| Contig-U14145-1 |
| Contig ID |
Contig-U14145-1 |
| Contig update |
2002.12.18 |
| Contig sequence |
 |
| Gap |
no gap |
| Contig length |
359 |
| Chromosome number (1..6, M) |
1 |
| Chromosome length |
4919822 |
| Start point |
3844746 |
| End point |
3844397 |
| Strand (PLUS/MINUS) |
MINUS |
| Number of clones |
1 |
| Number of EST |
1 |
| Link to clone list |
U14145 |
| List of clone(s) |
|
| Translated Amino Acid sequence |
|
| Translated Amino Acid sequence (All Frames) |
|
| own update |
2004. 6.10 |
| Homology vs CSM-cDNA |
|
| dna update |
2008.12.18 |
| Homology vs DNA |
Query= Contig-U14145-1 (Contig-U14145-1Q) /CSM_Contig/Contig-U14145-1Q.Seq.d
(359 letters)
Database: ddbj_A
92,845,959 sequences; 95,242,211,685 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value N
(BJ356756) Dictyostelium discoideum cDNA clone:dda61h08, 3' ... 680 0.0 1
(BI069488) C002P10U Populus strain T89 leaves Populus tremul... 80 8e-13 2
(BU834188) T058A06 Populus apical shoot cDNA library Populus... 80 9e-13 2
(BU891137) P046D11 Populus petioles cDNA library Populus tre... 80 2e-12 2
(DT493871) WS01116.BR_L14 PT-P-FL-A-2 Populus trichocarpa cD... 72 5e-10 2
(DV466749) MTUNUL1.P9.G03 NUL Populus fremontii x Populus an... 72 6e-10 2
(EF144670) Populus trichocarpa clone WS01116_L14 unknown mRNA. 72 6e-10 2
(AF302497) Hybrid poplar (Populus trichocarpa x P. deltoides... 72 2e-09 2
(AJ771756) Populus euphratica EST, clone P0001600005H06F1. 66 2e-08 2
(AJ773313) Populus euphratica EST, clone P0000200008D07F1. 66 2e-08 2
(AJ773282) Populus euphratica EST, clone P0000200007H03F1. 66 3e-08 2
(CF232582) PtaJXO0013B8B0804 Poplar cDNA library from young ... 66 3e-08 2
(CX171923) A08_69-52_02.ab1 leaf inoculated with Marssonia p... 66 3e-08 2
(CN549512) GQ0241.B3_M20 GQ024 Populus trichocarpa x Populus... 66 3e-08 2
(CU638744) Podospora anserina genomic DNA chromosome 6, supe... 70 6e-08 1
(CU907816) Podospora anserina mRNA sequence from clone HH0AC... 70 6e-08 1
(CU890009) Podospora anserina mRNA sequence from clone HH0AB... 70 6e-08 1
(AF302498) Hybrid poplar (Populus trichocarpa x P. deltoides... 66 1e-07 2
(DY895541) CeleSEQ15391 Cunninghamella elegans pBluescript (... 54 1e-06 2
(AF195659) Cunninghamella elegans NADPH-dependent cytochrome... 60 2e-06 2
(CU901554) Podospora anserina mRNA sequence from clone HH0AB... 62 1e-05 1
(AF024634) Petroselinum crispum NADPH cytochrome P450 reduct... 58 2e-05 2
(CU310107) Populus EST from severe drought-stressed opposite... 54 7e-05 2
(CK647958) c.04.E12.5 CM523-7 cassava lambda zap Manihot esc... 52 1e-04 2
(CK647368) c.02.F4.5 CM523-7 cassava lambda zap Manihot escu... 52 2e-04 2
(CK647356) c.02.D3.5 CM523-7 cassava lambda zap Manihot escu... 52 2e-04 2
(CK648744) c.07.C9.5 CM523-7 cassava lambda zap Manihot escu... 52 2e-04 2
(CK648145) c.05.N3.5 CM523-7 cassava lambda zap Manihot escu... 52 2e-04 2
(Z26252) V.sativa mRNA for NADPH-ferrihemoprotein reductase. 58 2e-04 1
(DV688532) CGN-31251 Leaf Coffea canephora cDNA clone cccl18... 58 2e-04 1
(DR909032) USDA-FP_17160 Citrus sinensis phloem Citrus sinen... 58 2e-04 1
(CX667479) UCRCP01_031_D12_T3 Swingle citrumelo nematode-cha... 58 2e-04 1
(CX307112) C19001A09T7 FlavFrSub1 Citrus clementina x Citrus... 58 2e-04 1
