| Contig-U14188-1 |
| Contig ID |
Contig-U14188-1 |
| Contig update |
2002.12.18 |
| Contig sequence |
 |
| Gap |
no gap |
| Contig length |
2091 |
| Chromosome number (1..6, M) |
3 |
| Chromosome length |
6358359 |
| Start point |
191663 |
| End point |
189588 |
| Strand (PLUS/MINUS) |
MINUS |
| Number of clones |
14 |
| Number of EST |
24 |
| Link to clone list |
U14188 |
| List of clone(s) |
|
| Translated Amino Acid sequence |
|
| Translated Amino Acid sequence (All Frames) |
|
| own update |
2004. 6.10 |
| Homology vs CSM-cDNA |
|
| dna update |
2008.12.19 |
| Homology vs DNA |
Query= Contig-U14188-1 (Contig-U14188-1Q) /CSM_Contig/Contig-U14188-1Q.Seq.d
(2091 letters)
Database: ddbj_A
92,845,959 sequences; 95,242,211,685 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value N
(BJ435714) Dictyostelium discoideum cDNA clone:ddv28b06, 3' ... 1425 0.0 2
(BJ441535) Dictyostelium discoideum cDNA clone:ddv47b05, 3' ... 1413 0.0 2
(BJ403011) Dictyostelium discoideum cDNA clone:dds18d02, 3' ... 1413 0.0 2
(BJ438032) Dictyostelium discoideum cDNA clone:ddv36k05, 3' ... 1378 0.0 2
(BJ438033) Dictyostelium discoideum cDNA clone:ddv36k06, 3' ... 1358 0.0 2
(BJ429586) Dictyostelium discoideum cDNA clone:ddv4f01, 3' e... 1348 0.0 1
(BJ434007) Dictyostelium discoideum cDNA clone:ddv23i15, 3' ... 1298 0.0 1
(BJ419448) Dictyostelium discoideum cDNA clone:ddv36k05, 5' ... 1259 0.0 1
(BJ440562) Dictyostelium discoideum cDNA clone:ddv44g06, 3' ... 1225 0.0 2
(BJ417558) Dictyostelium discoideum cDNA clone:ddv28b06, 5' ... 1219 0.0 1
(BJ419449) Dictyostelium discoideum cDNA clone:ddv36k06, 5' ... 1172 0.0 2
(BJ361150) Dictyostelium discoideum cDNA clone:ddc9k05, 5' e... 1162 0.0 1
(BJ430519) Dictyostelium discoideum cDNA clone:ddv7e14, 3' e... 1158 0.0 1
(BJ421860) Dictyostelium discoideum cDNA clone:ddv44g06, 5' ... 1156 0.0 2
(BJ422774) Dictyostelium discoideum cDNA clone:ddv47b05, 5' ... 1086 0.0 1
(BJ431865) Dictyostelium discoideum cDNA clone:ddv15i22, 3' ... 1029 0.0 1
(BJ412253) Dictyostelium discoideum cDNA clone:ddv7e14, 5' e... 1017 0.0 2
(BJ389232) Dictyostelium discoideum cDNA clone:dds18d02, 5' ... 844 0.0 2
(BJ438724) Dictyostelium discoideum cDNA clone:ddv38d10, 3' ... 1017 0.0 1
(BJ420114) Dictyostelium discoideum cDNA clone:ddv38d10, 5' ... 1009 0.0 1
(BJ415751) Dictyostelium discoideum cDNA clone:ddv23i15, 5' ... 890 0.0 2
(BJ417868) Dictyostelium discoideum cDNA clone:ddv15i22, 5' ... 749 0.0 2
(BJ437053) Dictyostelium discoideum cDNA clone:ddv33e04, 3' ... 844 0.0 1
(BJ374593) Dictyostelium discoideum cDNA clone:ddc9k05, 3' e... 765 0.0 1
(BJ445411) Dictyostelium discoideum cDNA clone:ddv59k08, 3' ... 704 0.0 1
(EJ894980) 1093018463201 Global-Ocean-Sampling_GS-30-02-01-1... 72 3e-17 2
(EJ780151) 1093017243845 Global-Ocean-Sampling_GS-30-02-01-1... 72 4e-17 2
(ER630316) 1093018418355 Global-Ocean-Sampling_GS-36-01-01-2... 72 4e-17 2
(EJ357986) 1092963673141 Global-Ocean-Sampling_GS-28-01-01-1... 44 1e-12 4
(FC770986) CBBN6171.fwd CBBN Lottia gigantea 3,4,5,6.5d Larv... 56 5e-06 3
(EK363106) 1095469322786 Global-Ocean-Sampling_GS-31-01-01-1... 52 2e-05 2
(ES391410) MUS11-H13.x1d-t SHGC-MUS Mytilus californianus cD... 54 2e-05 2
(ER528479) 1093015730567 Global-Ocean-Sampling_GS-35-01-01-1... 52 2e-05 2
(ER468802) 1092963941846 Global-Ocean-Sampling_GS-35-01-01-1... 44 0.003 2
(EJ301290) 1095390026874 Global-Ocean-Sampling_GS-27-01-01-1... 44 0.003 2
(ER575139) 1093015808675 Global-Ocean-Sampling_GS-36-01-01-2... 44 0.004 2
(EJ131129) 1092343528080 Global-Ocean-Sampling_GS-27-01-01-1... 44 0.004 2
(DY528849) BAAC-PNP1307J13.g2 C.remanei EST SB146 Caenorhabd... 56 0.006 1
(CJ376142) Molgula tectiformis cDNA, gastrula/neurula clone:... 56 0.006 1
(BJ394016) Dictyostelium discoideum cDNA clone:dds33a16, 5' ... 42 0.009 2
(AC116957) Dictyostelium discoideum chromosome 2 map 1685067... 42 0.033 16
(CJ481514) Macaca fascicularis mRNA, clone: QtrA-17205, 5' e... 52 0.087 1
(BJ362987) Dictyostelium discoideum cDNA clone:ddc24p08, 5' ... 44 0.12 2
(BJ388511) Dictyostelium discoideum cDNA clone:dds9m24, 5' e... 44 0.13 2
(BJ363421) Dictyostelium discoideum cDNA clone:ddc26f13, 5' ... 44 0.13 2
(BC159362) Xenopus tropicalis cDNA clone MGC:185873 IMAGE:75... 38 0.24 2
(CX493433) JGI_XZG39373.fwd NIH_XGC_tropGas7 Xenopus (Silura... 38 0.26 2
(CX515151) JGI_XZG45047.fwd NIH_XGC_tropGas7 Xenopus (Silura... 38 0.26 2
(CX801349) JGI_CAAJ14913.fwd NIH_XGC_tropBrn2 Xenopus (Silur... 38 0.26 2
(BJ388057) Dictyostelium discoideum cDNA clone:dds7m15, 5' e... 42 0.30 2
(BX037488) Single read from an extremity of a full-length cD... 50 0.34 1
(CN739543) SM_ASB434 Suidasia medanensis cDNA library Suidas... 50 0.34 1
(CJ485159) Macaca fascicularis mRNA, clone: QtsA-12732, 5' e... 50 0.34 1
(CJ483451) Macaca fascicularis mRNA, clone: QtsA-10935, 5' e... 50 0.34 1
(CJ456443) Macaca fascicularis mRNA, clone: QflA-22276, 5' e... 50 0.34 1
(CJ445237) Macaca fascicularis mRNA, clone: QflA-10370, 5' e... 50 0.34 1
(CJ445222) Macaca fascicularis mRNA, clone: QflA-10355, 5' e... 50 0.34 1
(EK516089) 1095515499653 Global-Ocean-Sampling_GS-32-01-01-1... 36 0.64 3
(EJ692564) 1092956008212 Global-Ocean-Sampling_GS-30-02-01-1... 44 0.68 2
(AC006279) Plasmodium falciparum chromosome 12 clone 3D7, **... 34 0.68 11
(EJ993617) 1093023069207 Global-Ocean-Sampling_GS-30-02-01-1... 38 0.70 2
(ET050414) CHO_OF5091xg06f1.ab1 CHO_OF5 Nicotiana tabacum ge... 38 0.76 3
(BJ363804) Dictyostelium discoideum cDNA clone:ddc28i13, 5' ... 34 0.83 3
(AC116984) Dictyostelium discoideum chromosome 2 map 2567470... 34 0.88 17
(AL365436) Human DNA sequence from clone RP11-74C1 on chromo... 40 0.88 4
(AG764396) Macaca fuscata fuscata DNA, clone: MSB2-235H05_R,... 34 0.96 2
(BJ362592) Dictyostelium discoideum cDNA clone:ddc22h14, 5' ... 40 1.1 2
(AC116551) Dictyostelium discoideum chromosome 2 map complem... 38 1.2 10
(AC115239) Rattus norvegicus clone CH230-153C6, *** SEQUENCI... 48 1.4 1
(AC105507) Rattus norvegicus clone CH230-239I22, *** SEQUENC... 48 1.4 1
(BX070438) Single read from an extremity of a full-length cD... 48 1.4 1
(BX062551) Single read from an extremity of a full-length cD... 48 1.4 1
(CE843991) tigr-gss-dog-17000332708242 Dog Library Canis lup... 48 1.4 1
(EC821355) SME00001431 esmbsro2 Sawyeria marylandensis cDNA,... 48 1.4 1
(DB609378) Halocynthia roretzi cDNA clone:mae18a21, 5' end. 48 1.4 1
(CJ492178) Macaca fascicularis mRNA, clone: QtsA-20145, 5' e... 48 1.4 1
(CJ491411) Macaca fascicularis mRNA, clone: QtsA-19344, 5' e... 48 1.4 1
(CJ472622) Macaca fascicularis mRNA, clone: QorA-12478, 5' e... 48 1.4 1
(CJ472022) Macaca fascicularis mRNA, clone: QorA-11761, 5' e... 48 1.4 1
