| Homology vs DNA |
 Query= Contig-U02523-1 (Contig-U02523-1Q) /CSM_Contig/Contig-U02523-1Q.Seq.d
(1247 letters)
Database: ddbj_A
102,105,510 sequences; 101,790,757,118 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value N
(BJ358898) Dictyostelium discoideum cDNA clone:ddc11i20, 5' ... 1104 0.0 3
(BJ429583) Dictyostelium discoideum cDNA clone:ddv4e03, 3' e... 839 0.0 2
(BJ341654) Dictyostelium discoideum cDNA clone:dda7i15, 3' e... 559 0.0 3
(BJ374118) Dictyostelium discoideum cDNA clone:ddc6g14, 3' e... 519 0.0 2
(BJ324711) Dictyostelium discoideum cDNA clone:dda7i15, 5' e... 769 0.0 3
(BJ372251) Dictyostelium discoideum cDNA clone:ddc11i20, 3' ... 519 0.0 2
(CZ532858) SRAA-aac81c08.b1 Strongyloides ratti whole genome... 48 3e-07 2
(AC078859) Homo sapiens 3 BAC RP11-588N12 (Roswell Park Canc... 36 0.009 2
(EW966638) HDLice3rdlarv_01_A05_T3 Headlice composite librar... 40 0.011 2
(AE002144) Ureaplasma parvum serovar 3 str. ATCC 700970 sect... 36 0.11 3
(AC116977) Dictyostelium discoideum chromosome 2 map 5515173... 40 0.12 11
(FE472460) CAOS3995.fwd CAOS Selaginella moellendorffii mixe... 34 0.16 2
(GD178393) EST04602 Watermelon fruit normalization and subtr... 50 0.21 1
(EJ643566) 1093012125502 Global-Ocean-Sampling_GS-29-01-01-1... 34 0.59 3
(FE246985) CAPG9710.fwd CAPG Naegleria gruberi amoeba stage ... 34 0.65 3
(AL596024) Zebrafish DNA sequence from clone BUSM1-199M19 in... 48 0.82 1
(AM480950) Vitis vinifera, whole genome shotgun sequence, co... 48 0.82 1
(EK325308) 1095467004903 Global-Ocean-Sampling_GS-31-01-01-1... 48 0.82 1
(ED769206) GM_WBb0143G19.f GM_WBb Glycine max genomic clone ... 48 0.82 1
(CP000095) Prochlorococcus marinus str. NATL2A, complete gen... 48 0.82 1
(AF211148) Carsonella ruddii natural-host Russelliana interm... 38 1.1 2
(AC122361) Mus musculus chromosome UNK clone RP23-430A10, WO... 36 1.3 6
(AL137080) Arabidopsis thaliana DNA chromosome 3, BAC clone ... 38 1.3 4
(BX323878) Zebrafish DNA sequence from clone CH211-57E23 in ... 34 1.7 2
(BX000473) Zebrafish DNA sequence from clone CH211-141O9. 34 1.7 2
(CT573171) Zebrafish DNA sequence *** SEQUENCING CANCELLED *... 34 1.7 2
(CU524186) Zebrafish DNA sequence from clone CH1073-374F22 i... 34 1.8 2
(AC188783) Glycine max clone gmp1-118c24, WORKING DRAFT SEQU... 36 2.0 4
(AY193544) Lactuca sativa clone TDM resistance protein RGC2 ... 36 2.0 2
(EI763096) CHORI510R314P02TF BAC library from the primary ov... 36 2.3 2
(DB583718) Halocynthia roretzi cDNA clone:ma317p02, 5' end. 40 2.7 2
(AV382673) Halocynthia roretzi cDNA clone:002D09_5, 5' end, ... 40 3.2 2
(CR556712) Zebrafish DNA sequence from clone DKEY-28E7 in li... 46 3.3 1
(BX640469) Zebrafish DNA sequence from clone DKEY-104M9 in l... 46 3.3 1
(AC096885) Danio rerio clone 136L4, complete sequence. 46 3.3 1
(AC101830) Mus musculus chromosome 1, clone RP24-480B20, com... 46 3.3 1
(AC099628) Mus musculus chromosome 1, clone RP24-82L18, comp... 46 3.3 1
(X97348) P.trichocarpa mRNA for anionic peroxidase Pxp11. 46 3.3 1
(AM116872) Sieversia pentapetala gbss1-2 pseudogene, clone 5-1. 46 3.3 1
(AM116871) Geum urbanum gbss1-2 pseudogene, clone 2-3. 46 3.3 1
(AM116869) Fallugia paradoxa partial gbss1-2 gene for granul... 46 3.3 1
(AF500476) Waldsteinia geoides clone 1 granule-bound starch ... 46 3.3 1
(AC148615) Ictalurus punctatus clone CH212-99A22, WORKING DR... 46 3.3 1
(AC202310) Medicago truncatula clone mth2-124f24, WORKING DR... 46 3.3 1
(ED640656) GM_WBa0051E13.f GM_WBa Glycine max genomic clone ... 46 3.3 1
(DU736888) APKI3981.g2 HF70_10-07-02 uncultured marine micro... 46 3.3 1
(EH472896) FDR103-P00043-DEPE-R_H20 FDR103 Danio rerio cDNA ... 46 3.3 1
(EB765554) 1960112 AG03 Danio rerio cDNA clone 764823, mRNA ... 46 3.3 1
(DY671866) STRBG72JX cold-stressed Fragaria vesca seedlings ... 46 3.3 1
(DY671507) STRCB10JX cold-stressed Fragaria vesca seedlings ... 46 3.3 1
(DY671376) STRC759JX cold-stressed Fragaria vesca seedlings ... 46 3.3 1
(DY667150) STRB645JX cold-stressed Fragaria vesca seedlings ... 46 3.3 1
(DV440504) davisf2008B06 Fragaria vesca 'Yellow Wonder' flow... 46 3.3 1
(CX737721) 797857 MARC 6BOV Bos taurus cDNA 3', mRNA sequence. 46 3.3 1
(CB535729) 769963 MARC 6BOV Bos taurus cDNA 3', mRNA sequence. 46 3.3 1
(CP000806) Cyanothece sp. ATCC 51142 circular chromosome, co... 46 3.3 1
(AP008983) Clostridium phage c-st genomic DNA, complete genome. 38 3.7 8
(AX392737) Sequence 27 from Patent WO0212526. 36 4.5 5
(AR707084) Sequence 27 from patent US 6933145. 36 4.5 5
(AL409786) T7 end of clone XAV0AA002A03 of library XAV0AA fr... 44 4.7 2
(AL845500) Mouse DNA sequence from clone RP23-221K3 on chrom... 36 4.9 6
(CP001184) Ureaplasma urealyticum serovar 10 str. ATCC 33699... 32 5.4 2
(AF222894) Ureaplasma parvum serovar 3 str. ATCC 700970, com... 32 5.5 2
(CP000942) Ureaplasma parvum serovar 3 str. ATCC 27815, comp... 32 5.5 2
(AC117072) Dictyostelium discoideum chromosome 2 map 3879572... 32 5.7 9
(AC005922) Homo sapiens chromosome 17, clone hRPK.235_I_10, ... 38 5.9 7
(AC107863) Mus musculus chromosome 3, clone RP23-383E14, com... 38 6.1 9
(CL354405) RPCI44_406D19.r RPCI-44 Sus scrofa genomic clone ... 34 6.5 2
(AE002135) Ureaplasma parvum serovar 3 str. ATCC 700970 sect... 32 7.1 2
(EJ393195) 1092963979167 Global-Ocean-Sampling_GS-28-01-01-1... 32 8.1 2
(EJ221562) 1092351241998 Global-Ocean-Sampling_GS-27-01-01-1... 32 8.1 3
(FF723416) XABT39706.rev Gateway compatible cien cDNA librar... 36 9.0 2
(AC229701) Medicago truncatula clone mth2-9e15, WORKING DRAF... 32 9.6 7
(AX753218) Sequence 7 from Patent WO03037929. 40 9.8 2
>(BJ358898) Dictyostelium discoideum cDNA clone:ddc11i20, 5' end,
single read.
