1
(BJ376709) Dictyostelium discoideum cDNA clone:ddc29i14, 3' ... 1187 0.0 1
(C94343) Dictyostelium discoideum slug cDNA, clone SSK861. 1108 0.0 1
(BJ375983) Dictyostelium discoideum cDNA clone:ddc20a21, 3' ... 100 5e-36 4
(C23698) Dictyostelium discoideum gamete cDNA, clone FC-AK18. 44 6e-13 4
(C89827) Dictyostelium discoideum slug cDNA, clone SSG207. 68 7e-12 2
(AC116305) Dictyostelium discoideum chromosome 2 map 1005175... 48 2e-09 2
(AU264702) Dictyostelium discoideum vegetative cDNA clone:VS... 38 7e-06 4
(CP000123) Mycoplasma capricolum subsp. capricolum ATCC 2734... 32 0.004 19
(CP000102) Methanosphaera stadtmanae DSM 3091, complete genome. 36 0.006 21
(AU284388) Dictyostelium discoideum gamete cDNA clone:FC-AR0... 40 0.007 2
(AE014817) Plasmodium falciparum 3D7 chromosome 14 section 2... 38 0.11 9
(AL360272) Human DNA sequence from clone RP11-169I2 on chrom... 44 0.11 3
(EJ076292) 1095458124194 Global-Ocean-Sampling_GS-26-01-01-1... 50 0.12 1
(BX293980) Mycoplasma mycoides subsp. mycoides SC str. PG1, ... 34 0.18 21
(AC116986) Dictyostelium discoideum chromosome 2 map 2234041... 36 0.22 10
(AC068991) Homo sapiens 12 BAC RP11-300D9 (Roswell Park Canc... 44 0.25 3
(AF165818) Guillardia theta nucleomorph chromosome 1, comple... 34 0.28 2
(CP000867) Methanococcus maripaludis C6, complete genome. 36 0.29 18
(EG716115) GTE00011890 Guillardia theta non-normalised Guill... 34 0.36 2
(AC007065) Homo sapiens, clone hRPK.58_A_1, complete sequence. 44 0.37 4
(AC110358) Rattus norvegicus clone CH230-238G5, *** SEQUENCI... 44 0.40 6
(AC162205) Bos taurus clone CH240-115B7, WORKING DRAFT SEQUE... 48 0.49 1
(AC210022) Zea mays chromosome 5 clone CH201-506A12; ZMMBBc0... 48 0.49 1
(ER849314) POTJO48TR Solanum tuberosum RHPOTKEY BAC ends Sol... 48 0.49 1
(CG020522) ZMMBBc0551L02r ZMMBBc Zea mays subsp. mays genomi... 48 0.49 1
(AC012099) Homo sapiens chromosome 14 clone RP11-45G3 contai... 34 0.58 8
(BX322566) Zebrafish DNA sequence from clone CH211-209B6 in ... 44 0.58 5
(CU302384) Pig DNA sequence *** SEQUENCING IN PROGRESS *** f... 36 0.74 4
(CP000672) Haemophilus influenzae PittGG, complete genome. 36 0.88 2
(AC118196) Mus musculus chromosome 1, clone RP23-354J2, comp... 36 0.95 6
(CP000942) Ureaplasma parvum serovar 3 str. ATCC 27815, comp... 32 0.97 16
(AC170248) Bos taurus clone CH240-209J16, WORKING DRAFT SEQU... 36 1.1 8
(EK319038) 1095462423033 Global-Ocean-Sampling_GS-31-01-01-1... 40 1.2 2
(AC117072) Dictyostelium discoideum chromosome 2 map 3879572... 34 1.4 7
(AE017263) Mesoplasma florum L1 complete genome. 34 1.6 14
(AE013218) Buchnera aphidicola str. Sg (Schizaphis graminum)... 32 1.7 14
(AC150978) Medicago truncatula clone mth2-66m17, complete se... 34 1.8 7
(AC110537) Mus musculus chromosome 5, clone RP23-44A4, compl... 46 1.9 1
(AC192612) Pan troglodytes BAC clone CH251-17G17 from chromo... 46 1.9 1
(AC182582) Pan troglodytes BAC clone CH251-716H14 from chrom... 46 1.9 1
(EJ810517) 1093017486437 Global-Ocean-Sampling_GS-30-02-01-1... 46 1.9 1
(EJ781618) 1093017258915 Global-Ocean-Sampling_GS-30-02-01-1... 46 1.9 1
(EI364976) GM_WBc0120A19.f GM_WBc Glycine max genomic clone ... 46 1.9 1
(EI348187) GM_WBc0094P02.r GM_WBc Glycine max genomic clone ... 46 1.9 1
(EI344680) GM_WBc0089O21.f GM_WBc Glycine max genomic clone ... 46 1.9 1
(EI344573) GM_WBc0089M11.f GM_WBc Glycine max genomic clone ... 46 1.9 1
(EI312259) GM_WBc0043L14.f GM_WBc Glycine max genomic clone ... 46 1.9 1
(EI306432) GM_WBc0035C20.f GM_WBc Glycine max genomic clone ... 46 1.9 1
(EI288664) GM_WBc0009F14.f GM_WBc Glycine max genomic clone ... 46 1.9 1
(EI287284) GM_WBc0007H02.f GM_WBc Glycine max genomic clone ... 46 1.9 1
(CZ520251) GMW2-33P17a.g2 GMW2 Glycine max genomic, genomic ... 46 1.9 1
(CZ508522) GMW2-33P17a.g1 GMW2 Glycine max genomic, genomic ... 46 1.9 1
(EE309957) AGENCOURT_87397132 NICHD_XGC_panc Xenopus laevis ... 46 1.9 1
(CX891213) JGI_CAAM4042.rev NIH_XGC_tropTe3 Xenopus (Siluran... 46 1.9 1
(C92975) Dictyostelium discoideum slug cDNA, clone SSF404. 46 1.9 1
(C23688) Dictyostelium discoideum gamete cDNA, clone FC-AF10. 46 1.9 1
(BJ372477) Dictyostelium discoideum cDNA clone:ddc12d21, 3' ... 46 1.9 1
(BJ344705) Dictyostelium discoideum cDNA clone:dda20a07, 3' ... 46 1.9 1
(EK377888) 1095469447765 Global-Ocean-Sampling_GS-31-01-01-1... 34 2.1 3
(AC007017) Arabidopsis thaliana chromosome 2 clone F11F19 ma... 44 2.3 2
(AC008513) Homo sapiens chromosome 5 clone CTC-455C23, compl... 38 2.5 5
(CU469464) Candidatus Phytoplasma mali strain AT complete ch... 34 2.5 14
(AC116963) Dictyostelium discoideum chromosome 2 map 4657875... 36 2.5 10
(CQ595985) Sequence 23743 from Patent WO0171042. 30 2.6 6
(AF324831) Plasmodium falciparum adhesive-like protein pseud... 40 2.7 3
(AC198009) Medicago truncatula chromosome 7 BAC clone mth2-9... 40 3.5 7
(CT998559) Zebrafish DNA sequence from clone DKEY-192J13 in ... 34 3.7 7
(CT737141) CH251-2G5, complete sequence. 42 3.7 3
(AM448022) Vitis vinifera, whole genome shotgun sequence, co... 32 4.1 2
(AC163132) Bos taurus clone CH240-124A20, WORKING DRAFT SEQU... 36 4.3 7
(EJ695996) 1092956018583 Global-Ocean-Sampling_GS-30-02-01-1... 40 4.5 2
(EJ652678) 1092954006484 Global-Ocean-Sampling_GS-30-02-01-1... 40 4.6 2
(AC008490) Homo sapiens chromosome 5 clone CTC-426I14, compl... 38 4.8 3
(CL911883) OA_ABa0012J14.f OA_ABa Oryza australiensis genomi... 34 4.9 2
(EK314344) 1095462407921 Global-Ocean-Sampling_GS-31-01-01-1... 34 4.9 2
(DU367522) 1098313103924 CHORI-243 Ovis aries genomic clone ... 32 5.0 2
(CU748163) A BAC library has been constructed from PN40024 g... 32 5.0 2
(CT537374) A BAC library has been constructed from cultivar ... 36 5.0 2
(AX145620) Sequence 4342 from Patent WO0134809. 42 5.1 2
(AR486256) Sequence 4342 from patent US 6703492. 42 5.1 2
(AF270302) Staphylococcus epidermidis strain SR1 clone step.... 42 5.1 2
(CT737214) Pig DNA sequence from clone CH242-116N18 on chrom... 42 5.1 8
(EK567220) 1095521048620 Global-Ocean-Sampling_GS-32-01-01-1... 42 5.1 2
(EK518741) 1095515510277 Global-Ocean-Sampling_GS-32-01-01-1... 42 5.3 2
(AX458490) Sequence 36 from Patent WO0246454. 36 5.6 5
(AC116960) Dictyostelium discoideum chromosome 2 map complem... 32 6.0 10
(AC116977) Dictyostelium discoideum chromosome 2 map 5515173... 38 6.9 9
(DQ366711) Uncultured Prochlorococcus marinus clone ASNC1092... 36 7.2 5
(CR790384) Zebrafish DNA sequence from clone DKEY-208I6 in l... 44 7.6 1
(CR735144) Zebrafish DNA sequence from clone DKEY-241O6 in l... 44 7.6 1
(AL844160) Mouse DNA sequence from clone RP23-340N6 on chrom... 44 7.6 1
(AC122195) Mus musculus BAC clone RP23-49D1 from 8, complete... 44 7.6 1
(AC006216) Arabidopsis thaliana chromosome 1 BAC F5F19 seque... 44 7.6 1
(AC230457) Bos taurus clone CH240-508A3, WORKING DRAFT SEQUE... 44 7.6 1
(AC214916) Pan troglodytes clone rp43-79f3, WORKING DRAFT SE... 44 7.6 1
(AC214914) Pan troglodytes clone rp43-71h9, WORKING DRAFT SE... 44 7.6 1
(AC214912) Pan troglodytes clone rp43-58a19, WORKING DRAFT S... 44 7.6 1
(AC214011) Macaca mulatta chromosome 3 clone CH250-293D17, W... 44 7.6 1
(AC213907) Macaca mulatta chromosome 3 clone CH250-398B11, W... 44 7.6 1