(CJ471987) Macaca fascicularis mRNA, clone: QorA-11725, 5' e... 48 1.4 1
(CJ470622) Macaca fascicularis mRNA, clone: QorA-10156, 5' e... 48 1.4 1
(CJ466344) Macaca fascicularis mRNA, clone: QnpA-15702, 5' e... 48 1.4 1
(CJ449020) Macaca fascicularis mRNA, clone: QflA-14419, 5' e... 48 1.4 1
(CJ441059) Macaca fascicularis mRNA, clone: QccE-18514, 5' e... 48 1.4 1
(BJ418773) Dictyostelium discoideum cDNA clone:ddv33o20, 5' ... 48 1.4 1
(BJ416412) Dictyostelium discoideum cDNA clone:ddv26i10, 5' ... 48 1.4 1
(BJ411460) Dictyostelium discoideum cDNA clone:ddv4e13, 5' e... 48 1.4 1
(BJ363400) Dictyostelium discoideum cDNA clone:ddc26o08, 5' ... 48 1.4 1
(BJ327473) Dictyostelium discoideum cDNA clone:dda20g13, 5' ... 48 1.4 1
(BJ391984) Dictyostelium discoideum cDNA clone:dds25n21, 5' ... 38 1.8 2
(BJ394031) Dictyostelium discoideum cDNA clone:dds33d16, 5' ... 38 1.8 2
(BJ415587) Dictyostelium discoideum cDNA clone:ddv23e03, 5' ... 40 2.0 2
(CJ466666) Macaca fascicularis mRNA, clone: QnpA-16061, 5' e... 46 2.3 2
(CJ487050) Macaca fascicularis mRNA, clone: QtsA-14703, 5' e... 46 2.4 2
(CJ448325) Macaca fascicularis mRNA, clone: QflA-13692, 5' e... 46 2.4 2
(CJ482600) Macaca fascicularis mRNA, clone: QtrA-19027, 5' e... 44 2.4 2
(BD101202) Novel genes cloned in humanneuroblastoma and frag... 46 2.4 2
(BD021264) Novel gene and novel gene fragment cloned in huma... 46 2.4 2
(CJ492107) Macaca fascicularis mRNA, clone: QtsA-20070, 5' e... 46 2.4 2
(CJ449788) Macaca fascicularis mRNA, clone: QflA-15320, 5' e... 36 2.5 2
>(BJ435714) Dictyostelium discoideum cDNA clone:ddv28b06, 3' end,
single read.
Length = 754
Score = 1425 bits (719), Expect(2) = 0.0
Identities = 721/722 (99%)
Strand = Plus / Minus
Query: 1297 catacagtttagatcctggttcatttttagtacaattgtcagagtcaatctcagagttac 1356
||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 754 catacagtttagatcntggttcatttttagtacaattgtcagagtcaatctcagagttac 695
Query: 1357 catcatcagatagatctataatcgaattgaaatttagagattggattaatgaattgacaa 1416
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 694 catcatcagatagatctataatcgaattgaaatttagagattggattaatgaattgacaa 635
Query: 1417 atcttgatgtctctagaaatgttgatattgccaataaaatcaatattccaccatcaaaag 1476
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 634 atcttgatgtctctagaaatgttgatattgccaataaaatcaatattccaccatcaaaag 575
Query: 1477 agggtttcttaaatccattgaaagcattgcaaatgtttgatgaacaattaccacacaaaa 1536
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 574 agggtttcttaaatccattgaaagcattgcaaatgtttgatgaacaattaccacacaaaa 515
Query: 1537 ccattatggtggctgatggtggtgatttcgttggttctgcaagttatatcgttcgtccaa 1596
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 514 ccattatggtggctgatggtggtgatttcgttggttctgcaagttatatcgttcgtccaa 455
Query: 1597 gagcaccattatcttggttggatcctggtgtatttggtacattgggtgttggtgctggtt 1656
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 454 gagcaccattatcttggttggatcctggtgtatttggtacattgggtgttggtgctggtt 395
Query: 1657 tttcaattgctgccaaactttgtagacctgatcatcaagtttggacaatctatggtgatg 1716
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 394 tttcaattgctgccaaactttgtagacctgatcatcaagtttggacaatctatggtgatg 335
Query: 1717 gtgctttcggttatagtataccagagttggatacaatggtacgtcataaaatttcagttg 1776
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 334 gtgctttcggttatagtataccagagttggatacaatggtacgtcataaaatttcagttg 275
Query: 1777 gtgctatcattggtaatgattcaggttggattcaaatcttacgtgaacaacaagaacaat 1836
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 274 gtgctatcattggtaatgattcaggttggattcaaatcttacgtgaacaacaagaacaat 215
Query: 1837 taaatagtgatgttggttgtaatttagcttatactgattatcatcaagttgcaatagcat 1896
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 214 taaatagtgatgttggttgtaatttagcttatactgattatcatcaagttgcaatagcat 155
Query: 1897 ttggtggtaaaggttttaaatcaacaaatgaatctgaattaaaatttgctttagaagaat 1956
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 154 ttggtggtaaaggttttaaatcaacaaatgaatctgaattaaaatttgctttagaagaat 95
Query: 1957 caaataaaattttaaatcaaaatcaacaaccagttgttattaattgtataattgaacgta 2016
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 94 caaataaaattttaaatcaaaatcaacaaccagttgttattaattgtataattgaacgta 35
Query: 2017 at 2018
||
Sbjct: 34 at 33
Score = 30.2 bits (15), Expect(2) = 0.0
Identities = 15/15 (100%)
Strand = Plus / Minus
Query: 2031 ggttcaattaggctt 2045
|||||||||||||||
Sbjct: 20 ggttcaattaggctt 6
Lambda K H
1.37 0.711 1.31
Matrix: blastn matrix:1 -3
Number of Sequences: 92845959
Number of Hits to DB: 2,296,710,649
Number of extensions: 134335457
Number of successful extensions: 11137199
Number of sequences better than 10.0: 334
Length of query: 2091
Length of database: 95,242,211,685
Length adjustment: 24
Effective length of query: 2067
Effective length of database: 97,308,875,965
Effective search space: 201137446619655
Effective search space used: 201137446619655
X1: 11 (21.8 bits)
S2: 23 (46.1 bits)
|
| protein update |
2009. 7.10 |
| Homology vs Protein |
Query= Contig-U14188-1 (Contig-U14188-1Q) /CSM_Contig/Contig-U14188-1Q.Seq.d
(2091 letters)
Database: nrp_B
3,236,559 sequences; 1,051,180,864 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
CP000686_920(CP000686|pid:none) Roseiflexus sp. RS-1, complete g... 337 e-143
(Q6NV04) RecName: Full=Acetolactate synthase-like protein; ... 338 e-142
BC149989_1(BC149989|pid:none) Bos taurus ilvB (bacterial acetola... 338 e-140
BT020804_1(BT020804|pid:none) Bos taurus ilvB (bacterial acetola... 338 e-140
(A6QQT9) RecName: Full=Acetolactate synthase-like protein; ... 338 e-140
BC151580_1(BC151580|pid:none) Bos taurus ilvB (bacterial acetola... 338 e-140
BT045095_1(BT045095|pid:none) Salmo salar clone ssal-rgf-511-330... 335 e-140
(A1L0T0) RecName: Full=Acetolactate synthase-like protein; ... 336 e-138
BC011761_1(BC011761|pid:none) Homo sapiens ilvB (bacterial aceto... 334 e-137
U61263_1(U61263|pid:none) Human acetolactate synthase homolog mR... 336 e-137
(Q8BU33) RecName: Full=Acetolactate synthase-like protein; ... 324 e-135
CP000267_2433(CP000267|pid:none) Rhodoferax ferrireducens T118, ... 328 e-131
(Q6DDK5) RecName: Full=Acetolactate synthase-like protein; ... 293 e-130
CP000251_1012(CP000251|pid:none) Anaeromyxobacter dehalogenans 2... 310 e-130
(O61856) RecName: Full=Acetolactate synthase-like protein; ... 302 e-125
FN357298_54(FN357298|pid:none) Schistosoma mansoni genome sequen... 216 e-107
AC004794_3(AC004794|pid:none) Homo sapiens chromosome 19, cosmid... 316 2e-84
FN357298_55(FN357298|pid:none) Schistosoma mansoni genome sequen... 216 4e-71
AB209065_1(AB209065|pid:none) Homo sapiens mRNA for ilvB (bacter... 181 9e-70
BC057527_1(BC057527|pid:none) Danio rerio ilvB (bacterial acetol... 192 3e-63
AM746676_8141(AM746676|pid:none) Sorangium cellulosum 'So ce 56'... 190 2e-46