Length = 641
Score = 1104 bits (557), Expect(3) = 0.0
Identities = 557/557 (100%)
Strand = Plus / Plus
Query: 101 tggtgttgtaatggattattataataaaaagataatggcaccaatggttagagttggtac 160
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 85 tggtgttgtaatggattattataataaaaagataatggcaccaatggttagagttggtac 144
Query: 161 atatccaatgagaatattagcatataactatggttgtgatattgcatatagtgaagaatt 220
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 145 atatccaatgagaatattagcatataactatggttgtgatattgcatatagtgaagaatt 204
Query: 221 aattgatttaaaacttatgaaatcaactagagttgtaaatgaaaaattaaaaacaattga 280
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 205 aattgatttaaaacttatgaaatcaactagagttgtaaatgaaaaattaaaaacaattga 264
Query: 281 ttttattgcaaaagatcaaacattatgttatagaacatcagaaaaagatgttcgtaatgt 340
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 265 ttttattgcaaaagatcaaacattatgttatagaacatcagaaaaagatgttcgtaatgt 324
Query: 341 attacaattaggtacagcatcatcaatgacagcattggaagcagcaaaagttgtatgtaa 400
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 325 attacaattaggtacagcatcatcaatgacagcattggaagcagcaaaagttgtatgtaa 384
Query: 401 tgatatttgtgcattggatattaatatgggatgtccaaaattcttttcagttcaaggtgg 460
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 385 tgatatttgtgcattggatattaatatgggatgtccaaaattcttttcagttcaaggtgg 444
Query: 461 aatgggatcagcattattatcaaaaccagagacaattaaggatatattaacaacattgaa 520
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 445 aatgggatcagcattattatcaaaaccagagacaattaaggatatattaacaacattgaa 504
Query: 521 gagaaatttaaatggtattccaataacatgtaaaattagactactatcaaccgaccaaga 580
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 505 gagaaatttaaatggtattccaataacatgtaaaattagactactatcaaccgaccaaga 564
Query: 581 aactatcgacctattacgtataatcgaatccactggtgtcagtgcaatcggtgttcactg 640
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 565 aactatcgacctattacgtataatcgaatccactggtgtcagtgcaatcggtgttcactg 624
Query: 641 tcgtatgataccagaga 657
|||||||||||||||||
Sbjct: 625 tcgtatgataccagaga 641
Score = 40.1 bits (20), Expect(3) = 0.0
Identities = 20/20 (100%)
Strand = Plus / Plus
Query: 17 aataaagaaagaaatggaag 36
||||||||||||||||||||
Sbjct: 1 aataaagaaagaaatggaag 20
Score = 36.2 bits (18), Expect(3) = 0.0
Identities = 18/18 (100%)
Strand = Plus / Plus
Query: 69 gattggattgaatcctat 86
||||||||||||||||||
Sbjct: 53 gattggattgaatcctat 70
Lambda K H
1.37 0.711 1.31
Matrix: blastn matrix:1 -3
Number of Sequences: 102105510
Number of Hits to DB: 1,288,292,187
Number of extensions: 83759336
Number of successful extensions: 7392632
Number of sequences better than 10.0: 75
Length of query: 1247
Length of database: 101,790,757,118
Length adjustment: 24
Effective length of query: 1223
Effective length of database: 99,340,224,878
Effective search space: 121493095025794
Effective search space used: 121493095025794
X1: 11 (21.8 bits)
S2: 22 (44.1 bits)
|
| Homology vs Protein |
Query= Contig-U02523-1 (Contig-U02523-1Q) /CSM_Contig/Contig-U02523-1Q.Seq.d
(1247 letters)
Database: nrp_B
3,236,559 sequences; 1,051,180,864 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
GM963140_1(GM963140|pid:none) Sequence 10094 from Patent WO20081... 279 2e-73
GM960614_1(GM960614|pid:none) Sequence 7568 from Patent WO200814... 276 8e-73
GM960610_1(GM960610|pid:none) Sequence 7564 from Patent WO200814... 275 3e-72
BT036303_1(BT036303|pid:none) Zea mays full-length cDNA clone ZM... 274 4e-72
CP000583_186(CP000583|pid:none) Ostreococcus lucimarinus CCE9901... 258 3e-67
BC120342_1(BC120342|pid:none) Bos taurus dihydrouridine synthase... 256 1e-66
BC158728_1(BC158728|pid:none) Rattus norvegicus dihydrouridine s... 254 5e-66
AB173744_1(AB173744|pid:none) Macaca fascicularis brain cDNA clo... 253 1e-65
AE014298_2107(AE014298|pid:none) Drosophila melanogaster chromos... 241 5e-62
FN317488_1(FN317488|pid:none) Schistosoma japonicum isolate Anhu... 233 1e-59
FN357420_44(FN357420|pid:none) Schistosoma mansoni genome sequen... 226 2e-57
AL032643_5(AL032643|pid:none) Caenorhabditis elegans YAC Y54E5A,... 223 1e-56
AK296663_1(AK296663|pid:none) Homo sapiens cDNA FLJ52317 complet... 195 2e-48
AE016814_258(AE016814|pid:none) Ashbya gossypii (= Eremothecium ... 177 9e-43
GM960628_1(GM960628|pid:none) Sequence 7582 from Patent WO200814... 174 6e-42
CR382134_248(CR382134|pid:none) Debaryomyces hansenii strain CBS... 174 6e-42
CU928165_248(CU928165|pid:none) Kluyveromyces thermotolerans str... 171 4e-41
CU633438_795(CU633438|pid:none) Podospora anserina genomic DNA c... 170 1e-40
GM960634_1(GM960634|pid:none) Sequence 7588 from Patent WO200814... 169 1e-40
GM960636_1(GM960636|pid:none) Sequence 7590 from Patent WO200814... 169 1e-40
AE017345_297(AE017345|pid:none) Cryptococcus neoformans var. neo... 167 6e-40
AY812067_1(AY812067|pid:none) Schistosoma japonicum SJCHGC08364 ... 167 6e-40
AM270033_2(AM270033|pid:none) Aspergillus niger contig An02c0390... 165 3e-39
GM960622_1(GM960622|pid:none) Sequence 7576 from Patent WO200814... 164 6e-39
AE017345_296(AE017345|pid:none) Cryptococcus neoformans var. neo... 162 3e-38
CP000498_518(CP000498|pid:none) Pichia stipitis CBS 6054 chromos... 160 7e-38
GM960606_1(GM960606|pid:none) Sequence 7560 from Patent WO200814... 160 9e-38
AM989989_5(AM989989|pid:none) Zygosaccharomyces rouxii strain CB... 158 4e-37
AP007151_1230(AP007151|pid:none) Aspergillus oryzae RIB40 genomi... 156 1e-36
(O95620) RecName: Full=tRNA-dihydrouridine synthase 4-like; ... 134 9e-30
BX072538_5(BX072538|pid:none) Zebrafish DNA sequence from clone ... 134 9e-30
U62767_1(U62767|pid:none) Human PP35 mRNA, complete cds. 132 3e-29
BC152624_1(BC152624|pid:none) Danio rerio zgc:92033, mRNA (cDNA ... 129 2e-28
BC078413_1(BC078413|pid:none) Danio rerio zgc:92033, mRNA (cDNA ... 124 5e-27
CR761565_1(CR761565|pid:none) Xenopus tropicalis finished cDNA, ... 124 7e-27
BC080375_1(BC080375|pid:none) Xenopus tropicalis MGC79829 protei... 124 7e-27
BT079060_1(BT079060|pid:none) Esox lucius clone eluc-evq-525-151... 123 2e-26
BT080253_1(BT080253|pid:none) Caligus clemensi clone ccle-evs-50... 121 6e-26
CP000501_305(CP000501|pid:none) Pichia stipitis CBS 6054 chromos... 119 2e-25
CR382131_1064(CR382131|pid:none) Yarrowia lipolytica strain CLIB... 118 4e-25