>(AU263832) Dictyostelium discoideum vegetative cDNA clone:VSD319,
3' end single read.
Length = 644

Score = 1243 bits (627), Expect = 0.0
Identities = 627/627 (100%)
Strand = Plus / Plus


Query: 1 attatcaagtttttgggaacactttgaaactgatgaatcctataaacaattatttcacaa 60
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1 attatcaagtttttgggaacactttgaaactgatgaatcctataaacaattatttcacaa 60


Query: 61 tgctatgaaagactatacttcattaattattgatagattaatatcaaagattagcttatc 120
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 61 tgctatgaaagactatacttcattaattattgatagattaatatcaaagattagcttatc 120


Query: 121 accaaattttaaaactgtagttgatattggtggtagtcatggttttttaattggtaaact 180
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 121 accaaattttaaaactgtagttgatattggtggtagtcatggttttttaattggtaaact 180


Query: 181 tttagaatcaaatccaaatattcatggtattaatttcgatttagaaaatattataaatag 240
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 181 tttagaatcaaatccaaatattcatggtattaatttcgatttagaaaatattataaatag 240


Query: 241 ttcaacaagtaaaaatgagaattttcaacatccaagattaaaacatgtttcaggtgattt 300
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 241 ttcaacaagtaaaaatgagaattttcaacatccaagattaaaacatgtttcaggtgattt 300


Query: 301 ctttaattcagtaccagaagctgattgttacattttgaaatatatacttcatgattggtc 360
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 301 ctttaattcagtaccagaagctgattgttacattttgaaatatatacttcatgattggtc 360


Query: 361 cgatgaaaaatgtattaccattttaaataatattcataaatctttaaaaccaaatggtaa 420
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 361 cgatgaaaaatgtattaccattttaaataatattcataaatctttaaaaccaaatggtaa 420


Query: 421 attattcattaatgatttagtacttgatccatcaaattatacaaaagaagctgtttttaa 480
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 421 attattcattaatgatttagtacttgatccatcaaattatacaaaagaagctgtttttaa 480


Query: 481 agatattctaatgatgcaatattttgatgctaaagaaagaagtattaatgaatggcatca 540
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 481 agatattctaatgatgcaatattttgatgctaaagaaagaagtattaatgaatggcatca 540


Query: 541 attatttgaaaaatgtggttttaaaattgattcagttgatacttcaatttcaccacaatt 600
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 541 attatttgaaaaatgtggttttaaaattgattcagttgatacttcaatttcaccacaatt 600


Query: 601 aatgattgtttcaaaaatcaattcttc 627
|||||||||||||||||||||||||||
Sbjct: 601 aatgattgtttcaaaaatcaattcttc 627

Lambda K H
1.37 0.711 1.31

Matrix: blastn matrix:1 -3
Number of Sequences: 92845959
Number of Hits to DB: 963,080,083
Number of extensions: 62071831
Number of successful extensions: 5263847
Number of sequences better than 10.0: 142
Length of query: 761
Length of database: 95,242,211,685
Length adjustment: 24
Effective length of query: 737
Effective length of database: 97,308,875,965
Effective search space: 71716641586205
Effective search space used: 71716641586205
X1: 11 (21.8 bits)
S2: 22 (44.1 bits)

protein update 2009. 7.10
Homology vs Protein
Query= Contig-U14269-1 (Contig-U14269-1Q) /CSM_Contig/Contig-U14269-1Q.Seq.d
(761 letters)