CP000384_2279(CP000384|pid:none) Mycobacterium sp. MCS, complete... 100 1e-41
CP001322_3429(CP001322|pid:none) Desulfatibacillum alkenivorans ... 99 1e-41
CP000686_1039(CP000686|pid:none) Roseiflexus sp. RS-1, complete ... 109 2e-40
CP000909_2039(CP000909|pid:none) Chloroflexus aurantiacus J-10-f... 114 2e-40
AM443174_1(AM443174|pid:none) Vitis vinifera contig VV78X055455.... 113 1e-39
CP001322_4137(CP001322|pid:none) Desulfatibacillum alkenivorans ... 96 1e-39
CP000088_551(CP000088|pid:none) Thermobifida fusca YX, complete ... 166 4e-39
BC000109_1(BC000109|pid:none) Homo sapiens ilvB (bacterial aceto... 157 1e-36
CP000353_738(CP000353|pid:none) Ralstonia metallidurans CH34 meg... 156 2e-36
AL939128_105(AL939128|pid:none) Streptomyces coelicolor A3(2) co... 153 3e-35
BA000030_1825(BA000030|pid:none) Streptomyces avermitilis MA-468... 152 6e-35
AE016827_1319(AE016827|pid:none) Mannheimia succiniciproducens M... 100 6e-35
(P09114) RecName: Full=Acetolactate synthase 2, chloroplastic; ... 95 1e-34
CP000479_2778(CP000479|pid:none) Mycobacterium avium 104, comple... 150 1e-34
(P09342) RecName: Full=Acetolactate synthase 1, chloroplastic; ... 95 1e-34
CP000850_1072(CP000850|pid:none) Salinispora arenicola CNS-205, ... 148 7e-34
CP000667_1192(CP000667|pid:none) Salinispora tropica CNB-440, co... 147 1e-33
EU517478_1(EU517478|pid:none) Bassia scoparia biotype SKCr-1 ace... 92 4e-33
EU517492_1(EU517492|pid:none) Bassia scoparia biotype AB5-5 acet... 94 6e-33
EU517469_1(EU517469|pid:none) Bassia scoparia biotype SK2-9 acet... 94 7e-33
EU517474_1(EU517474|pid:none) Bassia scoparia biotype AB4-1 acet... 93 1e-32
EU517468_1(EU517468|pid:none) Bassia scoparia biotype MB4-11 ace... 93 1e-32
EU517475_1(EU517475|pid:none) Bassia scoparia biotype SK4-12 ace... 93 1e-32
EU517485_1(EU517485|pid:none) Bassia scoparia biotype AB4-7 acet... 93 1e-32
EU517479_1(EU517479|pid:none) Bassia scoparia biotype AB4-12 ace... 93 1e-32
CS390343_1(CS390343|pid:none) Sequence 9 from Patent WO200602435... 91 1e-32
EU517481_1(EU517481|pid:none) Bassia scoparia biotype SKCr-2 ace... 93 1e-32
EU517495_1(EU517495|pid:none) Bassia scoparia biotype SKG2-3 ace... 92 1e-32
FB701060_1(FB701060|pid:none) Sequence 5 from Patent WO200700558... 91 1e-32
EU517487_1(EU517487|pid:none) Bassia scoparia biotype SK2-12 ace... 92 2e-32
EU517470_1(EU517470|pid:none) Bassia scoparia biotype MB4-7 acet... 92 2e-32
EU517489_1(EU517489|pid:none) Bassia scoparia biotype SKE2-3 ace... 92 2e-32
EU517466_1(EU517466|pid:none) Bassia scoparia biotype MB3-14 ace... 92 2e-32
EU517471_1(EU517471|pid:none) Bassia scoparia biotype SK6-2 acet... 92 2e-32
EU517484_1(EU517484|pid:none) Bassia scoparia biotype MB2-2 acet... 92 2e-32
AX700699_1(AX700699|pid:none) Sequence 3 from Patent WO03012115. 91 2e-32
AE000782_2075(AE000782|pid:none) Archaeoglobus fulgidus DSM 4304... 87 2e-32
AX700697_1(AX700697|pid:none) Sequence 1 from Patent WO03012115. 91 2e-32
EU517480_1(EU517480|pid:none) Bassia scoparia biotype SK6-8 acet... 92 2e-32
CP000568_2476(CP000568|pid:none) Clostridium thermocellum ATCC 2... 84 2e-32
(P66946) RecName: Full=Probable acetolactate synthase; ... 143 3e-32
CS390335_1(CS390335|pid:none) Sequence 1 from Patent WO2006024351. 89 4e-32
AE016958_1533(AE016958|pid:none) Mycobacterium avium subsp. para... 142 4e-32
EF157821_1(EF157821|pid:none) Amaranthus tuberculatus biotype IR... 94 5e-32
AF363370_1(AF363370|pid:none) Amaranthus powellii acetolactate s... 93 5e-32
AF363369_1(AF363369|pid:none) Amaranthus retroflexus acetolactat... 93 5e-32
CP000850_1095(CP000850|pid:none) Salinispora arenicola CNS-205, ... 90 6e-32
EF157819_1(EF157819|pid:none) Amaranthus tuberculatus biotype AC... 93 1e-31
CP000923_19(CP000923|pid:none) Thermoanaerobacter sp. X514, comp... 88 1e-31
CS390341_1(CS390341|pid:none) Sequence 7 from Patent WO2006024351. 89 1e-31
CR954247_450(CR954247|pid:none) Pseudoalteromonas haloplanktis s... 89 3e-31
CP000854_2669(CP000854|pid:none) Mycobacterium marinum M, comple... 139 3e-31
CP000325_2509(CP000325|pid:none) Mycobacterium ulcerans Agy99, c... 139 3e-31
EF656477_1(EF656477|pid:none) Solanum ptychanthum acetohydroxyac... 85 5e-31
AF308649_1(AF308649|pid:none) Solanum ptychanthum biotype imidaz... 85 5e-31
AF308648_1(AF308648|pid:none) Solanum ptychanthum biotype imidaz... 85 5e-31
EF656478_1(EF656478|pid:none) Solanum ptychanthum acetohydroxyac... 85 1e-30
AP009484_10(AP009484|pid:none) Macrococcus caseolyticus JCSC5402... 80 1e-30
CP000924_20(CP000924|pid:none) Thermoanaerobacter pseudethanolic... 87 2e-30
CP001339_2133(CP001339|pid:none) Thioalkalivibrio sp. HL-EbGR7, ... 98 2e-30
CP000272_289(CP000272|pid:none) Burkholderia xenovorans LB400 ch... 102 4e-30
AE005672_422(AE005672|pid:none) Streptococcus pneumoniae TIGR4, ... 79 1e-29
CP000936_513(CP000936|pid:none) Streptococcus pneumoniae Hungary... 79 1e-29
CP001108_724(CP001108|pid:none) Prosthecochloris aestuarii DSM 2... 91 5e-29
CP000725_520(CP000725|pid:none) Streptococcus gordonii str. Chal... 82 5e-29
CP000859_2031(CP000859|pid:none) Desulfococcus oleovorans Hxd3, ... 86 5e-29
AF129501_2(AF129501|pid:none) Buchnera aphidicola natural-host D... 99 1e-28
AM260525_1396(AM260525|pid:none) Bartonella tribocorum CIP 10547... 91 1e-28
AY714843_27(AY714843|pid:none) Uncultured archaeon GZfos26G2 clo... 83 2e-28
CP000387_1873(CP000387|pid:none) Streptococcus sanguinis SK36, c... 83 2e-28
CP000089_3046(CP000089|pid:none) Dechloromonas aromatica RCB, co... 91 3e-28
CP000927_3340(CP000927|pid:none) Caulobacter sp. K31, complete g... 86 4e-28
(Q9QXE0) RecName: Full=2-hydroxyacyl-CoA lyase 1; EC=4.... 127 1e-27
CP000556_533(CP000556|pid:none) Methylibium petroleiphilum PM1 p... 127 2e-27
AK299287_1(AK299287|pid:none) Homo sapiens cDNA FLJ55041 complet... 124 1e-26
BC077507_1(BC077507|pid:none) Xenopus laevis MGC82654 protein, m... 124 1e-26
(Q9UJ83) RecName: Full=2-hydroxyacyl-CoA lyase 1; EC=4.... 124 2e-26
AK301990_1(AK301990|pid:none) Homo sapiens cDNA FLJ54118 complet... 124 2e-26
AF161397_1(AF161397|pid:none) Homo sapiens HSPC279 mRNA, partial... 124 2e-26
AK301546_1(AK301546|pid:none) Homo sapiens cDNA FLJ53672 complet... 124 2e-26
CR848536_1(CR848536|pid:none) Xenopus tropicalis finished cDNA, ... 123 3e-26
AL954747_1326(AL954747|pid:none) Nitrosomonas europaea ATCC 1971... 92 7e-26
AB162349_4(AB162349|pid:none) Drosophila simulans genes, CG11099... 120 1e-25
CU234118_1621(CU234118|pid:none) Bradyrhizobium sp. ORS278,compl... 119 6e-25
CP000494_1913(CP000494|pid:none) Bradyrhizobium sp. BTAi1, compl... 118 7e-25
AK302086_1(AK302086|pid:none) Homo sapiens cDNA FLJ58815 complet... 118 7e-25
CP000804_2132(CP000804|pid:none) Roseiflexus castenholzii DSM 13... 117 1e-24