(Q9HGN6) RecName: Full=tRNA-dihydrouridine synthase 1; ... 112 2e-23
FM992692_31(FM992692|pid:none) Candida dubliniensis CD36 chromos... 110 1e-22
CP000721_103(CP000721|pid:none) Clostridium beijerinckii NCIMB 8... 109 2e-22
CR382134_345(CR382134|pid:none) Debaryomyces hansenii strain CBS... 109 2e-22
(O74553) RecName: Full=tRNA-dihydrouridine synthase 4; ... 107 7e-22
CR382128_863(CR382128|pid:none) Yarrowia lipolytica strain CLIB1... 104 8e-21
FN392322_173(FN392322|pid:none) Pichia pastoris GS115 chromosome... 103 1e-20
CP000885_421(CP000885|pid:none) Clostridium phytofermentans ISDg... 103 1e-20
AE008384_1343(AE008384|pid:none) Methanosarcina mazei strain Goe... 103 1e-20
CP001390_1698(CP001390|pid:none) Geobacter sp. FRC-32, complete ... 103 2e-20
CP001348_2848(CP001348|pid:none) Clostridium cellulolyticum H10,... 103 2e-20
CP001098_67(CP001098|pid:none) Halothermothrix orenii H 168, com... 102 2e-20
BT077769_1(BT077769|pid:none) Lepeophtheirus salmonis Pacific fo... 102 3e-20
BA000016_2467(BA000016|pid:none) Clostridium perfringens str. 13... 102 4e-20
CU928168_622(CU928168|pid:none) Kluyveromyces thermotolerans str... 102 4e-20
CP000607_334(CP000607|pid:none) Chlorobium phaeovibrioides DSM 2... 101 5e-20
AE010299_35(AE010299|pid:none) Methanosarcina acetivorans str. C... 101 6e-20
AL590447_160(AL590447|pid:none) chromosome VII of strain GB-M1 o... 100 8e-20
FN357881_13(FN357881|pid:none) Schistosoma mansoni genome sequen... 100 1e-19
CT005272_48(CT005272|pid:none) Leishmania major strain Friedlin,... 100 1e-19
CR937011_6(CR937011|pid:none) uncultured archaeon fos0625e3. 100 2e-19
CT573071_1650(CT573071|pid:none) Kuenenia stuttgartiensis genome... 99 3e-19
AM180355_3646(AM180355|pid:none) Clostridium difficile 630 compl... 99 3e-19
AP009049_144(AP009049|pid:none) Clostridium kluyveri NBRC 12016 ... 99 3e-19
CP001056_157(CP001056|pid:none) Clostridium botulinum B str. Ekl... 98 5e-19
CP000568_2642(CP000568|pid:none) Clostridium thermocellum ATCC 2... 98 5e-19
CP001124_2778(CP001124|pid:none) Geobacter bemidjiensis Bem, com... 98 5e-19
AE001437_3148(AE001437|pid:none) Clostridium acetobutylicum ATCC... 98 5e-19
CP001107_55(CP001107|pid:none) Eubacterium rectale ATCC 33656, c... 98 7e-19
AP008212_2037(AP008212|pid:none) Oryza sativa (japonica cultivar... 97 9e-19
CP000159_2459(CP000159|pid:none) Salinibacter ruber DSM 13855, c... 97 9e-19
AP004329_20(AP004329|pid:none) Oryza sativa Japonica Group genom... 97 9e-19
CP000961_1769(CP000961|pid:none) Shewanella woodyi ATCC 51908, c... 97 2e-18
CP000923_266(CP000923|pid:none) Thermoanaerobacter sp. X514, com... 97 2e-18
CP000728_3507(CP000728|pid:none) Clostridium botulinum F str. La... 97 2e-18
BC076792_1(BC076792|pid:none) Xenopus laevis MGC83715 protein, m... 96 2e-18
CU928168_759(CU928168|pid:none) Kluyveromyces thermotolerans str... 96 3e-18
(A3LUK5) RecName: Full=tRNA-dihydrouridine synthase 3; ... 96 3e-18
CP001101_2100(CP001101|pid:none) Chlorobium phaeobacteroides BS1... 96 3e-18
AM494972_56(AM494972|pid:none) Leishmania braziliensis chromosom... 96 3e-18
CU928174_539(CU928174|pid:none) Zygosaccharomyces rouxii strain ... 95 5e-18
AM412317_3528(AM412317|pid:none) Clostridium botulinum A str. AT... 95 5e-18
AE017341_228(AE017341|pid:none) Cryptococcus neoformans var. neo... 95 6e-18
CP000300_2000(CP000300|pid:none) Methanococcoides burtonii DSM 6... 95 6e-18
CP000252_728(CP000252|pid:none) Syntrophus aciditrophicus SB, co... 94 8e-18
CP001103_3907(CP001103|pid:none) Alteromonas macleodii 'Deep eco... 94 1e-17
(Q09504) RecName: Full=Uncharacterized tRNA-dihydrouridine synth... 94 1e-17
CP000361_440(CP000361|pid:none) Arcobacter butzleri RM4018, comp... 94 1e-17
T21830(T21830) hypothetical protein F36A2.2 - Caenorhabditis ele... 94 1e-17
AE017180_998(AE017180|pid:none) Geobacter sulfurreducens PCA, co... 93 2e-17
AE016818_421(AE016818|pid:none) Ashbya gossypii (= Eremothecium ... 93 2e-17
BC072076_1(BC072076|pid:none) Xenopus laevis hypothetical protei... 93 2e-17
(P41504) RecName: Full=Probable tRNA-dihydrouridine synthase; ... 93 2e-17
BC108777_1(BC108777|pid:none) Xenopus laevis hypothetical protei... 93 2e-17
CP000724_4356(CP000724|pid:none) Alkaliphilus metalliredigens QY... 93 2e-17
CR382136_271(CR382136|pid:none) Debaryomyces hansenii strain CBS... 92 3e-17
CP001327_550(CP001327|pid:none) Micromonas sp. RCC299 chromosome... 92 4e-17
(Q7XT07) RecName: Full=tRNA-dihydrouridine synthase 3-like; ... 92 5e-17
AE006470_1903(AE006470|pid:none) Chlorobium tepidum TLS, complet... 91 7e-17
AM920436_2220(AM920436|pid:none) Penicillium chrysogenum Wiscons... 91 9e-17
CR382122_121(CR382122|pid:none) Kluyveromyces lactis strain NRRL... 91 1e-16
FN392322_172(FN392322|pid:none) Pichia pastoris GS115 chromosome... 90 1e-16
CU928174_624(CU928174|pid:none) Zygosaccharomyces rouxii strain ... 90 1e-16
BX897685_7(BX897685|pid:none) Zebrafish DNA sequence from clone ... 90 1e-16
AM236080_2260(AM236080|pid:none) Rhizobium leguminosarum bv. vic... 90 1e-16
AE014134_3130(AE014134|pid:none) Drosophila melanogaster chromos... 90 2e-16
CR380959_432(CR380959|pid:none) Candida glabrata strain CBS138 c... 90 2e-16
CP000627_2590(CP000627|pid:none) Vibrio cholerae O395 chromosome... 89 3e-16
CP001074_2007(CP001074|pid:none) Rhizobium etli CIAT 652, comple... 89 3e-16
AE003852_287(AE003852|pid:none) Vibrio cholerae O1 biovar eltor ... 89 3e-16
(Q9KV66) RecName: Full=tRNA-dihydrouridine synthase B; ... 89 3e-16
CP001089_2762(CP001089|pid:none) Geobacter lovleyi SZ, complete ... 89 3e-16
AK297195_1(AK297195|pid:none) Homo sapiens cDNA FLJ59220 complet... 89 3e-16
CP001034_112(CP001034|pid:none) Natranaerobius thermophilus JW/N... 89 3e-16
CP001087_892(CP001087|pid:none) Desulfobacterium autotrophicum H... 89 3e-16
CP001191_1604(CP001191|pid:none) Rhizobium leguminosarum bv. tri... 89 4e-16
CP000821_2853(CP000821|pid:none) Shewanella sediminis HAW-EB3, c... 89 4e-16
CP000285_2272(CP000285|pid:none) Chromohalobacter salexigens DSM... 89 4e-16
AD2754(AD2754) nitrogen regulation protein nifR [imported] - Agr... 88 6e-16
AL663090_6(AL663090|pid:none) Mouse DNA sequence from clone RP23... 88 6e-16