Database: nrp_B
3,236,559 sequences; 1,051,180,864 total letters

Searching..................................................done

Score E
Sequences producing significant alignments: (bits) Value

(Q54S95) RecName: Full=O-methyltransferase 7; EC=2.1.1.-; 213 5e-54
(Q54GZ0) RecName: Full=O-methyltransferase 9; EC=2.1.1.-; 199 8e-50
(Q8T638) RecName: Full=Des-methyl DIF-1 methyltransferase A; ... 144 2e-33
AB430466_1(AB430466|pid:none) Carthamus tinctorius CtCAldOMT1 mR... 125 1e-27
FB854286_1(FB854286|pid:none) Sequence 73559 from Patent WO20080... 125 1e-27
AY268893_1(AY268893|pid:none) Papaver somniferum (R,S)-reticulin... 125 2e-27
FB854472_1(FB854472|pid:none) Sequence 73745 from Patent WO20080... 124 2e-27
EU882982_1(EU882982|pid:none) Papaver bracteatum reticuline 7-O-... 124 3e-27
(Q9FK25) RecName: Full=Quercetin 3-O-methyltransferase 1; ... 124 4e-27
FB854278_1(FB854278|pid:none) Sequence 73551 from Patent WO20080... 123 7e-27
FB854464_1(FB854464|pid:none) Sequence 73737 from Patent WO20080... 123 7e-27
AC119415_2(AC119415|pid:none) Medicago truncatula clone mth2-27n... 122 9e-27
AB232153_1(AB232153|pid:none) Eschscholzia californica Ec70MT mR... 122 9e-27
(Q9XGW0) RecName: Full=Caffeic acid 3-O-methyltransferase 1; ... 122 9e-27
AB121046_1(AB121046|pid:none) Rosa chinensis var. spontanea mRNA... 122 9e-27
EU309725_1(EU309725|pid:none) Humulus lupulus O-methyltransferas... 122 1e-26
FM164641_1(FM164641|pid:none) Humulus lupulus mRNA for O-methylt... 122 1e-26
U70424_1(U70424|pid:none) Arabidopsis thaliana O-methyltransfera... 122 2e-26
A26487_1(A26487|pid:none) Tobacco OMTI cDNA clone. 122 2e-26
FB854280_1(FB854280|pid:none) Sequence 73553 from Patent WO20080... 122 2e-26
FB854312_1(FB854312|pid:none) Sequence 73585 from Patent WO20080... 122 2e-26
CP000113_2231(CP000113|pid:none) Myxococcus xanthus DK 1622, com... 121 2e-26
DQ886020_1(DQ886020|pid:none) Malus x domestica caffeic acid O-m... 121 2e-26
DQ001169_1(DQ001169|pid:none) Acacia mangium x Acacia auriculifo... 120 5e-26
BT051813_1(BT051813|pid:none) Medicago truncatula clone MTYF5_F6... 120 6e-26
AF454631_1(AF454631|pid:none) Coffea canephora leaf caffeic acid... 120 6e-26
EF144664_1(EF144664|pid:none) Populus trichocarpa clone WS01116_... 119 8e-26
EF546435_1(EF546435|pid:none) Leucaena leucocephala caffeic acid... 119 8e-26
DQ886018_1(DQ886018|pid:none) Malus x domestica caffeic acid O-m... 119 1e-25
FB854308_1(FB854308|pid:none) Sequence 73581 from Patent WO20080... 119 1e-25
AB232781_1(AB232781|pid:none) Ipomoea nil genes for Caffeic acid... 119 1e-25
AB086104_1(AB086104|pid:none) Rosa chinensis var. spontanea RcOM... 118 2e-25
AC006216_5(AC006216|pid:none) Arabidopsis thaliana chromosome 1 ... 118 2e-25
AY443006_1(AY443006|pid:none) Ammi majus bergaptol O-methyltrans... 118 2e-25
DQ886019_1(DQ886019|pid:none) Malus x domestica caffeic acid O-m... 118 2e-25
(Q9XGV9) RecName: Full=Caffeic acid 3-O-methyltransferase 2; ... 118 2e-25
FB854276_1(FB854276|pid:none) Sequence 73549 from Patent WO20080... 118 2e-25
(Q43239) RecName: Full=Caffeic acid 3-O-methyltransferase; ... 118 2e-25
AB363638_1(AB363638|pid:none) Glehnia littoralis BMT mRNA for be... 118 2e-25
FB854458_1(FB854458|pid:none) Sequence 73731 from Patent WO20080... 118 2e-25
DQ886021_1(DQ886021|pid:none) Malus x domestica caffeic acid O-m... 118 2e-25
AF237777_1(AF237777|pid:none) Populus tomentosa caffeic acid O-3... 117 4e-25
A26484_1(A26484|pid:none) Poplar pPLC4. &FB854378_1(FB854378|pi... 117 4e-25
A26489_1(A26489|pid:none) Tobacco OMTIII cDNA. &FB854310_1(FB85... 117 5e-25
EU078958_1(EU078958|pid:none) Populus deltoides caffeic acid O-3... 117 5e-25
AF484252_1(AF484252|pid:none) Nicotiana tabacum caffeic acid O-m... 117 5e-25
(Q8LL87) RecName: Full=Caffeic acid 3-O-methyltransferase; ... 117 5e-25
(O81646) RecName: Full=Caffeic acid 3-O-methyltransferase; ... 117 5e-25
DQ665867_1(DQ665867|pid:none) Boehmeria nivea caffeic acid O-met... 116 7e-25
AY268895_1(AY268895|pid:none) Papaver somniferum catechol O-meth... 116 9e-25
AB017066_16(AB017066|pid:none) Arabidopsis thaliana genomic DNA,... 116 9e-25
DQ653365_1(DQ653365|pid:none) Arabidopsis thaliana clone 0000019... 116 9e-25
FJ667539_1(FJ667539|pid:none) Betula pendula putative caffeic ac... 115 1e-24
EF678153_1(EF678153|pid:none) Picea sitchensis clone WS02823_M11... 115 1e-24
U39301_1(U39301|pid:none) Pinus taeda xylem caffeic acid O-methy... 114 3e-24
AF064694_1(AF064694|pid:none) Thalictrum tuberosum catechol O-me... 114 3e-24
DQ084384_1(DQ084384|pid:none) Catharanthus roseus S-methyltransf... 114 3e-24
AF119225_1(AF119225|pid:none) Pinus radiata caffeic acid ortho-m... 114 3e-24
AM424783_1(AM424783|pid:none) Vitis vinifera contig VV78X230647.... 114 3e-24
D88742_1(D88742|pid:none) Glycyrrhiza echinata mRNA for O-methyl... 114 3e-24
EF083152_1(EF083152|pid:none) Picea sitchensis clone WS02725_E03... 114 4e-24
EF678645_1(EF678645|pid:none) Picea sitchensis clone WS02930_A21... 114 4e-24
AB086103_1(AB086103|pid:none) Rosa chinensis var. spontanea RcOM... 114 4e-24
EU760898_1(EU760898|pid:none) Populus tomentosa caffeic acid 3-O... 113 7e-24
EU882988_1(EU882988|pid:none) Papaver bracteatum clone PBRSC1NG_... 113 7e-24
EF457752_5(EF457752|pid:none) Gossypium arboreum alcohol dehydro... 113 7e-24
T09600(T09600) catechol O-methyltransferase homolog - Monterey p... 113 7e-24
CP000850_1962(CP000850|pid:none) Salinispora arenicola CNS-205, ... 113 7e-24
FB854452_1(FB854452|pid:none) Sequence 73725 from Patent WO20080... 112 1e-23
EF084477_1(EF084477|pid:none) Picea sitchensis clone WS02716_H05... 112 1e-23
AB183825_1(AB183825|pid:none) Iris hollandica IhCOMT mRNA for Ca... 112 1e-23
EF457751_5(EF457751|pid:none) Gossypium raimondii transposon Mut... 112 1e-23
(P46484) RecName: Full=Caffeic acid 3-O-methyltransferase; ... 112 1e-23
AY365419_1(AY365419|pid:none) Saccharum hybrid cultivar caffeic ... 112 1e-23
(Q42653) RecName: Full=Quercetin 3-O-methyltransferase 2; ... 112 1e-23
AF064693_1(AF064693|pid:none) Thalictrum tuberosum catechol O-me... 112 2e-23
EU603315_1(EU603315|pid:none) Populus trichocarpa isolate COMT1 ... 112 2e-23
AF064695_1(AF064695|pid:none) Thalictrum tuberosum catechol O-me... 111 2e-23
AY226581_1(AY226581|pid:none) Triticum aestivum caffeic acid O-m... 111 2e-23
FB854478_1(FB854478|pid:none) Sequence 73751 from Patent WO20080... 111 3e-23
(P45986) RecName: Full=Inositol 4-methyltransferase; EC... 111 3e-23
AY323278_1(AY323278|pid:none) Zea mays Sibiriaka O-methyltransfe... 110 4e-23
DQ115905_1(DQ115905|pid:none) Isatis tinctoria putative caffeic ... 110 4e-23
AY268894_1(AY268894|pid:none) Papaver somniferum (R,S)-norcoclau... 110 4e-23
EU240449_1(EU240449|pid:none) Oryza coarctata inositol methyl tr... 110 4e-23
FB854284_1(FB854284|pid:none) Sequence 73557 from Patent WO20080... 110 5e-23
EU626441_7(EU626441|pid:none) Gossypioides kirkii clone BAC 031A... 110 5e-23
AY323277_1(AY323277|pid:none) Zea mays Polar Dent O-methyltransf... 110 5e-23
(Q06509) RecName: Full=Caffeic acid 3-O-methyltransferase; ... 110 5e-23
AY323272_1(AY323272|pid:none) Zea mays inbred line MBS847 O-meth... 110 5e-23
AC011000_4(AC011000|pid:none) Sequence of BAC F16P17 from Arabid... 110 6e-23
DQ419912_1(DQ419912|pid:none) Medicago truncatula IOMT 4 mRNA, c... 110 6e-23
AF010291_1(AF010291|pid:none) Lolium perenne bispecific caffeic ... 110 6e-23
AM778913_6(AM778913|pid:none) Microcystis aeruginosa PCC 7806 ge... 109 8e-23
AM487016_2(AM487016|pid:none) Vitis vinifera contig VV78X120140.... 109 8e-23
AY323273_1(AY323273|pid:none) Zea mays inbred line Du101 O-methy... 109 8e-23
AF239740_1(AF239740|pid:none) Vitis vinifera caffeic acid O-meth... 109 1e-22
(Q86HS9) RecName: Full=O-methyltransferase 2; EC=2.1.1.-; 109 1e-22