CP000859_1320(CP000859|pid:none) Desulfococcus oleovorans Hxd3, ... 117 2e-24
CP000325_3935(CP000325|pid:none) Mycobacterium ulcerans Agy99, c... 116 3e-24
CP000854_314(CP000854|pid:none) Mycobacterium marinum M, complet... 116 3e-24
EU971204_1(EU971204|pid:none) Zea mays clone 359425 2-hydroxyphy... 114 1e-23
AL391142_4(AL391142|pid:none) Arabidopsis thaliana DNA chromosom... 113 2e-23
AJ278629_1(AJ278629|pid:none) Arabidopsis thaliana mRNA for Oxal... 113 2e-23
AE016958_3523(AE016958|pid:none) Mycobacterium avium subsp. para... 113 3e-23
CP000099_427(CP000099|pid:none) Methanosarcina barkeri str. Fusa... 83 3e-23
AE008384_2841(AE008384|pid:none) Methanosarcina mazei strain Goe... 81 5e-23
(Q54DA9) RecName: Full=Probable 2-hydroxyacyl-CoA lyase 1; ... 110 2e-22
CP000473_7171(CP000473|pid:none) Solibacter usitatus Ellin6076, ... 110 2e-22
CP000480_150(CP000480|pid:none) Mycobacterium smegmatis str. MC2... 110 3e-22
CP000494_1188(CP000494|pid:none) Bradyrhizobium sp. BTAi1, compl... 72 6e-22
AP008207_1412(AP008207|pid:none) Oryza sativa (japonica cultivar... 108 6e-22
CP001322_4980(CP001322|pid:none) Desulfatibacillum alkenivorans ... 108 6e-22
AM902716_407(AM902716|pid:none) Bordetella petrii strain DSM 128... 107 1e-21
CP001029_1125(CP001029|pid:none) Methylobacterium populi BJ001, ... 107 2e-21
CP001349_4648(CP001349|pid:none) Methylobacterium nodulans ORS 2... 106 3e-21
AP006618_4248(AP006618|pid:none) Nocardia farcinica IFM 10152 DN... 106 3e-21
AJ248287_111(AJ248287|pid:none) Pyrococcus abyssi complete genom... 104 1e-20
BA000004_3061(BA000004|pid:none) Bacillus halodurans C-125 DNA, ... 104 1e-20
BA000040_3157(BA000040|pid:none) Bradyrhizobium japonicum USDA 1... 104 1e-20
CP000931_2369(CP000931|pid:none) Shewanella halifaxensis HAW-EB4... 104 1e-20
CP000908_1182(CP000908|pid:none) Methylobacterium extorquens PA1... 103 2e-20
AP009384_468(AP009384|pid:none) Azorhizobium caulinodans ORS 571... 103 2e-20
CP000473_178(CP000473|pid:none) Solibacter usitatus Ellin6076, c... 103 2e-20
CP000851_1904(CP000851|pid:none) Shewanella pealeana ATCC 700345... 103 2e-20
AK125241_1(AK125241|pid:none) Homo sapiens cDNA FLJ43251 fis, cl... 103 2e-20
CP001001_5503(CP001001|pid:none) Methylobacterium radiotolerans ... 103 3e-20
CU234118_4684(CU234118|pid:none) Bradyrhizobium sp. ORS278,compl... 103 3e-20
CP000606_1769(CP000606|pid:none) Shewanella loihica PV-4, comple... 103 3e-20
CR543861_2795(CR543861|pid:none) Acinetobacter sp. ADP1 complete... 102 4e-20
CP001196_2511(CP001196|pid:none) Oligotropha carboxidovorans OM5... 102 5e-20
(P40149) RecName: Full=Oxalyl-CoA decarboxylase; EC=4.1... 102 5e-20
AM711867_1111(AM711867|pid:none) Clavibacter michiganensis subsp... 102 5e-20
AE016958_1532(AE016958|pid:none) Mycobacterium avium subsp. para... 102 5e-20
AE016822_1048(AE016822|pid:none) Leifsonia xyli subsp. xyli str.... 102 7e-20
CP000323_521(CP000323|pid:none) Psychrobacter cryohalolentis K5,... 101 9e-20
CP000821_2660(CP000821|pid:none) Shewanella sediminis HAW-EB3, c... 101 9e-20
CP001182_613(CP001182|pid:none) Acinetobacter baumannii AB0057, ... 101 9e-20
CP000961_1938(CP000961|pid:none) Shewanella woodyi ATCC 51908, c... 101 9e-20
CP000854_1688(CP000854|pid:none) Mycobacterium marinum M, comple... 101 9e-20
CP000082_527(CP000082|pid:none) Psychrobacter arcticus 273-4, co... 101 9e-20
CP000155_5648(CP000155|pid:none) Hahella chejuensis KCTC 2396, c... 101 9e-20
CP000521_524(CP000521|pid:none) Acinetobacter baumannii ATCC 179... 101 9e-20
BX950851_731(BX950851|pid:none) Erwinia carotovora subsp. atrose... 101 9e-20
BX571871_128(BX571871|pid:none) Photorhabdus luminescens subsp. ... 101 1e-19
AE004439_870(AE004439|pid:none) Pasteurella multocida subsp. mul... 101 1e-19
CP000284_2115(CP000284|pid:none) Methylobacillus flagellatus KT,... 101 1e-19
CP001635_4435(CP001635|pid:none) Variovorax paradoxus S110 chrom... 101 1e-19
CP001348_3337(CP001348|pid:none) Clostridium cellulolyticum H10,... 101 1e-19
CP000033_379(CP000033|pid:none) Lactobacillus acidophilus NCFM, ... 100 2e-19
CP000943_3829(CP000943|pid:none) Methylobacterium sp. 4-46, comp... 100 2e-19
CP001096_3042(CP001096|pid:none) Rhodopseudomonas palustris TIE-... 100 3e-19
AE016818_292(AE016818|pid:none) Ashbya gossypii (= Eremothecium ... 100 4e-19
CP000529_1703(CP000529|pid:none) Polaromonas naphthalenivorans C... 100 4e-19
CP000384_1893(CP000384|pid:none) Mycobacterium sp. MCS, complete... 100 4e-19
CP000512_3058(CP000512|pid:none) Acidovorax citrulli AAC00-1, co... 100 4e-19
CP000563_2342(CP000563|pid:none) Shewanella baltica OS155, compl... 99 5e-19
CP000822_3206(CP000822|pid:none) Citrobacter koseri ATCC BAA-895... 99 5e-19
CP000826_744(CP000826|pid:none) Serratia proteamaculans 568, com... 99 5e-19
CP001113_120(CP001113|pid:none) Salmonella enterica subsp. enter... 99 5e-19
CP000891_2476(CP000891|pid:none) Shewanella baltica OS195, compl... 99 5e-19
CP000753_2339(CP000753|pid:none) Shewanella baltica OS185, compl... 99 5e-19
CP001252_1934(CP001252|pid:none) Shewanella baltica OS223, compl... 99 5e-19
CP000783_3174(CP000783|pid:none) Enterobacter sakazakii ATCC BAA... 99 6e-19
CU458896_3296(CU458896|pid:none) Mycobacterium abscessus chromos... 99 6e-19
AE014075_92(AE014075|pid:none) Escherichia coli CFT073, complete... 99 6e-19
CU928164_82(CU928164|pid:none) Escherichia coli IAI39 chromosome... 99 6e-19
AE005674_72(AE005674|pid:none) Shigella flexneri 2a str. 301, co... 99 6e-19
CP000744_5338(CP000744|pid:none) Pseudomonas aeruginosa PA7, com... 99 6e-19
AM286415_623(AM286415|pid:none) Yersinia enterocolitica subsp. e... 99 6e-19
CP001164_78(CP001164|pid:none) Escherichia coli O157:H7 str. EC4... 99 6e-19
CP000447_1616(CP000447|pid:none) Shewanella frigidimarina NCIMB ... 99 6e-19
X55034_4(X55034|pid:none) E. coli 2 minute region. 99 6e-19
(P00893) RecName: Full=Acetolactate synthase isozyme 3 large sub... 99 6e-19
X01609_1(X01609|pid:none) E. coli ilvIH operon for valine-sensit... 99 6e-19
AP009240_79(AP009240|pid:none) Escherichia coli SE11 DNA, comple... 99 6e-19
CU928163_77(CU928163|pid:none) Escherichia coli UMN026 chromosom... 99 6e-19
CP001396_73(CP001396|pid:none) Escherichia coli BW2952, complete... 99 6e-19
CP000247_79(CP000247|pid:none) Escherichia coli 536, complete ge... 99 6e-19
A85490(A85490) hypothetical protein ilvI [imported] - Escherichi... 99 6e-19
CP000970_83(CP000970|pid:none) Escherichia coli SMS-3-5, complet... 99 6e-19
EF105338_1(EF105338|pid:none) Pseudomonas aeruginosa strain L36 ... 99 6e-19
A90639(A90639) hypothetical protein ECs0081 [imported] - Escheri... 99 6e-19
CP000655_633(CP000655|pid:none) Polynucleobacter necessarius sub... 99 6e-19