CP001110_2363(CP001110|pid:none) Pelodictyon phaeoclathratiforme... 88 6e-16
(A7TQ73) RecName: Full=tRNA-dihydrouridine synthase 3; ... 88 6e-16
AP009510_306(AP009510|pid:none) Uncultured Termite group 1 bacte... 88 7e-16
AE017321_458(AE017321|pid:none) Wolbachia endosymbiont strain TR... 88 7e-16
CP000628_1694(CP000628|pid:none) Agrobacterium radiobacter K84 c... 88 7e-16
CP000606_2235(CP000606|pid:none) Shewanella loihica PV-4, comple... 88 7e-16
CP000510_3031(CP000510|pid:none) Psychromonas ingrahamii 37, com... 88 7e-16
CP000716_361(CP000716|pid:none) Thermosipho melanesiensis BI429,... 87 1e-15
CP001154_2052(CP001154|pid:none) Laribacter hongkongensis HLHK9,... 87 1e-15
CP000746_638(CP000746|pid:none) Actinobacillus succinogenes 130Z... 87 1e-15
CP000492_2203(CP000492|pid:none) Chlorobium phaeobacteroides DSM... 87 1e-15
(Q8K582) RecName: Full=tRNA-dihydrouridine synthase 1-like; ... 87 1e-15
CP000267_2973(CP000267|pid:none) Rhodoferax ferrireducens T118, ... 87 1e-15
BT053883_1(BT053883|pid:none) Zea mays full-length cDNA clone ZM... 87 1e-15
CP001339_356(CP001339|pid:none) Thioalkalivibrio sp. HL-EbGR7, c... 87 1e-15
AP009178_1194(AP009178|pid:none) Nitratiruptor sp. SB155-2 genom... 87 1e-15
CP001614_2707(CP001614|pid:none) Teredinibacter turnerae T7901, ... 87 1e-15
FM954972_2778(FM954972|pid:none) Vibrio splendidus LGP32 chromos... 87 2e-15
CP000096_272(CP000096|pid:none) Pelodictyon luteolum DSM 273, co... 87 2e-15
CP000633_1556(CP000633|pid:none) Agrobacterium vitis S4 chromoso... 87 2e-15
(Q6P1R4) RecName: Full=tRNA-dihydrouridine synthase 1-like; ... 87 2e-15
S52263(S52263) probable nitrogen fixation regulatory protein-3 h... 87 2e-15
AM269980_89(AM269980|pid:none) Aspergillus niger contig An01c033... 87 2e-15
(Q9UTH9) RecName: Full=tRNA-dihydrouridine synthase 3; ... 86 2e-15
AE017340_2276(AE017340|pid:none) Idiomarina loihiensis L2TR, com... 86 2e-15
AE016825_2329(AE016825|pid:none) Chromobacterium violaceum ATCC ... 86 2e-15
CP000738_1079(CP000738|pid:none) Sinorhizobium medicae WSM419, c... 86 3e-15
(A7A1S5) RecName: Full=tRNA-dihydrouridine synthase 3; ... 86 3e-15
CP000513_397(CP000513|pid:none) Dichelobacter nodosus VCS1703A, ... 86 3e-15
S55957(S55957;S54006) hypothetical protein YLR401c - yeast (Sacc... 86 3e-15
(Q6FJ14) RecName: Full=tRNA-dihydrouridine synthase 3; ... 86 4e-15
CP000155_5740(CP000155|pid:none) Hahella chejuensis KCTC 2396, c... 86 4e-15
AE017263_29(AE017263|pid:none) Mesoplasma florum L1 complete gen... 86 4e-15
AP009484_1898(AP009484|pid:none) Macrococcus caseolyticus JCSC54... 86 4e-15
CP000472_409(CP000472|pid:none) Shewanella piezotolerans WP3, co... 86 4e-15
AP009152_1644(AP009152|pid:none) Kocuria rhizophila DC2201 DNA, ... 85 5e-15
CP000821_4109(CP000821|pid:none) Shewanella sediminis HAW-EB3, c... 85 5e-15
CP000930_1266(CP000930|pid:none) Heliobacterium modesticaldum Ic... 85 5e-15
CP000282_1302(CP000282|pid:none) Saccharophagus degradans 2-40, ... 85 6e-15
CP000931_3865(CP000931|pid:none) Shewanella halifaxensis HAW-EB4... 84 8e-15
CP000563_3872(CP000563|pid:none) Shewanella baltica OS155, compl... 84 8e-15
AE014134_3259(AE014134|pid:none) Drosophila melanogaster chromos... 84 8e-15
(Q6BS64) RecName: Full=tRNA-dihydrouridine synthase 3; ... 84 8e-15
CP000316_3367(CP000316|pid:none) Polaromonas sp. JS666, complete... 84 8e-15
CP000503_494(CP000503|pid:none) Shewanella sp. W3-18-1, complete... 84 1e-14
AP006840_3155(AP006840|pid:none) Symbiobacterium thermophilum IA... 84 1e-14
CP000444_3599(CP000444|pid:none) Shewanella sp. MR-7, complete g... 84 1e-14
FM178379_2837(FM178379|pid:none) Aliivibrio salmonicida LFI1238 ... 84 1e-14
CP000107_309(CP000107|pid:none) Ehrlichia canis str. Jake, compl... 84 1e-14
AE017341_401(AE017341|pid:none) Cryptococcus neoformans var. neo... 84 1e-14
CU468135_273(CU468135|pid:none) Erwinia tasmaniensis strain ET1/... 84 1e-14
CP001634_2072(CP001634|pid:none) Kosmotoga olearia TBF 19.5.1, c... 84 1e-14
CP000436_572(CP000436|pid:none) Haemophilus somnus 129PT, comple... 84 1e-14
CP001616_2497(CP001616|pid:none) Tolumonas auensis DSM 9187, com... 84 1e-14
CU458896_746(CU458896|pid:none) Mycobacterium abscessus chromoso... 84 1e-14
CP000783_3551(CP000783|pid:none) Enterobacter sakazakii ATCC BAA... 84 1e-14
AC091527_14(AC091527|pid:none) Trypanosoma brucei chromosome 7 c... 84 1e-14
CP000814_114(CP000814|pid:none) Campylobacter jejuni subsp. jeju... 84 1e-14
CP000020_2409(CP000020|pid:none) Vibrio fischeri ES114 chromosom... 84 1e-14
AE014295_115(AE014295|pid:none) Bifidobacterium longum NCC2705, ... 83 2e-14
CP000964_440(CP000964|pid:none) Klebsiella pneumoniae 342, compl... 83 2e-14
CP001323_551(CP001323|pid:none) Micromonas sp. RCC299 chromosome... 83 2e-14
CP000482_3031(CP000482|pid:none) Pelobacter propionicus DSM 2379... 83 2e-14
CP000323_2300(CP000323|pid:none) Psychrobacter cryohalolentis K5... 83 2e-14
AM999887_552(AM999887|pid:none) Wolbachia endosymbiont of Culex ... 83 2e-14
AE017196_23(AE017196|pid:none) Wolbachia endosymbiont of Drosoph... 83 2e-14
CP000879_1480(CP000879|pid:none) Petrotoga mobilis SJ95, complet... 83 2e-14
CP000699_243(CP000699|pid:none) Sphingomonas wittichii RW1, comp... 83 2e-14
CP001391_22(CP001391|pid:none) Wolbachia sp. wRi, complete genome. 83 2e-14
AP009179_1320(AP009179|pid:none) Sulfurovum sp. NBC37-1 genomic ... 83 2e-14
CR378674_20(CR378674|pid:none) Photobacterium profundum SS9; seg... 83 2e-14
AP008955_180(AP008955|pid:none) Brevibacillus brevis NBRC 100599... 83 2e-14
CP000931_1573(CP000931|pid:none) Shewanella halifaxensis HAW-EB4... 83 2e-14
CP000592_292(CP000592|pid:none) Ostreococcus lucimarinus CCE9901... 82 3e-14
CP000896_1325(CP000896|pid:none) Acholeplasma laidlawii PG-8A, c... 82 3e-14
CP000768_109(CP000768|pid:none) Campylobacter jejuni subsp. doyl... 82 3e-14
CP001185_736(CP001185|pid:none) Thermosipho africanus TCF52B, co... 82 4e-14
CP000749_3584(CP000749|pid:none) Marinomonas sp. MWYL1, complete... 82 4e-14
AM778931_65(AM778931|pid:none) Microcystis aeruginosa PCC 7806 g... 82 4e-14
(O52533) RecName: Full=tRNA-dihydrouridine synthase B; ... 82 4e-14
CP000947_1574(CP000947|pid:none) Haemophilus somnus 2336, comple... 82 4e-14