AC116957_30(AC116957|pid:none) Dictyostelium discoideum chromoso... 109 1e-22
AC123575_4(AC123575|pid:none) Medicago truncatula clone mth1-31p... 109 1e-22
EF586876_1(EF586876|pid:none) Hordeum vulgare subsp. vulgare fla... 108 2e-22
AC140068_8(AC140068|pid:none) Medicago truncatula clone mth2-15l... 108 2e-22
AY337460_1(AY337460|pid:none) Mentha x piperita flavonoid 3'-O-m... 107 3e-22
EF423611_1(EF423611|pid:none) Triticum aestivum O-methytransfera... 107 3e-22
AF033538_1(AF033538|pid:none) Lolium perenne caffeic acid O-meth... 107 3e-22
EU954067_1(EU954067|pid:none) Zea mays clone 1453701 quercetin 3... 107 4e-22
AF153823_1(AF153823|pid:none) Festuca arundinacea comt1a caffeic... 107 4e-22
(Q6ZD89) RecName: Full=Quercetin 3-O-methyltransferase 1; ... 107 4e-22
DQ400400_1(DQ400400|pid:none) Vanilla planifolia O-methyltransfe... 107 4e-22
AB122056_1(AB122056|pid:none) Oryza sativa Japonica Group COMT m... 107 4e-22
CP000316_1736(CP000316|pid:none) Polaromonas sp. JS666, complete... 106 7e-22
FB854482_1(FB854482|pid:none) Sequence 73755 from Patent WO20080... 106 7e-22
AB436792_1(AB436792|pid:none) Ocimum basilicum CVOMT mRNA for ch... 105 1e-21
EF495248_1(EF495248|pid:none) Bambusa oldhamii caffeic acid-3-O-... 105 2e-21
AM159089_1(AM159089|pid:none) Plantago major partial mRNA for ca... 105 2e-21
AC006424_18(AC006424|pid:none) Arabidopsis thaliana chromosome I... 105 2e-21
AY610507_1(AY610507|pid:none) Thalictrum flavum subsp. glaucum (... 105 2e-21
AY343489_1(AY343489|pid:none) Catharanthus roseus isolate CrOMT6... 105 2e-21
AM429719_1(AM429719|pid:none) Vitis vinifera contig VV78X053014.... 105 2e-21
AM182766_1(AM182766|pid:none) Rosa chinensis partial oomtD gene ... 105 2e-21
AF502287_1(AF502287|pid:none) Triticum aestivum caffeic acid O-m... 105 2e-21
AY217334_1(AY217334|pid:none) Papaver somniferum S-adenosyl-L-me... 105 2e-21
AB017068_23(AB017068|pid:none) Arabidopsis thaliana genomic DNA,... 105 2e-21
AF502433_1(AF502433|pid:none) Rosa hybrid cultivar orcinol O-met... 105 2e-21
AM182781_1(AM182781|pid:none) Rosa chinensis var. spontanea part... 105 2e-21
AJ937843_1(AJ937843|pid:none) Nicotiana tabacum partial mRNA for... 104 3e-21
AM182778_1(AM182778|pid:none) Rosa canina partial oomtB gene for... 104 3e-21
AM182768_1(AM182768|pid:none) Rosa chinensis partial oomtF gene ... 104 3e-21
AY764742_1(AY764742|pid:none) Pinus taeda isolate 24 caffeate O-... 103 5e-21
FB854476_1(FB854476|pid:none) Sequence 73749 from Patent WO20080... 103 5e-21
AF033540_1(AF033540|pid:none) Lolium perenne caffeic acid O-meth... 103 6e-21
AM182828_1(AM182828|pid:none) Rosa odorata partial oomtF gene fo... 103 6e-21
AY343487_1(AY343487|pid:none) Catharanthus roseus isolate CrOMT5... 103 6e-21
AM182790_1(AM182790|pid:none) Rosa gallica partial oomtC gene fo... 103 6e-21
AJ586106_1(AJ586106|pid:none) Festuca arundinacea partial mRNA f... 103 8e-21
EF423610_1(EF423610|pid:none) Triticum aestivum O-methyltransfer... 103 8e-21
AY337461_1(AY337461|pid:none) Mentha x piperita flavonoid 4'-O-m... 103 8e-21
FJ211269_1(FJ211269|pid:none) Phleum pratense caffeic acid ortho... 103 8e-21
AK227119_1(AK227119|pid:none) Arabidopsis thaliana mRNA for O-me... 102 1e-20
EU925389_1(EU925389|pid:none) Pimpinella anisum SAM:t-anol/isoeu... 102 1e-20
AM182808_1(AM182808|pid:none) Rosa marretii partial oomtA gene f... 102 1e-20
AM182777_1(AM182777|pid:none) Rosa canina partial oomtA gene for... 102 1e-20
EU309726_1(EU309726|pid:none) Humulus lupulus O-methyltransferas... 102 1e-20
AY610510_1(AY610510|pid:none) Thalictrum flavum subsp. glaucum 3... 102 1e-20
AM182823_1(AM182823|pid:none) Rosa odorata partial oomtA gene fo... 102 1e-20
AJ786316_1(AJ786316|pid:none) Rosa gigantea partial oomt2C gene ... 102 1e-20
CP000580_227(CP000580|pid:none) Mycobacterium sp. JLS, complete ... 102 1e-20
AC146757_21(AC146757|pid:none) Medicago truncatula clone mth2-16... 102 1e-20
AK221556_1(AK221556|pid:none) Arabidopsis thaliana mRNA for O-me... 102 1e-20
EF535147_1(EF535147|pid:none) Vitis vinifera O-methyltransferase... 102 1e-20
AM182765_1(AM182765|pid:none) Rosa chinensis partial oomtC gene ... 102 2e-20
AM182805_1(AM182805|pid:none) Rosa hugonis partial oomtA gene fo... 102 2e-20
EF084837_1(EF084837|pid:none) Picea sitchensis clone WS0281_K10 ... 102 2e-20
CP000653_1913(CP000653|pid:none) Enterobacter sp. 638, complete ... 101 2e-20
AJ439744_1(AJ439744|pid:none) Rosa hybrida mRNA for orcinol O-me... 101 2e-20
AM182801_1(AM182801|pid:none) Rosa gigantea partial oomtH gene f... 101 2e-20
AM182772_1(AM182772|pid:none) Rosa beggeriana partial oomtB gene... 101 2e-20
AC012190_4(AC012190|pid:none) Arabidopsis thaliana chromosome 1 ... 101 2e-20
AM182769_1(AM182769|pid:none) Rosa banksiae partial oomtA gene f... 101 2e-20
(Q93WU2) RecName: Full=Eugenol O-methyltransferase; EC=... 101 3e-20
AM182826_1(AM182826|pid:none) Rosa odorata partial oomtD gene fo... 101 3e-20
AJ786309_1(AJ786309|pid:none) Rosa hybrid cultivar partial oomt3... 101 3e-20
CP000384_236(CP000384|pid:none) Mycobacterium sp. MCS, complete ... 101 3e-20
AM182789_1(AM182789|pid:none) Rosa gallica partial oomtB gene fo... 101 3e-20
AM182788_1(AM182788|pid:none) Rosa gallica partial oomtA gene fo... 101 3e-20
AC140068_13(AC140068|pid:none) Medicago truncatula clone mth2-15... 101 3e-20
EF146847_1(EF146847|pid:none) Populus trichocarpa clone WS01214_... 101 3e-20
AY088666_1(AY088666|pid:none) Arabidopsis thaliana clone 9016 mR... 101 3e-20
AM182774_1(AM182774|pid:none) Rosa beggeriana partial oomtD gene... 101 3e-20
AM182807_1(AM182807|pid:none) Rosa majalis partial oomtA gene fo... 101 3e-20
AJ786306_1(AJ786306|pid:none) Rosa hybrid cultivar 'Kazanlik' pa... 101 3e-20
DQ838002_39(DQ838002|pid:none) Streptomyces lavendulae strain NR... 100 4e-20
AJ786314_1(AJ786314|pid:none) Rosa gigantea partial oomt2A gene ... 100 4e-20
AM489148_1(AM489148|pid:none) Vitis vinifera contig VV78X271265.... 100 4e-20
AF502434_1(AF502434|pid:none) Rosa hybrid cultivar orcinol O-met... 100 4e-20
AB086416_1(AB086416|pid:none) Hordeum vulgare mRNA for O-methylt... 100 4e-20
AC010718_16(AC010718|pid:none) Arabidopsis thaliana chromosome 1... 100 4e-20
AM182796_1(AM182796|pid:none) Rosa gigantea partial oomtC gene f... 100 5e-20
AY127568_1(AY127568|pid:none) Catharanthus roseus flavonoid O-me... 100 5e-20
AC012190_6(AC012190|pid:none) Arabidopsis thaliana chromosome 1 ... 100 5e-20
AJ223151_1(AJ223151|pid:none) Prunus amygdalus mRNA for O-methyl... 100 5e-20
AM182812_1(AM182812|pid:none) Rosa roxburghii partial oomtA gene... 100 5e-20
AC146549_13(AC146549|pid:none) Medicago truncatula clone mth2-7p... 100 5e-20
AM182824_1(AM182824|pid:none) Rosa odorata partial oomtB gene fo... 100 7e-20
AM182771_1(AM182771|pid:none) Rosa beggeriana partial oomtA gene... 100 7e-20
AM182775_1(AM182775|pid:none) Rosa bracteata partial oomtA gene ... 100 7e-20
AM182787_1(AM182787|pid:none) Rosa chinensis var. spontanea part... 100 7e-20
AM182764_1(AM182764|pid:none) Rosa chinensis partial oomtB gene ... 100 7e-20
AM182813_1(AM182813|pid:none) Rosa rugosa partial oomtA gene for... 100 7e-20
AM182827_1(AM182827|pid:none) Rosa odorata partial oomtE gene fo... 100 7e-20
(Q9LEL5) RecName: Full=3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-m... 100 9e-20
AM182784_1(AM182784|pid:none) Rosa chinensis var. spontanea part... 100 9e-20
AL662935_13(AL662935|pid:none) Oryza sativa genomic DNA, chromos... 100 9e-20
EF444544_1(EF444544|pid:none) Catharanthus roseus clone Cr16OMT ... 100 9e-20
AM182803_1(AM182803|pid:none) Rosa gigantea partial oomtJ gene f... 100 9e-20
AP008214_1209(AP008214|pid:none) Oryza sativa (japonica cultivar... 99 1e-19
AM182779_1(AM182779|pid:none) Rosa canina partial oomtC gene for... 99 1e-19