AE015929_2144(AE015929|pid:none) Staphylococcus epidermidis ATCC... 99 6e-19
CP000038_81(CP000038|pid:none) Shigella sonnei Ss046, complete g... 99 6e-19
(P40811) RecName: Full=Acetolactate synthase isozyme 3 large sub... 99 8e-19
(P51853) RecName: Full=Benzaldehyde lyase; EC=4.1.2.38;... 99 8e-19
CP000680_999(CP000680|pid:none) Pseudomonas mendocina ymp, compl... 99 8e-19
CP000713_604(CP000713|pid:none) Psychrobacter sp. PRwf-1, comple... 99 8e-19
CP000446_1742(CP000446|pid:none) Shewanella sp. MR-4, complete g... 99 8e-19
AX349268_1(AX349268|pid:none) Sequence 1 from Patent WO0202753. 99 8e-19
AY007242_1(AY007242|pid:none) Pseudomonas fluorescens biovar I b... 99 8e-19
AM286690_481(AM286690|pid:none) Alcanivorax borkumensis SK2, com... 99 8e-19
CP001147_1235(CP001147|pid:none) Thermodesulfovibrio yellowstoni... 99 8e-19
CP000964_4565(CP000964|pid:none) Klebsiella pneumoniae 342, comp... 99 8e-19
AP009384_2376(AP009384|pid:none) Azorhizobium caulinodans ORS 57... 99 8e-19
AE014613_118(AE014613|pid:none) Salmonella enterica subsp. enter... 99 8e-19
CU928158_97(CU928158|pid:none) Escherichia fergusonii ATCC 35469... 99 8e-19
AE014299_2232(AE014299|pid:none) Shewanella oneidensis MR-1, com... 99 8e-19
CP001120_116(CP001120|pid:none) Salmonella enterica subsp. enter... 99 8e-19
AP006725_802(AP006725|pid:none) Klebsiella pneumoniae NTUH-K2044... 99 8e-19
CP001157_4107(CP001157|pid:none) Azotobacter vinelandii DJ, comp... 99 8e-19
CP000857_121(CP000857|pid:none) Salmonella enterica subsp. enter... 99 8e-19
CT573326_4376(CT573326|pid:none) Pseudomonas entomophila str. L4... 98 1e-18
EU016672_21(EU016672|pid:none) Uncultured Group I marine crenarc... 98 1e-18
CP000285_498(CP000285|pid:none) Chromohalobacter salexigens DSM ... 98 1e-18
CP001002_207(CP001002|pid:none) Methylobacterium radiotolerans J... 98 1e-18
CP001283_1399(CP001283|pid:none) Bacillus cereus AH820, complete... 98 1e-18
CP000139_2482(CP000139|pid:none) Bacteroides vulgatus ATCC 8482,... 98 1e-18
EU078622_1(EU078622|pid:none) Klebsiella pneumoniae strain HR9 A... 98 1e-18
EU344810_2(EU344810|pid:none) Uncultured Pseudomonas sp. clone L... 98 1e-18
AE017355_1255(AE017355|pid:none) Bacillus thuringiensis serovar ... 98 1e-18
AE017194_1510(AE017194|pid:none) Bacillus cereus ATCC 10987, com... 98 1e-18
CP000503_1855(CP000503|pid:none) Shewanella sp. W3-18-1, complet... 98 1e-18
AE017225_1286(AE017225|pid:none) Bacillus anthracis str. Sterne,... 98 1e-18
CP000001_1262(CP000001|pid:none) Bacillus cereus E33L, complete ... 98 1e-18
AM260480_1691(AM260480|pid:none) Ralstonia eutropha H16 chromoso... 98 1e-18
AP010656_605(AP010656|pid:none) Candidatus Azobacteroides pseudo... 97 2e-18
CP000394_1481(CP000394|pid:none) Granulibacter bethesdensis CGDN... 97 2e-18
CP000712_4487(CP000712|pid:none) Pseudomonas putida F1, complete... 97 2e-18
(P45261) RecName: Full=Acetolactate synthase large subunit; ... 97 2e-18
CP000926_4648(CP000926|pid:none) Pseudomonas putida GB-1, comple... 97 2e-18
CP000057_1282(CP000057|pid:none) Haemophilus influenzae 86-028NP... 97 2e-18
EU016614_38(EU016614|pid:none) Uncultured Group I marine crenarc... 97 2e-18
(O33112) RecName: Full=Acetolactate synthase; EC=2.2.1.... 97 2e-18
FM200053_118(FM200053|pid:none) Salmonella enterica subsp. enter... 97 2e-18
CP000302_2107(CP000302|pid:none) Shewanella denitrificans OS217,... 97 2e-18
CP000964_2219(CP000964|pid:none) Klebsiella pneumoniae 342, comp... 97 2e-18
AE000657_332(AE000657|pid:none) Aquifex aeolicus VF5, complete g... 97 2e-18
CP000916_120(CP000916|pid:none) Thermotoga neapolitana DSM 4359,... 97 2e-18
EF123200_1(EF123200|pid:none) Xenorhabdus nematophila IlvI (ilvI... 97 2e-18
AP009389_527(AP009389|pid:none) Pelotomaculum thermopropionicum ... 97 2e-18
CP000949_753(CP000949|pid:none) Pseudomonas putida W619, complet... 97 3e-18
CP000240_632(CP000240|pid:none) Synechococcus sp. JA-2-3B'a(2-13... 97 3e-18
CP000386_3051(CP000386|pid:none) Rubrobacter xylanophilus DSM 99... 97 3e-18
CP000075_845(CP000075|pid:none) Pseudomonas syringae pv. syringa... 97 3e-18
CP000058_840(CP000058|pid:none) Pseudomonas syringae pv. phaseol... 97 3e-18
CP000091_1192(CP000091|pid:none) Ralstonia eutropha JMP134 chrom... 97 3e-18
CP000647_2027(CP000647|pid:none) Klebsiella pneumoniae subsp. pn... 97 3e-18
CP000454_2517(CP000454|pid:none) Arthrobacter sp. FB24, complete... 97 3e-18
(P57321) RecName: Full=Acetolactate synthase large subunit; ... 96 4e-18
CP001056_296(CP001056|pid:none) Clostridium botulinum B str. Ekl... 96 4e-18
BX572601_305(BX572601|pid:none) Rhodopseudomonas palustris CGA00... 96 4e-18
CP001341_2241(CP001341|pid:none) Arthrobacter chlorophenolicus A... 96 4e-18
CP000749_1305(CP000749|pid:none) Marinomonas sp. MWYL1, complete... 96 4e-18
CP000783_823(CP000783|pid:none) Enterobacter sakazakii ATCC BAA-... 96 4e-18
CP000746_1023(CP000746|pid:none) Actinobacillus succinogenes 130... 96 4e-18
CU207211_333(CU207211|pid:none) Herminiimonas arsenicoxydans chr... 96 4e-18
AM157416_1(AM157416|pid:none) Buchnera aphidicola ilvI gene for ... 96 4e-18
CP001176_1324(CP001176|pid:none) Bacillus cereus B4264, complete... 96 4e-18
CP000413_240(CP000413|pid:none) Lactobacillus gasseri ATCC 33323... 96 4e-18
CU468135_12(CU468135|pid:none) Erwinia tasmaniensis strain ET1/9... 96 4e-18
AE016825_586(AE016825|pid:none) Chromobacterium violaceum ATCC 1... 96 4e-18
AP006627_2637(AP006627|pid:none) Bacillus clausii KSM-K16 DNA, c... 96 4e-18
CP000943_1802(CP000943|pid:none) Methylobacterium sp. 4-46, comp... 96 4e-18
CP001635_2332(CP001635|pid:none) Variovorax paradoxus S110 chrom... 96 5e-18
CP000884_4849(CP000884|pid:none) Delftia acidovorans SPH-1, comp... 96 5e-18
DQ311277_1(DQ311277|pid:none) Bombyx mori 2-hydroxyphytanoyl-CoA... 96 5e-18
FM178379_2705(FM178379|pid:none) Aliivibrio salmonicida LFI1238 ... 96 5e-18
CP000685_2845(CP000685|pid:none) Flavobacterium johnsoniae UW101... 96 5e-18
(Q04524) RecName: Full=Acetolactate synthase, catabolic; ... 96 7e-18
AP008230_1366(AP008230|pid:none) Desulfitobacterium hafniense Y5... 96 7e-18
CP000774_2450(CP000774|pid:none) Parvibaculum lavamentivorans DS... 96 7e-18
CP000482_2521(CP000482|pid:none) Pelobacter propionicus DSM 2379... 96 7e-18
CP000148_1246(CP000148|pid:none) Geobacter metallireducens GS-15... 96 7e-18
CP000020_2287(CP000020|pid:none) Vibrio fischeri ES114 chromosom... 96 7e-18
CP000393_2487(CP000393|pid:none) Trichodesmium erythraeum IMS101... 95 9e-18
CP000431_6425(CP000431|pid:none) Rhodococcus jostii RHA1, comple... 95 9e-18
AE000516_3189(AE000516|pid:none) Mycobacterium tuberculosis CDC1... 95 9e-18
CP000034_103(CP000034|pid:none) Shigella dysenteriae Sd197, comp... 95 9e-18
CP000157_1103(CP000157|pid:none) Erythrobacter litoralis HTCC259... 95 9e-18