CR767821_345(CR767821|pid:none) Ehrlichia ruminantium strain Wel... 82 4e-14
CP000822_4543(CP000822|pid:none) Citrobacter koseri ATCC BAA-895... 82 5e-14
AY458646_13(AY458646|pid:none) Uncultured marine bacterium 578 c... 82 5e-14
CP000478_1794(CP000478|pid:none) Syntrophobacter fumaroxidans MP... 82 5e-14
AM502252_106(AM502252|pid:none) Leishmania infantum chromosome 34. 82 5e-14
BA000035_2457(BA000035|pid:none) Corynebacterium efficiens YS-31... 82 5e-14
CP000236_721(CP000236|pid:none) Ehrlichia chaffeensis str. Arkan... 82 5e-14
CP001322_3183(CP001322|pid:none) Desulfatibacillum alkenivorans ... 82 5e-14
(Q8ZAX7) RecName: Full=tRNA-dihydrouridine synthase B; ... 81 7e-14
CP001013_2117(CP001013|pid:none) Leptothrix cholodnii SP-6, comp... 81 7e-14
AC159445_17(AC159445|pid:none) Trypanosoma brucei chromosome 8 c... 81 7e-14
CP000025_113(CP000025|pid:none) Campylobacter jejuni RM1221, com... 81 7e-14
CP001052_1802(CP001052|pid:none) Burkholderia phytofirmans PsJN ... 81 7e-14
AE016827_532(AE016827|pid:none) Mannheimia succiniciproducens MB... 81 7e-14
CP001131_3815(CP001131|pid:none) Anaeromyxobacter sp. K, complet... 81 7e-14
(Q9CLW3) RecName: Full=tRNA-dihydrouridine synthase B; ... 81 7e-14
CP000082_2004(CP000082|pid:none) Psychrobacter arcticus 273-4, c... 81 7e-14
AE009952_211(AE009952|pid:none) Yersinia pestis KIM, complete ge... 81 7e-14
CP000388_269(CP000388|pid:none) Pseudoalteromonas atlantica T6c,... 81 9e-14
AM039952_868(AM039952|pid:none) Xanthomonas campestris pv. vesic... 81 9e-14
AD1103(AD1103) conserved hypothetical protein lmo0227 [imported]... 80 1e-13
CP000875_1456(CP000875|pid:none) Herpetosiphon aurantiacus ATCC ... 80 1e-13
BX842646_123(BX842646|pid:none) Bdellovibrio bacteriovorus compl... 80 1e-13
CP001157_3313(CP001157|pid:none) Azotobacter vinelandii DJ, comp... 80 1e-13
CP000282_806(CP000282|pid:none) Saccharophagus degradans 2-40, c... 80 1e-13
CP000767_1491(CP000767|pid:none) Campylobacter curvus 525.92, co... 80 1e-13
(Q1E2F4) RecName: Full=tRNA-dihydrouridine synthase 3; ... 80 1e-13
CP000777_10(CP000777|pid:none) Leptospira biflexa serovar Patoc ... 80 1e-13
CP000697_2003(CP000697|pid:none) Acidiphilium cryptum JF-5, comp... 80 1e-13
CP000744_5497(CP000744|pid:none) Pseudomonas aeruginosa PA7, com... 80 1e-13
CU914168_1219(CU914168|pid:none) Ralstonia solanacearum strain I... 80 1e-13
BT045865_1(BT045865|pid:none) Salmo salar clone ssal-rgf-535-051... 80 1e-13
CP001359_3895(CP001359|pid:none) Anaeromyxobacter dehalogenans 2... 80 1e-13
CP001175_2383(CP001175|pid:none) Listeria monocytogenes HCC23, c... 80 1e-13
(Q83PZ5) RecName: Full=tRNA-dihydrouridine synthase B; ... 80 1e-13
(Q8PCH1) RecName: Full=tRNA-dihydrouridine synthase B; ... 80 2e-13
CP000230_1671(CP000230|pid:none) Rhodospirillum rubrum ATCC 1117... 80 2e-13
CP000447_453(CP000447|pid:none) Shewanella frigidimarina NCIMB 4... 80 2e-13
CP000588_91(CP000588|pid:none) Ostreococcus lucimarinus CCE9901 ... 80 2e-13
AE009951_1268(AE009951|pid:none) Fusobacterium nucleatum subsp. ... 80 2e-13
CR940347_907(CR940347|pid:none) Theileria annulata strain Ankara... 80 2e-13
BX248359_205(BX248359|pid:none) Corynebacterium diphtheriae grav... 80 2e-13
CR628337_2786(CR628337|pid:none) Legionella pneumophila str. Len... 80 2e-13
CP000140_3099(CP000140|pid:none) Parabacteroides distasonis ATCC... 80 2e-13
BC017081_1(BC017081|pid:none) Homo sapiens dihydrouridine syntha... 80 2e-13
CP000679_550(CP000679|pid:none) Caldicellulosiruptor saccharolyt... 80 2e-13
CU468230_2555(CU468230|pid:none) Acinetobacter baumannii str. SD... 80 2e-13
CP000569_189(CP000569|pid:none) Actinobacillus pleuropneumoniae ... 80 2e-13
CP000863_749(CP000863|pid:none) Acinetobacter baumannii ACICU, c... 80 2e-13
CR628336_2924(CR628336|pid:none) Legionella pneumophila str. Par... 80 2e-13
(P44965) RecName: Full=tRNA-dihydrouridine synthase B; ... 80 2e-13
CP000853_439(CP000853|pid:none) Alkaliphilus oremlandii OhILAs, ... 80 2e-13
CP000771_360(CP000771|pid:none) Fervidobacterium nodosum Rt17-B1... 79 3e-13
CP001281_1946(CP001281|pid:none) Thauera sp. MZ1T, complete geno... 79 3e-13
AM285302_17(AM285302|pid:none) Spiroplasma citri GII3-3X chromos... 79 3e-13
CP001336_159(CP001336|pid:none) Desulfitobacterium hafniense DCB... 79 3e-13
CP000769_3868(CP000769|pid:none) Anaeromyxobacter sp. Fw109-5, c... 79 3e-13
CP001620_385(CP001620|pid:none) Corynebacterium kroppenstedtii D... 79 3e-13
CP000141_2294(CP000141|pid:none) Carboxydothermus hydrogenoforma... 79 3e-13
CP000117_643(CP000117|pid:none) Anabaena variabilis ATCC 29413, ... 79 3e-13
AP008230_217(AP008230|pid:none) Desulfitobacterium hafniense Y51... 79 3e-13
CP000089_2857(CP000089|pid:none) Dechloromonas aromatica RCB, co... 79 3e-13
CP000462_3402(CP000462|pid:none) Aeromonas hydrophila subsp. hyd... 79 3e-13
AE013598_3703(AE013598|pid:none) Xanthomonas oryzae pv. oryzae K... 79 3e-13
CP000521_824(CP000521|pid:none) Acinetobacter baumannii ATCC 179... 79 3e-13
X62399_1(X62399|pid:none) E.coli orf1 (cotranscribed with fis pr... 79 3e-13
CP000240_1590(CP000240|pid:none) Synechococcus sp. JA-2-3B'a(2-1... 79 3e-13
AE000512_96(AE000512|pid:none) Thermotoga maritima MSB8, complet... 79 3e-13
CR522870_2602(CR522870|pid:none) Desulfotalea psychrophila LSv54... 79 3e-13
(A4RLF4) RecName: Full=tRNA-dihydrouridine synthase 3; ... 79 4e-13
CP001068_1880(CP001068|pid:none) Ralstonia pickettii 12J chromos... 79 4e-13
CP000860_126(CP000860|pid:none) Candidatus Desulforudis audaxvia... 79 4e-13
CP000653_3666(CP000653|pid:none) Enterobacter sp. 638, complete ... 79 4e-13
CP000448_107(CP000448|pid:none) Syntrophomonas wolfei subsp. wol... 79 4e-13
(Q5BF62) RecName: Full=tRNA-dihydrouridine synthase 3; ... 79 4e-13
CP000560_81(CP000560|pid:none) Bacillus amyloliquefaciens FZB42,... 79 4e-13
AP009256_1137(AP009256|pid:none) Bifidobacterium adolescentis AT... 79 4e-13
AP008971_989(AP008971|pid:none) Finegoldia magna ATCC 29328 DNA,... 78 6e-13
CP000285_687(CP000285|pid:none) Chromohalobacter salexigens DSM ... 78 6e-13
CP000656_1653(CP000656|pid:none) Mycobacterium gilvum PYR-GCK, c... 78 6e-13
CP001087_1080(CP001087|pid:none) Desulfobacterium autotrophicum ... 78 6e-13