AY217766_1(AY217766|pid:none) Sorghum bicolor caffeic acid O-met... 99 1e-19
BT039086_1(BT039086|pid:none) Zea mays full-length cDNA clone ZM... 99 1e-19
AM182814_1(AM182814|pid:none) Rosa rugosa partial oomtB gene for... 99 1e-19
AF387790_1(AF387790|pid:none) Sorghum bicolor O-methyltransferas... 99 1e-19
AJ786311_1(AJ786311|pid:none) Rosa hybrid cultivar partial oomt4... 99 1e-19
(Q9LEL6) RecName: Full=(RS)-norcoclaurine 6-O-methyltransferase;... 99 1e-19
AM182799_1(AM182799|pid:none) Rosa gigantea partial oomtF gene f... 99 1e-19
AM182802_1(AM182802|pid:none) Rosa gigantea partial oomtI gene f... 99 1e-19
AM182829_1(AM182829|pid:none) Rosa odorata partial oomtA gene fo... 99 1e-19
AJ786315_1(AJ786315|pid:none) Rosa gigantea partial oomt2B gene ... 99 1e-19
AM182783_1(AM182783|pid:none) Rosa chinensis var. spontanea part... 99 1e-19
AC144341_4(AC144341|pid:none) Medicago truncatula clone mth2-22g... 99 1e-19
AM182795_1(AM182795|pid:none) Rosa gigantea partial oomtB gene f... 99 1e-19
CP000511_2422(CP000511|pid:none) Mycobacterium vanbaalenii PYR-1... 99 2e-19
CP000951_1310(CP000951|pid:none) Synechococcus sp. PCC 7002, com... 98 2e-19
AM182810_1(AM182810|pid:none) Rosa marretii partial oomtC gene f... 98 2e-19
AM182793_1(AM182793|pid:none) Rosa gallica partial oomtF gene fo... 98 3e-19
AM182797_1(AM182797|pid:none) Rosa gigantea partial oomtD gene f... 98 3e-19
AM420293_2538(AM420293|pid:none) Saccharopolyspora erythraea NRR... 98 3e-19
AL035522_2(AL035522|pid:none) Arabidopsis thaliana DNA chromosom... 97 4e-19
AJ586105_1(AJ586105|pid:none) Lolium multiflorum partial mRNA fo... 97 4e-19
AC146549_15(AC146549|pid:none) Medicago truncatula clone mth2-7p... 97 6e-19
U82011_1(U82011|pid:none) Prunus armeniaca methyltransferase mRN... 96 9e-19
AY389608_1(AY389608|pid:none) Hyacinthus orientalis O-methyltran... 96 9e-19
DQ424844_1(DQ424844|pid:none) Cathaya argyrophylla isolate 1 caf... 96 9e-19
AB258439_1(AB258439|pid:none) Iris x hollandica IhOMT2 mRNA for ... 96 1e-18
CP000480_5175(CP000480|pid:none) Mycobacterium smegmatis str. MC... 96 1e-18
AM182770_1(AM182770|pid:none) Rosa banksiae partial oomtB gene f... 96 1e-18
FM178870_1(FM178870|pid:none) Vitis vinifera mRNA for resveratro... 96 2e-18
EU882980_1(EU882980|pid:none) Papaver bracteatum putative norcoc... 96 2e-18
(P16559) RecName: Full=Multifunctional cyclase-dehydratase-3-O-m... 95 2e-18
AC079037_18(AC079037|pid:none) Oryza sativa chromosome 10 clone ... 95 2e-18
DQ885221_1(DQ885221|pid:none) Linum nodiflorum coniferyl alcohol... 95 3e-18
FJ645928_1(FJ645928|pid:none) Mangifera indica cultivar Dashehar... 94 4e-18
AF033539_1(AF033539|pid:none) Lolium perenne caffeic acid O-meth... 94 4e-18
AM900040_15(AM900040|pid:none) Streptomyces olivaceus elloramyci... 94 5e-18
U43498_1(U43498|pid:none) Hordeum vulgare 0-methyltransferase mR... 94 5e-18
AF127374_45(AF127374|pid:none) Streptomyces lavendulae LinA-like... 94 6e-18
AY127569_1(AY127569|pid:none) Catharanthus roseus O-methyltransf... 94 6e-18
AY061859_9(AY061859|pid:none) Pseudomonas fluorescens safracin b... 93 1e-17
DQ862834_1(DQ862834|pid:none) Triticum monococcum caffeic acid 3... 93 1e-17
AY610512_1(AY610512|pid:none) Thalictrum flavum subsp. glaucum (... 92 2e-17
T06786(T06786) 6a-hydroxymaackiain methyltransferase (EC 2.1.1.-... 92 2e-17
AB091684_1(AB091684|pid:none) Glycyrrhiza echinata HI4'OMT mRNA ... 92 2e-17
DQ419914_1(DQ419914|pid:none) Medicago truncatula IOMT 7 mRNA, c... 92 2e-17
AM424198_1(AM424198|pid:none) Vitis vinifera contig VV78X139377.... 91 3e-17
AY942158_1(AY942158|pid:none) Medicago truncatula SAM dependent ... 91 3e-17
AC146549_20(AC146549|pid:none) Medicago truncatula clone mth2-7p... 91 3e-17
AK072016_1(AK072016|pid:none) Oryza sativa Japonica Group cDNA c... 91 4e-17
CP001013_1310(CP001013|pid:none) Leptothrix cholodnii SP-6, comp... 91 4e-17
AY337458_1(AY337458|pid:none) Mentha x piperita flavonoid 7-O-me... 91 4e-17
AL035522_3(AL035522|pid:none) Arabidopsis thaliana DNA chromosom... 91 5e-17
AY337457_1(AY337457|pid:none) Mentha x piperita flavonoid 7-O-me... 91 5e-17
AY549198_4(AY549198|pid:none) Streptomyces tubercidicus oxidored... 90 7e-17
FB854468_1(FB854468|pid:none) Sequence 73741 from Patent WO20080... 90 7e-17
FB854460_1(FB854460|pid:none) Sequence 73733 from Patent WO20080... 90 7e-17
AF525490_17(AF525490|pid:none) Streptomyces griseus fredericamyc... 90 9e-17
EF214736_1(EF214736|pid:none) Linum usitatissimum caffeic acid O... 90 9e-17
FB854450_1(FB854450|pid:none) Sequence 73723 from Patent WO20080... 90 9e-17
AB014456_1(AB014456|pid:none) Pyrus pyrifolia mRNA for O-methylt... 90 9e-17
AM433396_2(AM433396|pid:none) Vitis vinifera contig VV78X237045.... 90 9e-17
EF444546_1(EF444546|pid:none) Catharanthus roseus clone CROLF1NG... 89 1e-16
AY337459_1(AY337459|pid:none) Mentha x piperita flavonoid 8-O-me... 89 2e-16
BX601644_2(BX601644|pid:none) Zebrafish DNA sequence from clone ... 89 2e-16
AP008214_336(AP008214|pid:none) Oryza sativa (japonica cultivar-... 89 2e-16
AP004560_24(AP004560|pid:none) Oryza sativa Japonica Group genom... 89 2e-16
AY894417_1(AY894417|pid:none) Ruta graveolens 3,5-dimethoxypheno... 89 2e-16
AP008218_789(AP008218|pid:none) Oryza sativa (japonica cultivar-... 89 2e-16
DQ885222_1(DQ885222|pid:none) Linum album coniferyl alcohol 9-O-... 89 2e-16
CP000518_2960(CP000518|pid:none) Mycobacterium sp. KMS, complete... 89 2e-16
BC154029_1(BC154029|pid:none) Danio rerio zgc:171885, mRNA (cDNA... 89 2e-16
BT037928_1(BT037928|pid:none) Zea mays full-length cDNA clone ZM... 88 3e-16
(P47917) RecName: Full=O-methyltransferase ZRP4; Short=... 88 3e-16
BT043303_1(BT043303|pid:none) Zea mays full-length cDNA clone ZM... 88 3e-16
AY838877_7(AY838877|pid:none) Aspergillus fumigatus putative gli... 88 3e-16
DQ885220_1(DQ885220|pid:none) Linum flavum coniferyl alcohol 9-O... 88 3e-16
CP000150_336(CP000150|pid:none) Burkholderia sp. 383 chromosome ... 87 4e-16
BA000012_6339(BA000012|pid:none) Mesorhizobium loti MAFF303099 D... 87 4e-16
CR382134_706(CR382134|pid:none) Debaryomyces hansenii strain CBS... 87 7e-16
BT039676_1(BT039676|pid:none) Zea mays full-length cDNA clone ZM... 86 1e-15
X77467_1(X77467|pid:none) H.vulgare L. mRNA for flavonoid 7-O-me... 86 1e-15
AF367289_1(AF367289|pid:none) Arabidopsis thaliana AT3g53140/T4D... 86 1e-15
AC130603_2(AC130603|pid:none) Oryza sativa (japonica cultivar-gr... 86 1e-15
EU960220_1(EU960220|pid:none) Zea mays clone 222640 O-methyltran... 86 2e-15
BX571875_105(BX571875|pid:none) Photorhabdus luminescens subsp. ... 86 2e-15
AP008231_1021(AP008231|pid:none) Synechococcus elongatus PCC 630... 86 2e-15
AM463116_6(AM463116|pid:none) Vitis vinifera contig VV78X253715.... 86 2e-15
AM932687_4(AM932687|pid:none) Triticum aestivum 3B chromosome, c... 85 2e-15
BX571875_104(BX571875|pid:none) Photorhabdus luminescens subsp. ... 85 2e-15
AP008218_790(AP008218|pid:none) Oryza sativa (japonica cultivar-... 85 2e-15
EF429247_5(EF429247|pid:none) Penicillium lilacinoechinulatum st... 85 3e-15
BT065574_1(BT065574|pid:none) Zea mays full-length cDNA clone ZM... 85 3e-15
EF189708_1(EF189708|pid:none) Sorghum bicolor O-methyltransferas... 85 3e-15
BX908810_7(BX908810|pid:none) Neurospora crassa DNA linkage grou... 84 4e-15
AY553235_13(AY553235|pid:none) Leptosphaeria maculans HDX1 (HDX1... 84 4e-15
AM270272_43(AM270272|pid:none) Aspergillus niger contig An12c016... 84 5e-15
EU883011_1(EU883011|pid:none) Papaver bracteatum reticuline 7-O-... 84 6e-15
BT035223_1(BT035223|pid:none) Zea mays full-length cDNA clone ZM... 84 6e-15
AM420293_3947(AM420293|pid:none) Saccharopolyspora erythraea NRR... 84 6e-15
AC079037_21(AC079037|pid:none) Oryza sativa chromosome 10 clone ... 83 8e-15
CP000480_2143(CP000480|pid:none) Mycobacterium smegmatis str. MC... 83 8e-15