CP000852_1781(CP000852|pid:none) Caldivirga maquilingensis IC-16... 95 9e-18
CP000539_1701(CP000539|pid:none) Acidovorax sp. JS42, complete g... 95 9e-18
AL445065_44(AL445065|pid:none) Thermoplasma acidophilum complete... 95 9e-18
CP000507_2011(CP000507|pid:none) Shewanella amazonensis SB2B, co... 95 1e-17
CP000655_1057(CP000655|pid:none) Polynucleobacter necessarius su... 95 1e-17
CP000352_911(CP000352|pid:none) Ralstonia metallidurans CH34, co... 95 1e-17
CP001151_226(CP001151|pid:none) Rhodobacter sphaeroides KD131 ch... 95 1e-17
FM954972_340(FM954972|pid:none) Vibrio splendidus LGP32 chromoso... 95 1e-17
AP009179_1823(AP009179|pid:none) Sulfurovum sp. NBC37-1 genomic ... 95 1e-17
AP009247_392(AP009247|pid:none) Candidatus Vesicomyosocius okuta... 95 1e-17
CP000116_1991(CP000116|pid:none) Thiobacillus denitrificans ATCC... 95 1e-17
AE000782_1989(AE000782|pid:none) Archaeoglobus fulgidus DSM 4304... 95 1e-17
CP000144_181(CP000144|pid:none) Rhodobacter sphaeroides 2.4.1 ch... 95 1e-17
(P0A622) RecName: Full=Acetolactate synthase; EC=2.2.1.... 95 1e-17
CP000542_1706(CP000542|pid:none) Verminephrobacter eiseniae EF01... 94 1e-17
AP008957_2397(AP008957|pid:none) Rhodococcus erythropolis PR4 DN... 94 1e-17
CP000826_3420(CP000826|pid:none) Serratia proteamaculans 568, co... 94 1e-17
CP000627_2009(CP000627|pid:none) Vibrio cholerae O395 chromosome... 94 1e-17
CP000814_534(CP000814|pid:none) Campylobacter jejuni subsp. jeju... 94 2e-17
CP000656_4212(CP000656|pid:none) Mycobacterium gilvum PYR-GCK, c... 94 2e-17
CP000151_2403(CP000151|pid:none) Burkholderia sp. 383 chromosome... 94 2e-17
AM747720_2355(AM747720|pid:none) Burkholderia cenocepacia J2315 ... 94 2e-17
CP001091_770(CP001091|pid:none) Actinobacillus pleuropneumoniae ... 94 2e-17
CP001132_879(CP001132|pid:none) Acidithiobacillus ferrooxidans A... 94 2e-17
CP000378_1642(CP000378|pid:none) Burkholderia cenocepacia AU 105... 94 2e-17
AP009493_2000(AP009493|pid:none) Streptomyces griseus subsp. gri... 94 2e-17
CP000025_660(CP000025|pid:none) Campylobacter jejuni RM1221, com... 94 2e-17
CP001196_1270(CP001196|pid:none) Oligotropha carboxidovorans OM5... 94 2e-17
CP000090_944(CP000090|pid:none) Ralstonia eutropha JMP134 chromo... 94 3e-17
CP000613_1925(CP000613|pid:none) Rhodospirillum centenum SW, com... 94 3e-17
CP001472_3308(CP001472|pid:none) Acidobacterium capsulatum ATCC ... 94 3e-17
CP001515_1402(CP001515|pid:none) Bifidobacterium animalis subsp.... 94 3e-17
AP008934_82(AP008934|pid:none) Staphylococcus saprophyticus subs... 93 3e-17
CP001100_1617(CP001100|pid:none) Chloroherpeton thalassium ATCC ... 93 3e-17
CP000462_1085(CP000462|pid:none) Aeromonas hydrophila subsp. hyd... 93 3e-17
CU207366_2086(CU207366|pid:none) Gramella forsetii KT0803 comple... 93 3e-17
AK056977_1(AK056977|pid:none) Homo sapiens cDNA FLJ32415 fis, cl... 93 3e-17
CP000758_1788(CP000758|pid:none) Ochrobactrum anthropi ATCC 4918... 93 3e-17
AE009439_531(AE009439|pid:none) Methanopyrus kandleri AV19, comp... 93 3e-17
CP000644_3162(CP000644|pid:none) Aeromonas salmonicida subsp. sa... 93 3e-17
CP000776_1098(CP000776|pid:none) Campylobacter hominis ATCC BAA-... 93 4e-17
CP000362_2608(CP000362|pid:none) Roseobacter denitrificans OCh 1... 93 4e-17
AY619685_6(AY619685|pid:none) Uncultured gamma proteobacterium e... 93 4e-17
AE015928_2077(AE015928|pid:none) Bacteroides thetaiotaomicron VP... 93 4e-17
AE017220_113(AE017220|pid:none) Salmonella enterica subsp. enter... 93 4e-17
CP001618_1400(CP001618|pid:none) Beutenbergia cavernae DSM 12333... 92 6e-17
CP000103_473(CP000103|pid:none) Nitrosospira multiformis ATCC 25... 92 6e-17
CP000555_2099(CP000555|pid:none) Methylibium petroleiphilum PM1,... 92 6e-17
AM286415_3854(AM286415|pid:none) Yersinia enterocolitica subsp. ... 92 6e-17
CP000789_765(CP000789|pid:none) Vibrio harveyi ATCC BAA-1116 chr... 92 7e-17
AC3329(AC3329) acetolactate synthase (EC 4.1.3.18) [imported] - ... 92 7e-17
AE017223_1293(AE017223|pid:none) Brucella abortus biovar 1 str. ... 92 7e-17
CU459003_2528(CU459003|pid:none) Magnetospirillum gryphiswaldens... 92 7e-17
BX571856_2248(BX571856|pid:none) Staphylococcus aureus subsp. au... 92 7e-17
AE000782_1759(AE000782|pid:none) Archaeoglobus fulgidus DSM 4304... 92 7e-17
CP001281_2606(CP001281|pid:none) Thauera sp. MZ1T, complete geno... 92 7e-17
CP000084_3(CP000084|pid:none) Candidatus Pelagibacter ubique HTC... 92 7e-17
CU633749_993(CU633749|pid:none) Cupriavidus taiwanensis str. LMG... 92 7e-17
CP000440_2294(CP000440|pid:none) Burkholderia ambifaria AMMD chr... 92 1e-16
CP000569_719(CP000569|pid:none) Actinobacillus pleuropneumoniae ... 92 1e-16
CP001025_2157(CP001025|pid:none) Burkholderia ambifaria MC40-6 c... 92 1e-16
CP001189_1740(CP001189|pid:none) Gluconacetobacter diazotrophicu... 92 1e-16
AM420293_5977(AM420293|pid:none) Saccharopolyspora erythraea NRR... 92 1e-16
AP009324_2192(AP009324|pid:none) Staphylococcus aureus subsp. au... 92 1e-16
BA000033_2132(BA000033|pid:none) Staphylococcus aureus subsp. au... 92 1e-16
AP007281_481(AP007281|pid:none) Lactobacillus reuteri JCM 1112 D... 92 1e-16
CP000253_2328(CP000253|pid:none) Staphylococcus aureus subsp. au... 92 1e-16
AP010904_2183(AP010904|pid:none) Desulfovibrio magneticus RS-1 D... 92 1e-16
CP001078_622(CP001078|pid:none) Clostridium botulinum E3 str. Al... 92 1e-16
AM889285_22(AM889285|pid:none) Gluconacetobacter diazotrophicus ... 92 1e-16
AP009385_2199(AP009385|pid:none) Burkholderia multivorans ATCC 1... 92 1e-16
CP000688_744(CP000688|pid:none) Dehalococcoides sp. BAV1, comple... 92 1e-16
CP000830_1772(CP000830|pid:none) Dinoroseobacter shibae DFL 12, ... 91 1e-16
CP000698_3655(CP000698|pid:none) Geobacter uraniireducens Rf4, c... 91 1e-16
CP000577_1284(CP000577|pid:none) Rhodobacter sphaeroides ATCC 17... 91 1e-16
AM902716_1612(AM902716|pid:none) Bordetella petrii strain DSM 12... 91 1e-16
CP000471_888(CP000471|pid:none) Magnetococcus sp. MC-1, complete... 91 1e-16
CP000243_2661(CP000243|pid:none) Escherichia coli UTI89, complet... 91 1e-16
AY116644_4(AY116644|pid:none) Streptomyces viridifaciens amino a... 91 1e-16
AE004969_1122(AE004969|pid:none) Neisseria gonorrhoeae FA 1090, ... 91 1e-16
CP000697_2794(CP000697|pid:none) Acidiphilium cryptum JF-5, comp... 91 1e-16
CP001050_273(CP001050|pid:none) Neisseria gonorrhoeae NCCP11945,... 91 1e-16
CU928145_2619(CU928145|pid:none) Escherichia coli 55989 chromoso... 91 1e-16
CP001063_2361(CP001063|pid:none) Shigella boydii CDC 3083-94, co... 91 2e-16
AE017262_1987(AE017262|pid:none) Listeria monocytogenes str. 4b ... 91 2e-16
CP000614_2320(CP000614|pid:none) Burkholderia vietnamiensis G4 c... 91 2e-16