CP000675_3031(CP000675|pid:none) Legionella pneumophila str. Cor... 78 6e-13
CP000680_2707(CP000680|pid:none) Pseudomonas mendocina ymp, comp... 78 6e-13
AL935253_148(AL935253|pid:none) Lactobacillus plantarum strain W... 78 6e-13
CR522870_2400(CR522870|pid:none) Desulfotalea psychrophila LSv54... 78 6e-13
CP000672_1396(CP000672|pid:none) Haemophilus influenzae PittGG, ... 78 8e-13
AP009552_1655(AP009552|pid:none) Microcystis aeruginosa NIES-843... 78 8e-13
CP000851_1497(CP000851|pid:none) Shewanella pealeana ATCC 700345... 78 8e-13
CP000381_896(CP000381|pid:none) Neisseria meningitidis 053442, c... 77 1e-12
(Q50049) RecName: Full=Probable tRNA-dihydrouridine synthase; ... 77 1e-12
AP011115_4950(AP011115|pid:none) Rhodococcus opacus B4 DNA, comp... 77 1e-12
AE017354_2800(AE017354|pid:none) Legionella pneumophila subsp. p... 77 1e-12
CP001037_3564(CP001037|pid:none) Nostoc punctiforme PCC 73102, c... 77 1e-12
CP000057_1015(CP000057|pid:none) Haemophilus influenzae 86-028NP... 77 1e-12
(Q9JZL5) RecName: Full=tRNA-dihydrouridine synthase C; ... 77 1e-12
AM421808_931(AM421808|pid:none) Neisseria meningitidis serogroup... 77 1e-12
(Q28BT8) RecName: Full=tRNA-dihydrouridine synthase 3-like; ... 77 1e-12
AF125451_6(AF125451|pid:none) Caenorhabditis elegans cosmid Y37E... 77 1e-12
CP001154_3188(CP001154|pid:none) Laribacter hongkongensis HLHK9,... 77 1e-12
CP000854_4790(CP000854|pid:none) Mycobacterium marinum M, comple... 77 1e-12
CP001111_637(CP001111|pid:none) Stenotrophomonas maltophilia R55... 77 1e-12
AE010300_7(AE010300|pid:none) Leptospira interrogans serovar lai... 77 1e-12
AL939112_242(AL939112|pid:none) Streptomyces coelicolor A3(2) co... 77 1e-12
CR954246_1156(CR954246|pid:none) Pseudoalteromonas haloplanktis ... 77 1e-12
CP001287_2274(CP001287|pid:none) Cyanothece sp. PCC 8801, comple... 77 1e-12
CR931997_383(CR931997|pid:none) Corynebacterium jeikeium K411 co... 77 1e-12
(A6RMI1) RecName: Full=tRNA-dihydrouridine synthase 3; ... 77 2e-12
AP006618_612(AP006618|pid:none) Nocardia farcinica IFM 10152 DNA... 77 2e-12
CP000251_3778(CP000251|pid:none) Anaeromyxobacter dehalogenans 2... 77 2e-12
A83662(A83662) transcription regulator involved in nitrogen regu... 77 2e-12
CP000304_3200(CP000304|pid:none) Pseudomonas stutzeri A1501, com... 77 2e-12
CP000830_1569(CP000830|pid:none) Dinoroseobacter shibae DFL 12, ... 77 2e-12
CP001055_1452(CP001055|pid:none) Elusimicrobium minutum Pei191, ... 77 2e-12
AM743169_745(AM743169|pid:none) Stenotrophomonas maltophilia K27... 76 2e-12
AF434658_14(AF434658|pid:none) Leptospira interrogans putative p... 76 2e-12
CP000644_740(CP000644|pid:none) Aeromonas salmonicida subsp. sal... 76 2e-12
AE002098_1359(AE002098|pid:none) Neisseria meningitidis MC58, co... 76 2e-12
AM408590_878(AM408590|pid:none) Mycobacterium bovis BCG Pasteur ... 76 2e-12
CP000655_1865(CP000655|pid:none) Polynucleobacter necessarius su... 76 2e-12
CP000826_4407(CP000826|pid:none) Serratia proteamaculans 568, co... 76 2e-12
CP001213_798(CP001213|pid:none) Bifidobacterium animalis subsp. ... 76 2e-12
CP000462_2150(CP000462|pid:none) Aeromonas hydrophila subsp. hyd... 76 2e-12
CP000325_371(CP000325|pid:none) Mycobacterium ulcerans Agy99, co... 76 2e-12
AP008937_223(AP008937|pid:none) Lactobacillus fermentum IFO 3956... 76 2e-12
CP001186_71(CP001186|pid:none) Bacillus cereus G9842, complete g... 76 3e-12
(Q9AMN9) RecName: Full=tRNA-dihydrouridine synthase C; ... 76 3e-12
CP000680_703(CP000680|pid:none) Pseudomonas mendocina ymp, compl... 76 3e-12
CP000030_335(CP000030|pid:none) Anaplasma marginale str. St. Mar... 76 3e-12
(O52532) RecName: Full=tRNA-dihydrouridine synthase B; ... 76 3e-12
AJ278969_1(AJ278969|pid:none) Ruminococcus flavefaciens cellulos... 76 3e-12
AL157959_1440(AL157959|pid:none) Neisseria meningitidis serogrou... 76 3e-12
CP000480_5580(CP000480|pid:none) Mycobacterium smegmatis str. MC... 76 3e-12
BX908798_1987(BX908798|pid:none) Parachlamydia-related symbiont ... 75 4e-12
(Q0U9D6) RecName: Full=tRNA-dihydrouridine synthase 3; ... 75 4e-12
AE017223_1042(AE017223|pid:none) Brucella abortus biovar 1 str. ... 75 4e-12
(Q4UNJ4) RecName: Full=Probable tRNA-dihydrouridine synthase; ... 75 4e-12
CT005271_118(CT005271|pid:none) Leishmania major strain Friedlin... 75 4e-12
CP000384_4494(CP000384|pid:none) Mycobacterium sp. MCS, complete... 75 4e-12
AE017282_1644(AE017282|pid:none) Methylococcus capsulatus str. B... 75 4e-12
CP000471_3626(CP000471|pid:none) Magnetococcus sp. MC-1, complet... 75 4e-12
AB3360(AB3360) nitrogen regulation protein nifR3 [imported] - Br... 75 4e-12
CP001010_1325(CP001010|pid:none) Polynucleobacter necessarius su... 75 4e-12
BX908798_1579(BX908798|pid:none) Parachlamydia-related symbiont ... 75 4e-12
AE014133_169(AE014133|pid:none) Streptococcus mutans UA159, comp... 75 4e-12
BC126846_1(BC126846|pid:none) Bos taurus dihydrouridine synthase... 75 4e-12
CP000474_1426(CP000474|pid:none) Arthrobacter aurescens TC1, com... 75 5e-12
CP000813_649(CP000813|pid:none) Bacillus pumilus SAFR-032, compl... 75 5e-12
CP000777_571(CP000777|pid:none) Leptospira biflexa serovar Patoc... 75 5e-12
BC008362_1(BC008362|pid:none) Homo sapiens dihydrouridine syntha... 75 5e-12
CR555306_606(CR555306|pid:none) Azoarcus sp. EbN1 complete genome. 75 5e-12
FP236842_277(FP236842|pid:none) Erwinia pyrifoliae strain Ep1/96... 75 5e-12
AJ749949_519(AJ749949|pid:none) Francisella tularensis subsp. tu... 75 5e-12
AE016830_247(AE016830|pid:none) Enterococcus faecalis V583, comp... 75 5e-12
CP000915_927(CP000915|pid:none) Francisella tularensis subsp. me... 75 5e-12
BC009973_1(BC009973|pid:none) Homo sapiens dihydrouridine syntha... 75 5e-12
BC004549_1(BC004549|pid:none) Homo sapiens dihydrouridine syntha... 75 5e-12
(Q96G46) RecName: Full=tRNA-dihydrouridine synthase 3-like; ... 75 5e-12
CP000686_834(CP000686|pid:none) Roseiflexus sp. RS-1, complete g... 75 5e-12
AE000513_2390(AE000513|pid:none) Deinococcus radiodurans R1 chro... 75 6e-12
BA000043_73(BA000043|pid:none) Geobacillus kaustophilus HTA426 D... 75 6e-12
AM406671_2167(AM406671|pid:none) Lactococcus lactis subsp. cremo... 75 6e-12
CP000232_145(CP000232|pid:none) Moorella thermoacetica ATCC 3907... 75 6e-12