(Q92056) RecName: Full=Hydroxyindole O-methyltransferase; ... 83 8e-15
AP003916_10(AP003916|pid:none) Oryza sativa Japonica Group genom... 83 8e-15
AY549202_3(AY549202|pid:none) Streptomyces tubercidicus oxidored... 83 8e-15
AP008217_1043(AP008217|pid:none) Oryza sativa (japonica cultivar... 83 8e-15
CR858159_1(CR858159|pid:none) Pongo abelii mRNA; cDNA DKFZp468C2... 83 8e-15
AK090498_1(AK090498|pid:none) Homo sapiens cDNA FLJ33179 fis, cl... 83 1e-14
Y15521_2(Y15521|pid:none) Homo sapiens ASMTL gene. 83 1e-14
Y15521_1(Y15521|pid:none) Homo sapiens ASMTL gene. 83 1e-14
AM501485_2(AM501485|pid:none) Streptomyces sp. A2991200 benG gen... 83 1e-14
AK299231_1(AK299231|pid:none) Homo sapiens cDNA FLJ55355 complet... 83 1e-14
AM489148_2(AM489148|pid:none) Vitis vinifera contig VV78X271265.... 82 2e-14
AM269952_15(AM269952|pid:none) Aspergillus niger contig An01c005... 82 2e-14
BC010089_1(BC010089|pid:none) Homo sapiens acetylserotonin O-met... 82 2e-14
AK001090_1(AK001090|pid:none) Homo sapiens cDNA FLJ10228 fis, cl... 82 2e-14
EU960042_1(EU960042|pid:none) Zea mays clone 221358 O-methyltran... 82 2e-14
(Q54FP4) RecName: Full=O-methyltransferase 10; EC=2.1.1... 82 2e-14
M84411_1(M84411|pid:none) Nicotiana tabacum O-methyltransferase ... 82 2e-14
BC088783_1(BC088783|pid:none) Xenopus tropicalis hypothetical LO... 82 2e-14
EU956381_1(EU956381|pid:none) Zea mays clone 1561696 O-methyltra... 81 3e-14
CP000571_273(CP000571|pid:none) Burkholderia pseudomallei 668 ch... 81 3e-14
CP000667_2771(CP000667|pid:none) Salinispora tropica CNB-440, co... 81 3e-14
DQ355149_1(DQ355149|pid:none) Cercospora nicotianae cercosporin ... 81 4e-14
BX571966_135(BX571966|pid:none) Burkholderia pseudomallei strain... 81 4e-14
EF457753_6(EF457753|pid:none) Gossypium hirsutum retrotransposon... 80 5e-14
CP000125_1645(CP000125|pid:none) Burkholderia pseudomallei 1710b... 80 5e-14
CP000573_182(CP000573|pid:none) Burkholderia pseudomallei 1106a ... 80 5e-14
EF033251_1(EF033251|pid:none) Scophthalmus maximus methyl transf... 80 7e-14
AP009493_6886(AP009493|pid:none) Streptomyces griseus subsp. gri... 80 7e-14
FB854492_1(FB854492|pid:none) Sequence 73765 from Patent WO20080... 80 7e-14
BT035856_1(BT035856|pid:none) Zea mays full-length cDNA clone ZM... 80 7e-14
BT039525_1(BT039525|pid:none) Zea mays full-length cDNA clone ZM... 80 9e-14
AF479308_1(AF479308|pid:none) Arachis hypogaea putative caffeic ... 80 9e-14
L78306_1(L78306|pid:none) Rattus norvegicus hydroxyindole-O-meth... 79 2e-13
EF444545_1(EF444545|pid:none) Catharanthus roseus clone CROLF1NG... 79 2e-13
AP004862_4(AP004862|pid:none) Oryza sativa Japonica Group genomi... 79 2e-13
AM270059_38(AM270059|pid:none) Aspergillus niger contig An03c018... 79 2e-13
AP007175_42(AP007175|pid:none) Aspergillus oryzae RIB40 genomic ... 79 2e-13
CP000473_803(CP000473|pid:none) Solibacter usitatus Ellin6076, c... 79 2e-13
CP000085_207(CP000085|pid:none) Burkholderia thailandensis E264 ... 79 2e-13
BT068879_1(BT068879|pid:none) Zea mays full-length cDNA clone ZM... 79 2e-13
AC112208_22(AC112208|pid:none) Oryza sativa (japonica cultivar-g... 78 3e-13
AM269994_16(AM269994|pid:none) Aspergillus niger contig An01c048... 78 3e-13
AY216900_1(AY216900|pid:none) Limonium latifolium clone gt31 S-a... 78 3e-13
AY216903_1(AY216903|pid:none) Limonium latifolium S-adenosyl-L-m... 78 3e-13
AY216902_1(AY216902|pid:none) Limonium latifolium clone gt61 S-a... 78 3e-13
AM920433_314(AM920433|pid:none) Penicillium chrysogenum Wisconsi... 78 3e-13
FJ483966_28(FJ483966|pid:none) Streptomyces diastatochromogenes ... 78 3e-13
CR859692_1(CR859692|pid:none) Pongo abelii mRNA; cDNA DKFZp469F1... 77 5e-13
AY216896_1(AY216896|pid:none) Limonium latifolium clone 23 S-ade... 77 5e-13
AM270372_28(AM270372|pid:none) Aspergillus niger contig An16c020... 77 6e-13
AM492533_30(AM492533|pid:none) Streptomyces tendae lysolipin bio... 77 6e-13
CP000450_1019(CP000450|pid:none) Nitrosomonas eutropha C91, comp... 77 6e-13
BT039560_1(BT039560|pid:none) Zea mays full-length cDNA clone ZM... 77 6e-13
BX571875_101(BX571875|pid:none) Photorhabdus luminescens subsp. ... 77 8e-13
CU633899_291(CU633899|pid:none) Podospora anserina genomic DNA c... 77 8e-13
AF023481_1(AF023481|pid:none) Medicago sativa o-methytransferase... 77 8e-13
(Q8HZJ0) RecName: Full=Hydroxyindole O-methyltransferase; ... 77 8e-13
AY510452_18(AY510452|pid:none) Aspergillus flavus isolate BN008 ... 76 1e-12
AY510455_15(AY510455|pid:none) Aspergillus flavus isolate AF36 a... 76 1e-12
AM469302_1(AM469302|pid:none) Vitis vinifera contig VV78X049259.... 75 2e-12
AF159789_1(AF159789|pid:none) Aspergillus flavus O-methyltransfe... 75 2e-12
DQ143963_7(DQ143963|pid:none) Streptomyces rimosus oxytetracycli... 75 3e-12
EU961576_1(EU961576|pid:none) Zea mays clone 236658 O-methyltran... 75 3e-12
BX294135_213(BX294135|pid:none) Rhodopirellula baltica SH 1 comp... 75 3e-12
AP007175_50(AP007175|pid:none) Aspergillus oryzae RIB40 genomic ... 74 4e-12
AJ297297_1(AJ297297|pid:none) Pinus pinaster partial mRNA for ca... 74 5e-12
AY510451_16(AY510451|pid:none) Aspergillus flavus isolate AF13 a... 74 5e-12
AX196123_1(AX196123|pid:none) Sequence 195 from Patent WO0151639. 74 5e-12
AY510453_16(AY510453|pid:none) Aspergillus flavus isolate AF70 a... 74 5e-12
EU882998_1(EU882998|pid:none) Thalictrum flavum clone TFLSC1NG_0... 74 7e-12
AB022905_1(AB022905|pid:none) Aspergillus parasiticus mt-I gene ... 73 9e-12
AC135258_6(AC135258|pid:none) Oryza sativa (japonica cultivar-gr... 73 9e-12
AP007155_451(AP007155|pid:none) Aspergillus oryzae RIB40 genomic... 73 1e-11
DQ143963_20(DQ143963|pid:none) Streptomyces rimosus oxytetracycl... 73 1e-11
CP000431_4389(CP000431|pid:none) Rhodococcus jostii RHA1, comple... 72 1e-11
BT064079_1(BT064079|pid:none) Zea mays full-length cDNA clone ZM... 72 1e-11
AY177404_1(AY177404|pid:none) Secale cereale O-methyltransferase... 72 1e-11
AY048670_36(AY048670|pid:none) Streptomyces globisporus enediyne... 72 1e-11
AF258243_1(AF258243|pid:none) Brassica napus cultivar Stellar O-... 72 1e-11
CU633454_8(CU633454|pid:none) Podospora anserina genomic DNA chr... 72 2e-11
AM920431_991(AM920431|pid:none) Penicillium chrysogenum Wisconsi... 72 2e-11
AY337013_1(AY337013|pid:none) Brassica rapa subsp. pekinensis cl... 72 2e-11
CP000667_2786(CP000667|pid:none) Salinispora tropica CNB-440, co... 72 2e-11
CP000096_752(CP000096|pid:none) Pelodictyon luteolum DSM 273, co... 72 2e-11
AM270304_7(AM270304|pid:none) Aspergillus niger contig An13c0100... 72 2e-11
AY510454_19(AY510454|pid:none) Aspergillus nomius isolate AN1313... 71 4e-11
EU147298_25(EU147298|pid:none) Streptomyces rishiriensis strain ... 71 4e-11
EF189706_1(EF189706|pid:none) Sorghum bicolor O-methyltransferas... 71 4e-11
EU975141_1(EU975141|pid:none) Zea mays clone 472438 O-methyltran... 71 4e-11
AK059770_1(AK059770|pid:none) Oryza sativa Japonica Group cDNA c... 70 6e-11
FN178498_11(FN178498|pid:none) Streptomyces anulatus phenazine g... 70 6e-11
EU147299_2(EU147299|pid:none) Streptomyces sanglieri strain AK 6... 70 6e-11
BC121542_1(BC121542|pid:none) Xenopus tropicalis hypothetical pr... 70 7e-11
EU962149_1(EU962149|pid:none) Zea mays clone 240613 O-methyltran... 70 9e-11
AM270218_7(AM270218|pid:none) Aspergillus niger contig An11c0010... 69 1e-10
D38214_2(D38214|pid:none) Streptomyces aureofaciens cts4, cts6 a... 69 1e-10
AF453501_35(AF453501|pid:none) Actinosynnema pretiosum subsp. au... 69 1e-10
AK314922_1(AK314922|pid:none) Homo sapiens cDNA, FLJ95831, highl... 69 2e-10
BC133912_1(BC133912|pid:none) Danio rerio zgc:162232, mRNA (cDNA... 69 2e-10
AF370034_1(AF370034|pid:none) Coturnix japonica hydroxyindole O-... 69 2e-10
CU633876_97(CU633876|pid:none) Podospora anserina genomic DNA ch... 69 2e-10