AM167904_2671(AM167904|pid:none) Bordetella avium 197N complete ... 91 2e-16
AP011115_7226(AP011115|pid:none) Rhodococcus opacus B4 DNA, comp... 91 2e-16
CP000494_5709(CP000494|pid:none) Bradyrhizobium sp. BTAi1, compl... 91 2e-16
CP000463_2170(CP000463|pid:none) Rhodopseudomonas palustris BisA... 91 2e-16
FM180568_2566(FM180568|pid:none) Escherichia coli 0127:H6 E2348/... 91 2e-16
CP000377_875(CP000377|pid:none) Silicibacter sp. TM1040, complet... 91 2e-16
FM242711_1964(FM242711|pid:none) Listeria monocytogenes Clip8145... 91 2e-16
CP000561_444(CP000561|pid:none) Pyrobaculum calidifontis JCM 115... 91 2e-16
CU234118_5264(CU234118|pid:none) Bradyrhizobium sp. ORS278,compl... 91 2e-16
CP000708_1236(CP000708|pid:none) Brucella ovis ATCC 25840 chromo... 91 2e-16
CP000010_1590(CP000010|pid:none) Burkholderia mallei ATCC 23344 ... 91 2e-16
CP000702_371(CP000702|pid:none) Thermotoga petrophila RKU-1, com... 91 2e-16
CP001056_663(CP001056|pid:none) Clostridium botulinum B str. Ekl... 91 2e-16
CP000852_1143(CP000852|pid:none) Caldivirga maquilingensis IC-16... 91 2e-16
CP000102_28(CP000102|pid:none) Methanosphaera stadtmanae DSM 309... 91 2e-16
CP000934_660(CP000934|pid:none) Cellvibrio japonicus Ueda107, co... 91 2e-16
CP000027_805(CP000027|pid:none) Dehalococcoides ethenogenes 195,... 91 2e-16
AE017340_2573(AE017340|pid:none) Idiomarina loihiensis L2TR, com... 91 2e-16
(P39994) RecName: Full=Putative 2-hydroxyacyl-CoA lyase; ... 91 2e-16
AE014075_2834(AE014075|pid:none) Escherichia coli CFT073, comple... 91 2e-16
CP001390_1490(CP001390|pid:none) Geobacter sp. FRC-32, complete ... 91 2e-16
CP000510_3243(CP000510|pid:none) Psychromonas ingrahamii 37, com... 91 2e-16
CP001037_1597(CP001037|pid:none) Nostoc punctiforme PCC 73102, c... 90 3e-16
AM942759_1047(AM942759|pid:none) Proteus mirabilis strain HI4320... 90 3e-16
CP001101_1646(CP001101|pid:none) Chlorobium phaeobacteroides BS1... 90 3e-16
(P0AFI0) RecName: Full=Probable oxalyl-CoA decarboxylase; ... 90 3e-16
CP000142_2051(CP000142|pid:none) Pelobacter carbinolicus DSM 238... 90 3e-16
AP009240_2670(AP009240|pid:none) Escherichia coli SE11 DNA, comp... 90 3e-16
AE005674_2440(AE005674|pid:none) Shigella flexneri 2a str. 301, ... 90 3e-16
AP008937_1022(AP008937|pid:none) Lactobacillus fermentum IFO 395... 90 3e-16
CP000800_2541(CP000800|pid:none) Escherichia coli E24377A, compl... 90 3e-16
CP000975_2361(CP000975|pid:none) Methylacidiphilum infernorum V4... 90 3e-16
CP000866_1068(CP000866|pid:none) Nitrosopumilus maritimus SCM1, ... 90 3e-16
CP001130_1196(CP001130|pid:none) Hydrogenobaculum sp. Y04AAS1, c... 90 3e-16
AP006716_461(AP006716|pid:none) Staphylococcus haemolyticus JCSC... 90 3e-16
CU928164_2499(CU928164|pid:none) Escherichia coli IAI39 chromoso... 90 4e-16
CP000283_2093(CP000283|pid:none) Rhodopseudomonas palustris BisB... 90 4e-16
CP000492_827(CP000492|pid:none) Chlorobium phaeobacteroides DSM ... 90 4e-16
CP001229_78(CP001229|pid:none) Sulfurihydrogenibium azorense Az-... 90 4e-16
CP000360_3104(CP000360|pid:none) Acidobacteria bacterium Ellin34... 90 4e-16
AM421808_1374(AM421808|pid:none) Neisseria meningitidis serogrou... 90 4e-16
CP000970_2449(CP000970|pid:none) Escherichia coli SMS-3-5, compl... 90 4e-16
AL157959_1564(AL157959|pid:none) Neisseria meningitidis serogrou... 90 4e-16
CP001077_467(CP001077|pid:none) Rhizobium etli CIAT 652 plasmid ... 90 4e-16
BA000040_6503(BA000040|pid:none) Bradyrhizobium japonicum USDA 1... 89 5e-16
CP000301_3218(CP000301|pid:none) Rhodopseudomonas palustris BisB... 89 5e-16
CP001110_2012(CP001110|pid:none) Pelodictyon phaeoclathratiforme... 89 5e-16
CP000607_1153(CP000607|pid:none) Chlorobium phaeovibrioides DSM ... 89 5e-16
CP000009_1057(CP000009|pid:none) Gluconobacter oxydans 621H, com... 89 5e-16
AP007255_3507(AP007255|pid:none) Magnetospirillum magneticum AMB... 89 5e-16
AE008691_21(AE008691|pid:none) Thermoanaerobacter tengcongensis ... 89 5e-16
CP000633_2058(CP000633|pid:none) Agrobacterium vitis S4 chromoso... 89 5e-16
AB057421_11(AB057421|pid:none) Staphylococcus aureus IS256, ORF5... 89 5e-16
CP000108_1876(CP000108|pid:none) Chlorobium chlorochromatii CaD3... 89 5e-16
CP000031_2518(CP000031|pid:none) Ruegeria pomeroyi DSS-3, comple... 89 6e-16
CP001071_1622(CP001071|pid:none) Akkermansia muciniphila ATCC BA... 89 6e-16
CP000158_447(CP000158|pid:none) Hyphomonas neptunium ATCC 15444,... 89 6e-16
CP000879_1539(CP000879|pid:none) Petrotoga mobilis SJ95, complet... 89 6e-16
Z46959_1(Z46959|pid:none) G.hirsutum gene for acetohydroxyacid s... 89 6e-16
AJ938182_2087(AJ938182|pid:none) Staphylococcus aureus RF122 com... 89 6e-16
AM902716_27(AM902716|pid:none) Bordetella petrii strain DSM 1280... 89 6e-16
CT573213_5714(CT573213|pid:none) Frankia alni str. ACN14A chromo... 89 6e-16
BA000022_1399(BA000022|pid:none) Synechocystis sp. PCC 6803 DNA,... 89 6e-16
CP000077_1444(CP000077|pid:none) Sulfolobus acidocaldarius DSM 6... 89 6e-16
AE016823_2684(AE016823|pid:none) Leptospira interrogans serovar ... 89 8e-16
CP001358_1879(CP001358|pid:none) Desulfovibrio desulfuricans sub... 89 8e-16
BX936429_1(BX936429|pid:none) Zebrafish DNA sequence from clone ... 89 8e-16
CP000031_2332(CP000031|pid:none) Ruegeria pomeroyi DSS-3, comple... 89 8e-16
CP001052_1290(CP001052|pid:none) Burkholderia phytofirmans PsJN ... 89 8e-16
CP001291_4867(CP001291|pid:none) Cyanothece sp. PCC 7424, comple... 89 8e-16
CP001087_2074(CP001087|pid:none) Desulfobacterium autotrophicum ... 89 8e-16
AM167904_3384(AM167904|pid:none) Bordetella avium 197N complete ... 89 8e-16
AE006470_613(AE006470|pid:none) Chlorobium tepidum TLS, complete... 88 1e-15
AE000666_1410(AE000666|pid:none) Methanothermobacter thermautotr... 88 1e-15
CP001635_2030(CP001635|pid:none) Variovorax paradoxus S110 chrom... 88 1e-15
CP000388_620(CP000388|pid:none) Pseudoalteromonas atlantica T6c,... 88 1e-15
CP000414_1858(CP000414|pid:none) Leuconostoc mesenteroides subsp... 88 1e-15
CP001275_354(CP001275|pid:none) Thermomicrobium roseum DSM 5159,... 88 1e-15
BA000043_2661(BA000043|pid:none) Geobacillus kaustophilus HTA426... 88 1e-15
CP000001_1642(CP000001|pid:none) Bacillus cereus E33L, complete ... 88 1e-15
BA000012_1127(BA000012|pid:none) Mesorhizobium loti MAFF303099 D... 88 1e-15
CP001099_625(CP001099|pid:none) Chlorobaculum parvum NCIB 8327, ... 88 1e-15
AL935254_230(AL935254|pid:none) Lactobacillus plantarum strain W... 88 1e-15
CP001192_937(CP001192|pid:none) Rhizobium leguminosarum bv. trif... 88 1e-15
BX897699_1059(BX897699|pid:none) Bartonella henselae strain Hous... 88 1e-15
CP000449_286(CP000449|pid:none) Maricaulis maris MCS10, complete... 88 1e-15
CP000767_919(CP000767|pid:none) Campylobacter curvus 525.92, com... 88 1e-15