CP001281_1401(CP001281|pid:none) Thauera sp. MZ1T, complete geno... 75 6e-12
CP000151_597(CP000151|pid:none) Burkholderia sp. 383 chromosome ... 75 6e-12
CP000447_2396(CP000447|pid:none) Shewanella frigidimarina NCIMB ... 74 8e-12
(Q7SG01) RecName: Full=tRNA-dihydrouridine synthase 3; ... 74 8e-12
AM502235_38(AM502235|pid:none) Leishmania infantum chromosome 17. 74 8e-12
CP001600_3379(CP001600|pid:none) Edwardsiella ictaluri 93-146, c... 74 8e-12
CP000781_4363(CP000781|pid:none) Xanthobacter autotrophicus Py2,... 74 8e-12
AE015928_3072(AE015928|pid:none) Bacteroides thetaiotaomicron VP... 74 8e-12
CP000378_207(CP000378|pid:none) Burkholderia cenocepacia AU 1054... 74 8e-12
CU633438_481(CU633438|pid:none) Podospora anserina genomic DNA c... 74 8e-12
CP000095_424(CP000095|pid:none) Prochlorococcus marinus str. NAT... 74 8e-12
AM286690_2162(AM286690|pid:none) Alcanivorax borkumensis SK2, co... 74 8e-12
CP000572_3349(CP000572|pid:none) Burkholderia pseudomallei 1106a... 74 1e-11
CP000075_4403(CP000075|pid:none) Pseudomonas syringae pv. syring... 74 1e-11
CP000949_4584(CP000949|pid:none) Pseudomonas putida W619, comple... 74 1e-11
CP000248_1917(CP000248|pid:none) Novosphingobium aromaticivorans... 74 1e-11
(Q88DK5) RecName: Full=tRNA-dihydrouridine synthase B; ... 74 1e-11
CP000512_1228(CP000512|pid:none) Acidovorax citrulli AAC00-1, co... 74 1e-11
(Q87VS1) RecName: Full=tRNA-dihydrouridine synthase B; ... 74 1e-11
AM233362_974(AM233362|pid:none) Francisella tularensis subsp. ho... 74 1e-11
AE016825_544(AE016825|pid:none) Chromobacterium violaceum ATCC 1... 74 1e-11
CP001279_47(CP001279|pid:none) Nautilia profundicola AmH, comple... 74 1e-11
CP000859_2859(CP000859|pid:none) Desulfococcus oleovorans Hxd3, ... 74 1e-11
CP001197_2628(CP001197|pid:none) Desulfovibrio vulgaris str. 'Mi... 74 1e-11
CP001392_2490(CP001392|pid:none) Diaphorobacter sp. TPSY, comple... 74 1e-11
CP000789_2825(CP000789|pid:none) Vibrio harveyi ATCC BAA-1116 ch... 74 1e-11
CP000644_1940(CP000644|pid:none) Aeromonas salmonicida subsp. sa... 74 1e-11
BX294152_40(BX294152|pid:none) Rhodopirellula baltica SH 1 compl... 73 2e-11
CP000116_2456(CP000116|pid:none) Thiobacillus denitrificans ATCC... 73 2e-11
CP001503_566(CP001503|pid:none) Burkholderia glumae BGR1 chromos... 73 2e-11
AM711867_1603(AM711867|pid:none) Clavibacter michiganensis subsp... 73 2e-11
(Q4WRX4) RecName: Full=tRNA-dihydrouridine synthase 3; ... 73 2e-11
CU466930_759(CU466930|pid:none) Candidatus Cloacamonas acidamino... 73 2e-11
CP000926_4841(CP000926|pid:none) Pseudomonas putida GB-1, comple... 73 2e-11
CP000553_442(CP000553|pid:none) Prochlorococcus marinus str. NAT... 73 2e-11
CP000348_10(CP000348|pid:none) Leptospira borgpetersenii serovar... 73 2e-11
(Q8XYX1) RecName: Full=tRNA-dihydrouridine synthase C; ... 73 2e-11
(Q6C4K3) RecName: Full=tRNA-dihydrouridine synthase 3; ... 73 2e-11
CP000270_3775(CP000270|pid:none) Burkholderia xenovorans LB400 c... 73 2e-11
(Q884C6) RecName: Full=tRNA-dihydrouridine synthase C; ... 73 2e-11
CP000454_1329(CP000454|pid:none) Arthrobacter sp. FB24, complete... 73 2e-11
BA000030_5656(BA000030|pid:none) Streptomyces avermitilis MA-468... 73 2e-11
CP000323_1075(CP000323|pid:none) Psychrobacter cryohalolentis K5... 73 2e-11
CP000058_4251(CP000058|pid:none) Pseudomonas syringae pv. phaseo... 73 2e-11
AJ235270_10(AJ235270|pid:none) Rickettsia prowazekii strain Madr... 72 3e-11
AE016830_2994(AE016830|pid:none) Enterococcus faecalis V583, com... 72 3e-11
AE017355_69(AE017355|pid:none) Bacillus thuringiensis serovar ko... 72 3e-11
AM849034_1540(AM849034|pid:none) Clavibacter michiganensis subsp... 72 3e-11
CP000235_527(CP000235|pid:none) Anaplasma phagocytophilum HZ, co... 72 3e-11
CP001283_72(CP001283|pid:none) Bacillus cereus AH820, complete g... 72 3e-11
AE017194_74(AE017194|pid:none) Bacillus cereus ATCC 10987, compl... 72 3e-11
AE006914_11(AE006914|pid:none) Rickettsia conorii str. Malish 7,... 72 3e-11
AF176314_6(AF176314|pid:none) Zymomonas mobilis fosmid clone 42B... 72 3e-11
AE016795_1144(AE016795|pid:none) Vibrio vulnificus CMCP6 chromos... 72 3e-11
CP000485_69(CP000485|pid:none) Bacillus thuringiensis str. Al Ha... 72 3e-11
AE008692_1127(AE008692|pid:none) Zymomonas mobilis subsp. mobili... 72 3e-11
(Q92JQ6) RecName: Full=Probable tRNA-dihydrouridine synthase; ... 72 3e-11
CP000058_1860(CP000058|pid:none) Pseudomonas syringae pv. phaseo... 72 3e-11
(P45672) RecName: Full=Probable tRNA-dihydrouridine synthase; ... 72 3e-11
(Q9ZED2) RecName: Full=Probable tRNA-dihydrouridine synthase; ... 72 3e-11
CP000614_642(CP000614|pid:none) Burkholderia vietnamiensis G4 ch... 72 3e-11
AY775011_1(AY775011|pid:none) Synthetic construct Francisella tu... 72 3e-11
CP000909_205(CP000909|pid:none) Chloroflexus aurantiacus J-10-fl... 72 3e-11
CP000976_707(CP000976|pid:none) Borrelia duttonii Ly, complete g... 72 4e-11
CP000685_1069(CP000685|pid:none) Flavobacterium johnsoniae UW101... 72 4e-11
AM181176_596(AM181176|pid:none) Pseudomonas fluorescens SBW25 co... 72 4e-11
(A1D1U0) RecName: Full=tRNA-dihydrouridine synthase 3; ... 72 4e-11
CP000993_696(CP000993|pid:none) Borrelia recurrentis A1, complet... 72 4e-11
CP000848_16(CP000848|pid:none) Rickettsia rickettsii str. 'Sheil... 72 4e-11
CP000302_2371(CP000302|pid:none) Shewanella denitrificans OS217,... 72 4e-11
CP000766_18(CP000766|pid:none) Rickettsia rickettsii str. Iowa, ... 72 4e-11
CP000510_2149(CP000510|pid:none) Psychromonas ingrahamii 37, com... 72 4e-11
AP008981_924(AP008981|pid:none) Orientia tsutsugamushi str. Iked... 72 5e-11
CP000521_2747(CP000521|pid:none) Acinetobacter baumannii ATCC 17... 72 5e-11
CP000237_359(CP000237|pid:none) Neorickettsia sennetsu strain Mi... 72 5e-11
CP000911_1109(CP000911|pid:none) Brucella suis ATCC 23445 chromo... 72 5e-11
CP000872_1080(CP000872|pid:none) Brucella canis ATCC 23365 chrom... 72 5e-11
AE001363_748(AE001363|pid:none) Chlamydophila pneumoniae CWL029,... 72 5e-11
CP001052_3277(CP001052|pid:none) Burkholderia phytofirmans PsJN ... 72 5e-11
CP000511_5006(CP000511|pid:none) Mycobacterium vanbaalenii PYR-1... 72 5e-11
CP001615_973(CP001615|pid:none) Exiguobacterium sp. AT1b, comple... 72 5e-11