AL683807_3(AL683807|pid:none) Human DNA sequence from clone RP13... 69 2e-10
AM270379_17(AM270379|pid:none) Aspergillus niger contig An16c027... 68 3e-10
AM425674_1(AM425674|pid:none) Vitis vinifera contig VV78X219143.... 68 3e-10
AM451825_1(AM451825|pid:none) Vitis vinifera contig VV78X218047.... 67 6e-10
AP007150_470(AP007150|pid:none) Aspergillus oryzae RIB40 genomic... 67 6e-10
DQ456845_1(DQ456845|pid:none) Hypocrea virens O-methyl transfera... 67 6e-10
AB196490_17(AB196490|pid:none) Aspergillus oryzae DNA, aflatoxin... 67 8e-10
AP007159_25(AP007159|pid:none) Aspergillus oryzae RIB40 genomic ... 67 8e-10
AY510455_16(AY510455|pid:none) Aspergillus flavus isolate AF36 a... 66 1e-09
AY510453_17(AY510453|pid:none) Aspergillus flavus isolate AF70 a... 66 1e-09
(Q06528) RecName: Full=Carminomycin 4-O-methyltransferase; ... 66 1e-09
U76384_1(U76384|pid:none) Triticum aestivum o-methyltransferase ... 66 1e-09
AM270244_47(AM270244|pid:none) Aspergillus niger contig An11c027... 66 1e-09
AP007157_399(AP007157|pid:none) Aspergillus oryzae RIB40 genomic... 66 1e-09
AP007154_131(AP007154|pid:none) Aspergillus oryzae RIB40 genomic... 65 2e-09
AF258244_1(AF258244|pid:none) Brassica napus cultivar Stellar O-... 65 3e-09
EU147299_12(EU147299|pid:none) Streptomyces sanglieri strain AK ... 65 3e-09
AF258245_1(AF258245|pid:none) Brassica rapa cultivar R500 O-meth... 65 3e-09
AJ698925_1(AJ698925|pid:none) Populus deltoides x Populus maximo... 64 4e-09
AF258248_1(AF258248|pid:none) Brassica oleracea cultivar Rapid C... 64 4e-09
AP008218_568(AP008218|pid:none) Oryza sativa (japonica cultivar-... 64 4e-09
AX212323_1(AX212323|pid:none) Sequence 2 from Patent WO0159139. 64 5e-09
AM270059_4(AM270059|pid:none) Aspergillus niger contig An03c0180... 64 5e-09
L35154_4(L35154|pid:none) Streptomyces sp. acyltransferase (dauA... 64 7e-09
AL683807_6(AL683807|pid:none) Human DNA sequence from clone RP13... 63 9e-09
AY150801_18(AY150801|pid:none) Rhodospirillum rubrum strain S1 c... 63 9e-09
AM270191_9(AM270191|pid:none) Aspergillus niger contig An09c0020... 63 9e-09
AB070947_8(AB070947|pid:none) Streptomyces avermitilis polyketid... 63 9e-09
AM920437_117(AM920437|pid:none) Penicillium chrysogenum Wisconsi... 63 1e-08
CU633876_95(CU633876|pid:none) Podospora anserina genomic DNA ch... 63 1e-08
AC138195_20(AC138195|pid:none) Oryza sativa (japonica cultivar-g... 62 2e-08
AM270395_26(AM270395|pid:none) Aspergillus niger contig An18c002... 62 2e-08
AB011413_3(AB011413|pid:none) Streptomyces griseus genes for Orf... 62 2e-08
DQ991505_1(DQ991505|pid:none) Cercospora nicotianae O-methyltran... 62 2e-08
BT036832_1(BT036832|pid:none) Zea mays full-length cDNA clone ZM... 62 3e-08
AP007151_142(AP007151|pid:none) Aspergillus oryzae RIB40 genomic... 62 3e-08
AM492533_32(AM492533|pid:none) Streptomyces tendae lysolipin bio... 61 3e-08
AP007155_601(AP007155|pid:none) Aspergillus oryzae RIB40 genomic... 61 3e-08
EF085637_1(EF085637|pid:none) Picea sitchensis clone WS02913_J03... 61 3e-08
AM454604_1(AM454604|pid:none) Vitis vinifera contig VV78X268285.... 61 4e-08
BT030091_1(BT030091|pid:none) Arabidopsis thaliana At1g21130 gen... 60 6e-08
AM420293_4564(AM420293|pid:none) Saccharopolyspora erythraea NRR... 60 6e-08
AP008218_463(AP008218|pid:none) Oryza sativa (japonica cultivar-... 60 6e-08
AX212323_2(AX212323|pid:none) Sequence 2 from Patent WO0159139. 60 7e-08
AM269974_10(AM269974|pid:none) Aspergillus niger contig An01c027... 60 1e-07
AP007175_473(AP007175|pid:none) Aspergillus oryzae RIB40 genomic... 59 1e-07
AL607008_9(AL607008|pid:none) Oryza sativa genomic DNA, chromoso... 59 2e-07
CP000744_879(CP000744|pid:none) Pseudomonas aeruginosa PA7, comp... 58 3e-07
AB385841_1(AB385841|pid:none) Streptomyces albulus pls gene for ... 58 4e-07
AM238663_674(AM238663|pid:none) Streptomyces ambofaciens ATCC 23... 57 5e-07
BX572597_244(BX572597|pid:none) Rhodopseudomonas palustris CGA00... 57 6e-07
CP000478_912(CP000478|pid:none) Syntrophobacter fumaroxidans MPO... 57 6e-07
AM269996_81(AM269996|pid:none) Aspergillus niger contig An02c001... 57 6e-07
CP000854_920(CP000854|pid:none) Mycobacterium marinum M, complet... 57 6e-07
AY659199_1(AY659199|pid:none) Synthetic construct Peudomonas aer... 57 6e-07
AE004091_4208(AE004091|pid:none) Pseudomonas aeruginosa PAO1, co... 57 6e-07
AM270265_6(AM270265|pid:none) Aspergillus niger contig An12c0080... 57 8e-07
CP000325_565(CP000325|pid:none) Mycobacterium ulcerans Agy99, co... 56 1e-06
CP001344_236(CP001344|pid:none) Cyanothece sp. PCC 7425, complet... 56 1e-06
BC102999_1(BC102999|pid:none) Bos taurus acetylserotonin O-methy... 56 1e-06
AP007154_260(AP007154|pid:none) Aspergillus oryzae RIB40 genomic... 55 2e-06
EU967787_1(EU967787|pid:none) Zea mays clone 306068 O-methyltran... 55 3e-06
CP001096_1673(CP001096|pid:none) Rhodopseudomonas palustris TIE-... 55 3e-06
CP000085_2110(CP000085|pid:none) Burkholderia thailandensis E264... 53 9e-06
AC112208_16(AC112208|pid:none) Oryza sativa (japonica cultivar-g... 53 9e-06
CP000301_1274(CP000301|pid:none) Rhodopseudomonas palustris BisB... 53 1e-05
CP001349_5496(CP001349|pid:none) Methylobacterium nodulans ORS 2... 52 2e-05
CP000859_2654(CP000859|pid:none) Desulfococcus oleovorans Hxd3, ... 52 2e-05
AP008217_746(AP008217|pid:none) Oryza sativa (japonica cultivar-... 52 2e-05
CT573071_1957(CT573071|pid:none) Kuenenia stuttgartiensis genome... 52 2e-05
EU074211_15(EU074211|pid:none) Kutzneria sp. 744 regulator gene,... 52 2e-05
DQ390698_1(DQ390698|pid:none) Aspergillus parasiticus strain IC7... 51 3e-05
AE016825_2261(AE016825|pid:none) Chromobacterium violaceum ATCC ... 51 3e-05
CP000148_1714(CP000148|pid:none) Geobacter metallireducens GS-15... 51 5e-05
DQ390681_1(DQ390681|pid:none) Aspergillus parasiticus strain IC1... 51 5e-05
CP000393_2723(CP000393|pid:none) Trichodesmium erythraeum IMS101... 51 5e-05
CU633461_87(CU633461|pid:none) Podospora anserina genomic DNA ch... 51 5e-05
AM420293_2801(AM420293|pid:none) Saccharopolyspora erythraea NRR... 50 6e-05
CP000473_7105(CP000473|pid:none) Solibacter usitatus Ellin6076, ... 50 6e-05
CP000859_926(CP000859|pid:none) Desulfococcus oleovorans Hxd3, c... 49 1e-04
AY458639_84(AY458639|pid:none) Uncultured marine bacterium 442 c... 49 1e-04
AE008920_2(AE008920|pid:none) Uncultured marine proteobacterium ... 49 1e-04
AE008919_5(AE008919|pid:none) Uncultured marine proteobacterium ... 49 1e-04
CP000544_1581(CP000544|pid:none) Halorhodospira halophila SL1, c... 49 1e-04
CQ796209_1(CQ796209|pid:none) Sequence 21 from Patent WO20040270... 49 1e-04
CP001110_2551(CP001110|pid:none) Pelodictyon phaeoclathratiforme... 48 4e-04
AB212624_4(AB212624|pid:none) Streptomyces sp. KO-3988 furaquino... 48 4e-04
CP000103_1172(CP000103|pid:none) Nitrosospira multiformis ATCC 2... 48 4e-04
AB034704_13(AB034704|pid:none) Rubrivivax gelatinosus DNA, photo... 47 5e-04
BX842573_291(BX842573|pid:none) Mycobacterium tuberculosis H37Rv... 47 5e-04
CP000362_106(CP000362|pid:none) Roseobacter denitrificans OCh 11... 47 5e-04
EU240558_6(EU240558|pid:none) Streptomyces sahachiroi azinomycin... 47 5e-04
AP008218_462(AP008218|pid:none) Oryza sativa (japonica cultivar-... 47 5e-04
CP001145_1369(CP001145|pid:none) Coprothermobacter proteolyticus... 47 5e-04
AY234384_3(AY234384|pid:none) Rubrivivax gelatinosus strain S1 5... 47 5e-04
CP001087_1552(CP001087|pid:none) Desulfobacterium autotrophicum ... 47 7e-04
FJ483966_18(FJ483966|pid:none) Streptomyces diastatochromogenes ... 47 9e-04
AM920431_84(AM920431|pid:none) Penicillium chrysogenum Wisconsin... 46 0.001
AF528191_17(AF528191|pid:none) Thiocapsa roseopersicina strain B... 46 0.001
CP001322_792(CP001322|pid:none) Desulfatibacillum alkenivorans A... 46 0.001
CP000698_4079(CP000698|pid:none) Geobacter uraniireducens Rf4, c... 45 0.002