CP001407_1696(CP001407|pid:none) Bacillus cereus 03BB102, comple... 87 2e-15
CP000089_1609(CP000089|pid:none) Dechloromonas aromatica RCB, co... 87 2e-15
CP000485_1531(CP000485|pid:none) Bacillus thuringiensis str. Al ... 87 2e-15
AE014133_209(AE014133|pid:none) Streptococcus mutans UA159, comp... 87 2e-15
S60058(S60058;S78425)acetolactate synthase (EC 4.1.3.18) precurs... 87 2e-15
AE017355_1663(AE017355|pid:none) Bacillus thuringiensis serovar ... 87 2e-15
BX950229_650(BX950229|pid:none) Methanococcus maripaludis strain... 87 2e-15
AM406671_1263(AM406671|pid:none) Lactococcus lactis subsp. cremo... 87 2e-15
Z46960_1(Z46960|pid:none) G.hirsutum gene for acetohydroxyacid s... 87 2e-15
CP000750_1331(CP000750|pid:none) Kineococcus radiotolerans SRS30... 87 2e-15
CP000932_772(CP000932|pid:none) Campylobacter lari RM2100, compl... 87 2e-15
CP000560_2449(CP000560|pid:none) Bacillus amyloliquefaciens FZB4... 87 2e-15
AE008692_1139(AE008692|pid:none) Zymomonas mobilis subsp. mobili... 87 2e-15
CP001638_2349(CP001638|pid:none) Geobacillus sp. WCH70, complete... 87 3e-15
CU207211_1165(CU207211|pid:none) Herminiimonas arsenicoxydans ch... 87 3e-15
CP000780_1437(CP000780|pid:none) Candidatus Methanoregula boonei... 87 3e-15
(O19929) RecName: Full=Acetolactate synthase large subunit; ... 87 3e-15
CP000438_3049(CP000438|pid:none) Pseudomonas aeruginosa UCBPP-PA... 87 3e-15
CP001280_2935(CP001280|pid:none) Methylocella silvestris BL2, co... 87 3e-15
CP001176_798(CP001176|pid:none) Bacillus cereus B4264, complete ... 86 4e-15
AP008231_1366(AP008231|pid:none) Synechococcus elongatus PCC 630... 86 4e-15
CP000820_1077(CP000820|pid:none) Frankia sp. EAN1pec, complete g... 86 4e-15
AE008922_3275(AE008922|pid:none) Xanthomonas campestris pv. camp... 86 4e-15
BX640452_60(BX640452|pid:none) Bordetella bronchiseptica strain ... 86 4e-15
BX640436_196(BX640436|pid:none) Bordetella parapertussis strain ... 86 4e-15
AE000782_1699(AE000782|pid:none) Archaeoglobus fulgidus DSM 4304... 86 4e-15
CP001349_5240(CP001349|pid:none) Methylobacterium nodulans ORS 2... 86 4e-15
CR931997_1300(CR931997|pid:none) Corynebacterium jeikeium K411 c... 86 4e-15
AE017355_755(AE017355|pid:none) Bacillus thuringiensis serovar k... 86 4e-15
CP000922_588(CP000922|pid:none) Anoxybacillus flavithermus WK1, ... 86 4e-15
CP000485_738(CP000485|pid:none) Bacillus thuringiensis str. Al H... 86 4e-15
BX640412_121(BX640412|pid:none) Bordetella pertussis strain Toha... 86 4e-15
CP001279_770(CP001279|pid:none) Nautilia profundicola AmH, compl... 86 4e-15
AE016879_807(AE016879|pid:none) Bacillus anthracis str. Ames, co... 86 4e-15
CP000001_757(CP000001|pid:none) Bacillus cereus E33L, complete g... 86 4e-15
CP001407_777(CP001407|pid:none) Bacillus cereus 03BB102, complet... 86 4e-15
AY083837_1(AY083837|pid:none) Geobacillus stearothermophilus str... 86 4e-15
CP001628_804(CP001628|pid:none) Micrococcus luteus NCTC 2665, co... 86 4e-15
CP000552_591(CP000552|pid:none) Prochlorococcus marinus str. MIT... 86 5e-15
CP001338_2285(CP001338|pid:none) Candidatus Methanosphaerula pal... 86 5e-15
CP000250_996(CP000250|pid:none) Rhodopseudomonas palustris HaA2,... 86 5e-15
AL591688_2122(AL591688|pid:none) Sinorhizobium meliloti 1021 com... 86 5e-15
CP000419_768(CP000419|pid:none) Streptococcus thermophilus LMD-9... 86 5e-15
AE007869_1990(AE007869|pid:none) Agrobacterium tumefaciens str. ... 86 5e-15
AE010299_3689(AE010299|pid:none) Methanosarcina acetivorans str.... 86 5e-15
>CP000686_920(CP000686|pid:none) Roseiflexus sp. RS-1, complete
genome.
Length = 573
Score = 337 bits (865), Expect(2) = e-143
Identities = 189/449 (42%), Positives = 263/449 (58%), Gaps = 2/449 (0%)
Frame = +3
Query: 705 PGPVFVEFPIDVLYQESVVRGWY-LKNQDQAKSLASRVINMYMSYHLKKIFSAIDSNIVI 881
PGPVFVE PID+LY E VVR WY LK ++ + + ++ + H +F+ V+
Sbjct: 150 PGPVFVELPIDLLYDEQVVRQWYGLKRIGRSPAQWATWVSRSVWVH--HLFAGAQQQAVV 207
Query: 882 HGR-VRQHQTRVTSDHVSALLARLVSNKDGACKKPVLIVGSQVTLINDAYSIESLQRSVQ 1058
R V Q + H ++L ++P+L+ GSQ L D S+++L R++
Sbjct: 208 KPRPVPQREPDQRDIHAASLAL-------ATAERPLLLAGSQAVL--DPASVDALARAIT 258
Query: 1059 SLGIPVFTSSMSRGLLGTSHSNLFRHCRSHALKKADLVILAGVTCDFRLNYGRSINSRAK 1238
+ GIPV+ S M+RGLLG +H RH R AL++ADLVILAGV CDFRL+YG I +
Sbjct: 259 ATGIPVYLSGMARGLLGANHPLQMRHRRREALREADLVILAGVPCDFRLDYGNHIPRHTR 318
Query: 1239 VFSINRDSIDLYKNKSPNYPYSLDPGSFLVQLSESISELPSSDRSIIELKFRDWINELTN 1418
+ + NR DL N+ P DP F+ +LS + S W L
Sbjct: 319 IIAANRSRTDLTLNRRPQIAVLGDPAHFIHRLSNAASNH----------NLERWQETLRQ 368
Query: 1419 LDVSRNVDIANKINIPPSKEGFLNPLKALQMFDEQLPHKTIMVADGGDFVGSASYIVRPR 1598
D R +I I + + ++NPL +M ++ L +++VADGGDFV +ASYIVRPR
Sbjct: 369 RDAGREAEI---IRLSNQQTAYVNPLYLCRMINDALSDNSVIVADGGDFVATASYIVRPR 425
Query: 1599 APLSWLDPGVFGTLGVGAGFSIAAKLCRPDHQVWTIYGDGAFGYSIPELDTMVRHKISVG 1778
PLSWLDPG FGTLGVGAGF++ AKLCRPD VW +YGDG+ GYSI E DT RH I V
Sbjct: 426 RPLSWLDPGPFGTLGVGAGFALGAKLCRPDADVWLLYGDGSVGYSIAEFDTFTRHNIPVI 485
Query: 1779 AIIGNDSGWIQILREQQEQLNSDVGCNLAYTDYHQVAIAFGGKGFKSTNESELKFALEES 1958
A++GND+GW QI REQ E L+ DV LA++DY QVA FG G + + ++ L+++
Sbjct: 486 AVVGNDAGWTQIAREQVELLHDDVATRLAHSDYDQVAAGFGAVGRRIDDPELVEETLQQA 545
Query: 1959 NKILNQNQQPVVINCIIERNDFRKGSIRL 2045
+ + +PV++N +I DFRKGS+ +
Sbjct: 546 QQSAARG-KPVLVNVLIGTTDFRKGSLSM 573
Score = 198 bits (503), Expect(2) = e-143
Identities = 99/156 (63%), Positives = 119/156 (76%)
Frame = +2
Query: 263 GGELVANVLSKQGVKFLFTLTGGHIAPILVESDKIGIRVIDVRHESTTVFAADGVFRLTG 442
GG+LVA L GV+F+FTLTGGHIAP+LV + GIRVID RHE+T VFAAD V RLTG
Sbjct: 3 GGDLVAQALQAHGVRFVFTLTGGHIAPVLVGCHQRGIRVIDTRHEATAVFAADAVARLTG 62
Query: 443 IPGVAVVTAGPGLTNTITAVKNAQMAQSGVVLIGGATSDLLKGKGSLQDIDQFALLRPHV 622
IPGVAVVTAGPG+TNTITA+KNAQMAQS +VLIGGAT+ L+G+G+LQDIDQ L++
Sbjct: 63 IPGVAVVTAGPGVTNTITAIKNAQMAQSPLVLIGGATATALRGRGALQDIDQMTLMKSLT 122
Query: 623 KWCSHVSTNSDIVPMLERAFYEARNGTPGSCVC*IP 730
KW V D++P LE AF+ AR+G PG +P
Sbjct: 123 KWRRSVRRVRDLIPTLEEAFFRARDGVPGPVFVELP 158
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3236559
Number of Hits to DB: 3,077,145,803
Number of extensions: 64673476
Number of successful extensions: 214851
Number of sequences better than 10.0: 1800
Number of HSP's gapped: 213419
Number of HSP's successfully gapped: 3484
Length of query: 697
Length of database: 1,051,180,864
Length adjustment: 136
Effective length of query: 561
Effective length of database: 611,008,840
Effective search space: 342775959240
Effective search space used: 342775959240
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 32 (16.9 bits)
|
| PSORT |
|
| VS (DIR, S) |
0 |
| VH (FL, L) |
7 |
| VF (FL, S) |
5 |
| AH (FL, L) |
0 |
| AF (FL, S) |
0 |
| SL (DIR, L) |
0 |
| SS (DIR, S) |
0 |
| SH (FL, L) |
0 |
| SF (FL, S) |
1 |
| CH (FL, L) |
0 |
| CF (FL, S) |
1 |
| FCL (DIR, L) |
0 |
| FC (DIR, S) |
0 |
| FC-IC (SUB) |
0 |