AE014291_1086(AE014291|pid:none) Brucella suis 1330 chromosome I... 72 5e-11
CP000503_1683(CP000503|pid:none) Shewanella sp. W3-18-1, complet... 72 5e-11
CR936503_1596(CR936503|pid:none) Lactobacillus sakei strain 23K ... 71 7e-11
(Q5HKD5) RecName: Full=Probable tRNA-dihydrouridine synthase; ... 71 7e-11
CP001068_373(CP001068|pid:none) Ralstonia pickettii 12J chromoso... 71 7e-11
AY658832_1(AY658832|pid:none) Synthetic construct Peudomonas aer... 71 7e-11
CT573326_4516(CT573326|pid:none) Pseudomonas entomophila str. L4... 71 7e-11
CP000903_71(CP000903|pid:none) Bacillus weihenstephanensis KBAB4... 71 7e-11
AL935253_58(AL935253|pid:none) Lactobacillus plantarum strain WC... 71 7e-11
CP000951_926(CP000951|pid:none) Synechococcus sp. PCC 7002, comp... 71 7e-11
CP001227_117(CP001227|pid:none) Rickettsia peacockii str. Rustic... 71 7e-11
CP000934_2681(CP000934|pid:none) Cellvibrio japonicus Ueda107, c... 71 7e-11
CP000438_1889(CP000438|pid:none) Pseudomonas aeruginosa UCBPP-PA... 71 7e-11
AM889285_2267(AM889285|pid:none) Gluconacetobacter diazotrophicu... 71 9e-11
CP000758_2054(CP000758|pid:none) Ochrobactrum anthropi ATCC 4918... 71 9e-11
AE016879_72(AE016879|pid:none) Bacillus anthracis str. Ames, com... 71 9e-11
CP001189_481(CP001189|pid:none) Gluconacetobacter diazotrophicus... 71 9e-11
AP006861_24(AP006861|pid:none) Chlamydophila felis Fe/C-56 DNA, ... 71 9e-11
AP006716_1228(AP006716|pid:none) Staphylococcus haemolyticus JCS... 71 9e-11
CR954210_173(CR954210|pid:none) Ostreococcus tauri strain OTTH05... 71 9e-11
CP000750_3337(CP000750|pid:none) Kineococcus radiotolerans SRS30... 71 9e-11
CP000850_3666(CP000850|pid:none) Salinispora arenicola CNS-205, ... 71 9e-11
CP000560_764(CP000560|pid:none) Bacillus amyloliquefaciens FZB42... 71 9e-11
CP001050_203(CP001050|pid:none) Neisseria gonorrhoeae NCCP11945,... 71 9e-11
CP000949_1543(CP000949|pid:none) Pseudomonas putida W619, comple... 71 9e-11
(Q68XZ3) RecName: Full=Probable tRNA-dihydrouridine synthase; ... 71 9e-11
CP000009_450(CP000009|pid:none) Gluconobacter oxydans 621H, comp... 70 1e-10
AP009153_1740(AP009153|pid:none) Gemmatimonas aurantiaca T-27 DN... 70 1e-10
AE009948_1779(AE009948|pid:none) Streptococcus agalactiae 2603V/... 70 1e-10
CP000414_672(CP000414|pid:none) Leuconostoc mesenteroides subsp.... 70 1e-10
CP000509_1902(CP000509|pid:none) Nocardioides sp. JS614, complet... 70 1e-10
CP000094_615(CP000094|pid:none) Pseudomonas fluorescens Pf0-1, c... 70 1e-10
BX572601_135(BX572601|pid:none) Rhodopseudomonas palustris CGA00... 70 1e-10
CP000886_4097(CP000886|pid:none) Salmonella enterica subsp. ente... 70 1e-10
CP000725_1921(CP000725|pid:none) Streptococcus gordonii str. Cha... 70 2e-10
CP000922_72(CP000922|pid:none) Anoxybacillus flavithermus WK1, c... 70 2e-10
AP009380_16(AP009380|pid:none) Porphyromonas gingivalis ATCC 332... 70 2e-10
(Q91XI1) RecName: Full=tRNA-dihydrouridine synthase 3-like; ... 70 2e-10
(Q2UL89) RecName: Full=tRNA-dihydrouridine synthase 3; ... 70 2e-10
BT080404_1(BT080404|pid:none) Caligus clemensi clone ccle-evs-51... 70 2e-10
CP000647_3637(CP000647|pid:none) Klebsiella pneumoniae subsp. pn... 70 2e-10
CP001635_4574(CP001635|pid:none) Variovorax paradoxus S110 chrom... 70 2e-10
CP000360_30(CP000360|pid:none) Acidobacteria bacterium Ellin345,... 70 2e-10
CU459003_2097(CU459003|pid:none) Magnetospirillum gryphiswaldens... 70 2e-10
(Q3KRC5) RecName: Full=tRNA-dihydrouridine synthase 3-like; ... 70 2e-10
CP000753_2584(CP000753|pid:none) Shewanella baltica OS185, compl... 70 2e-10
BX640421_151(BX640421|pid:none) Bordetella pertussis strain Toha... 69 3e-10
CP000013_725(CP000013|pid:none) Borrelia garinii PBi, complete g... 69 3e-10
FM209186_1931(FM209186|pid:none) Pseudomonas aeruginosa LESB58 c... 69 3e-10
AE009952_2970(AE009952|pid:none) Yersinia pestis KIM, complete g... 69 3e-10
AE015924_19(AE015924|pid:none) Porphyromonas gingivalis W83, com... 69 3e-10
CP000112_3082(CP000112|pid:none) Desulfovibrio desulfuricans G20... 69 4e-10
CP000826_1331(CP000826|pid:none) Serratia proteamaculans 568, co... 69 4e-10
CP000713_943(CP000713|pid:none) Psychrobacter sp. PRwf-1, comple... 69 4e-10
AP007281_259(AP007281|pid:none) Lactobacillus reuteri JCM 1112 D... 69 5e-10
CP000031_2046(CP000031|pid:none) Ruegeria pomeroyi DSS-3, comple... 69 5e-10
>GM963140_1(GM963140|pid:none) Sequence 10094 from Patent
WO2008142034.
Length = 320
Score = 279 bits (713), Expect = 2e-73
Identities = 148/316 (46%), Positives = 204/316 (64%), Gaps = 3/316 (0%)
Frame = +3
Query: 111 MDYYNKKIMAPMVRVGTYPMRILAYNYGCDIAYSEELIDLKLMKSTRVVNEKLKTIDFIA 290
MDY NK ++APMVR GT P R+LA YG DI Y EE+ID K + RV NE L T DF+
Sbjct: 1 MDYRNKLVLAPMVRAGTLPFRLLAAEYGADITYGEEIIDHKFVHCQRVTNESLGTTDFLE 60
Query: 291 KD-QTLCYRT--SEKDVRNVLQLGTASSMTALEAAKVVCNDICALDINMGCPKFFSVQGG 461
+ ++ +RT E+D R V Q+GT+ ++ AL+AA++VCND+ A+DINMGCPK FSV GG
Sbjct: 61 RGTDSVVFRTCPQERD-RVVFQMGTSDAVRALKAAEIVCNDVAAIDINMGCPKAFSVSGG 119
Query: 462 MGSALLSKPETIKDILTTLKRNLNGIPITCKIRLLSTDQETIDLLRIIESTGVSAIGVHC 641
MGSALLSKPE I DILTTL+RNLN P+TCKIRLL+T Q+T++L R IE GV A+ VH
Sbjct: 120 MGSALLSKPELIHDILTTLRRNLN-TPVTCKIRLLNTRQDTVELARRIEKCGVPALAVHG 178
Query: 642 RMIPERPRDPAHWDRLENILSNASFSVPIIANGDIFEHADIEKIKKQTKVDSIMIARGVV 821
R + +RPRDPA WD + +++S + S+P+IANGD+FE+ D ++IK T S+M ARG +
Sbjct: 179 RKVKDRPRDPAKWDEIADVVS--ALSIPVIANGDVFEYEDFKRIKDATGATSVMAARGAL 236
Query: 822 KNVSIFSKPSPIDLKQIIQEYTEIAYQTNNSPVNTKYVINSMLNENNITTNKEAKAMSSA 1001
N SIFS + + +EY +N +TK + ++ E K +
Sbjct: 237 WNASIFSPNGKVPWEDFKREYVRKTILWDNCIKSTKTTLREIIMHYICLELPEGKGVIKC 296
Query: 1002 RDYDTITKIWGINDKF 1049
+ +++G D +
Sbjct: 297 GSSADVARLYGEEDYY 312
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3236559
Number of Hits to DB: 1,588,463,607
Number of extensions: 30565386
Number of successful extensions: 89308
Number of sequences better than 10.0: 890
Number of HSP's gapped: 87980
Number of HSP's successfully gapped: 903
Length of query: 415
Length of database: 1,051,180,864
Length adjustment: 131
Effective length of query: 284
Effective length of database: 627,191,635
Effective search space: 178122424340
Effective search space used: 178122424340
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 32 (16.9 bits)
|