>(Q54S95) RecName: Full=O-methyltransferase 7; EC=2.1.1.-;
Length = 339

Score = 213 bits (542), Expect = 5e-54
Identities = 98/202 (48%), Positives = 146/202 (72%)
Frame = +2

Query: 11 FWEHFETDESYKQLFHNAMKDYTSLIIDRLISKISLSPNFKTVVDIGGSHGFLIGKLLES 190
FW+ +T+E +K F+ M+++++L I +I S +F TVVD+GGSHG ++G+L++
Sbjct: 141 FWDIVKTNEHFKYSFNQEMREFSNLSIPTIIKNTDFS-SFNTVVDVGGSHGRIVGELVKK 199

Query: 191 NPNIHGINFDLENIINSSTSKNENFQHPRLKHVSGDFFNSVPEADCYILKYILHDWSDEK 370
N++GI FDLE +INSS K +HPR+++VSG FF SVP ADCY+LK ILHDW DEK
Sbjct: 200 YENLNGIVFDLETVINSSIEK---IKHPRIEYVSGSFFESVPSADCYVLKNILHDWDDEK 256

Query: 371 CITILNNIHKSLKPNGKLFINDLVLDPSNYTKEAVFKDILMMQYFDAKERSINEWHQLFE 550
C+ IL I KS+K N K+FI D ++DP++Y K ++F D+ + +F+++ERS+N+W QL +
Sbjct: 257 CLEILKTISKSMKENSKIFIFDEIIDPNDYRKLSLFLDVTVFHFFNSRERSLNDWKQLCD 316

Query: 551 KCGFKIDSVDTSISPQLMIVSK 616
K FKIDS++ PQL+I+SK
Sbjct: 317 KSDFKIDSINNVTQPQLLILSK 338

Lambda K H
0.318 0.134 0.401

Gapped
Lambda K H
0.267 0.0410 0.140

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3236559
Number of Hits to DB: 929,010,603
Number of extensions: 16675640
Number of successful extensions: 54439
Number of sequences better than 10.0: 696
Number of HSP's gapped: 53676
Number of HSP's successfully gapped: 697
Length of query: 253
Length of database: 1,051,180,864
Length adjustment: 126
Effective length of query: 127
Effective length of database: 643,374,430
Effective search space: 81708552610
Effective search space used: 81708552610
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 31 (16.5 bits)

PSORT

psg: 0.75 gvh: 0.38 alm: 0.44 top: 0.53 tms: 0.00 mit: 0.24 mip: 0.00
nuc: 0.00 erl: 0.00 erm: 0.00 pox: 0.00 px2: 0.00 vac: 0.00 rnp: 0.00
act: 0.00 caa: 0.00 yqr: 0.00 tyr: 0.00 leu: 0.00 gpi: 0.00 myr: 0.00
dna: 0.00 rib: 0.00 bac: 0.00 m1a: 0.00 m1b: 0.00 m2 : 0.00 mNt: 0.00
m3a: 0.00 m3b: 0.00 m_ : 1.00

40.0 %: nuclear
36.0 %: cytoplasmic
8.0 %: cytoskeletal
8.0 %: mitochondrial
4.0 %: vesicles of secretory system
4.0 %: endoplasmic reticulum

>> prediction for Contig-U14269-1 is nuc

VS (DIR, S) 1
VH (FL, L) 0
VF (FL, S) 0
AH (FL, L) 0
AF (FL, S) 0
SL (DIR, L) 0
SS (DIR, S) 1
SH (FL, L) 0
SF (FL, S) 0
CH (FL, L) 1
CF (FL, S) 0
FCL (DIR, L) 0
FC (DIR, S) 0
FC-IC (SUB) 0