(CX292277) C04013E05SK FlavFr1 Citrus clementina cDNA clone ... 58 2e-04 1
(CX043974) UCRCS07_14F03_g Parent Washington Navel Orange Th... 58 2e-04 1
(CX043435) UCRCS07_11A10_g Parent Washington Navel Orange Th... 58 2e-04 1
(CV859155) gonad_EST06631 Embryonic gonad cDNA Library Gallu... 58 2e-04 1
(CN189862) UCRCS06_0002I14_r Washington Navel Orange Stored ... 58 2e-04 1
(CF832302) UCRCS02_01K08_f Ruby Orange Ovary at Anthesis cDN... 58 2e-04 1
(CF832300) UCRCS02_01K07_f Ruby Orange Ovary at Anthesis cDN... 58 2e-04 1
(EY849185) CA26-C1-002-049-F06-CT.F Sour orange leaf, field ... 58 2e-04 1
(EY843565) CA26-C1-002-016-D05-CT.F Sour orange leaf, field ... 58 2e-04 1
(EY843280) CA26-C1-002-011-A06-CT.F Sour orange leaf, field ... 58 2e-04 1
(EY834095) PT11-C2-301-026-C05-CT.F Poncirus trifoliata bark... 58 2e-04 1
(EY831118) PT11-C2-300-073-B06-CT.F Poncirus trifoliata bark... 58 2e-04 1
(EY830818) PT11-C2-300-069-B10-CT.F Poncirus trifoliata bark... 58 2e-04 1
(EY827965) PT11-C2-300-015-D09-CT.F Poncirus trifoliata bark... 58 2e-04 1
(EY820373) PT11-C1-901-018-D09-CT.F Poncirus trifoliata leaf... 58 2e-04 1
(EY819846) PT11-C1-901-013-F07-CT.F Poncirus trifoliata leaf... 58 2e-04 1
(EY819834) PT11-C1-901-013-E07-CT.F Poncirus trifoliata leaf... 58 2e-04 1
(EY808967) CR05-C3-702-099-D03-CT.F Mandarin fruit, developm... 58 2e-04 1
(EY806436) CR05-C3-702-062-A05-CT.F Mandarin fruit, developm... 58 2e-04 1
(EY801148) CR05-C3-701-089-D12-CT.F Mandarin fruit, developm... 58 2e-04 1
(EY769124) CR05-C1-102-035-E10-CT.F Mandarin leaf, infected ... 58 2e-04 1
(EY768104) CR05-C1-102-025-A04-CT.F Mandarin leaf, infected ... 58 2e-04 1
(EY762980) CR05-C1-100-061-A04-CT.F Mandarin leaf, greenhous... 58 2e-04 1
(EY762168) CR05-C1-100-051-B07-CT.F Mandarin leaf, greenhous... 58 2e-04 1
(EY754114) CS12-C1-001-010-H03-CT.F Sweet orange leaf, field... 58 2e-04 1
(EY744791) CS00-C5-003-003-E11-CT.F Sweet orange flower, gre... 58 2e-04 1
(EY743272) CS00-C3-705-090-C08-CT.F Sweet orange fruit, deve... 58 2e-04 1
(EY743252) CS00-C3-705-101-H11-CT.F Sweet orange fruit, deve... 58 2e-04 1
(EY736654) CS00-C3-705-019-A04-CT.F Sweet orange fruit, deve... 58 2e-04 1
(EY725676) CS00-C3-703-037-F04-CT.F Sweet orange fruit, deve... 58 2e-04 1
(EY721134) CS00-C3-703-018-H04-CT.F Sweet orange fruit, deve... 58 2e-04 1
(EY711748) CS00-C3-702-011-D01-CT.F Sweet orange fruit, deve... 58 2e-04 1
(EY708886) CS00-C3-701-103-G08-CT.F Sweet orange fruit, deve... 58 2e-04 1
(EY705851) CS00-C3-701-049-F08-CT.F Sweet orange fruit, deve... 58 2e-04 1
(EY659476) CS00-C1-101-009-E10-CT.F Sweet orange leaf, infec... 58 2e-04 1
(EY653393) CS00-C1-100-043-H07-CT.F Sweet orange leaf, green... 58 2e-04 1
(CK647673) c.03.O3.5 CM523-7 cassava lambda zap Manihot escu... 52 2e-04 2
(FF655941) G826P5270RF4.T0 Acorn worm normalized juvenile pE... 50 3e-04 2
(DV446478) CV01019A1D09.f1 CV01-normalized library Manihot e... 52 3e-04 2
(FF535779) CASRH34TF CASR Manihot esculenta cDNA 5', mRNA se... 52 3e-04 2
(AL365946) Medicago truncatula EST MtBA03D01F1 : T3 end of c... 50 8e-04 2
(EV262389) MTYEU93TF JCVI-MT1 Medicago truncatula cDNA 5', m... 50 9e-04 2
(AC189517) Brassica rapa subsp. pekinensis clone KBrB090J11,... 56 9e-04 1
(EV020936) BNSCS2CT_UP_070_F01_18APR2007_005 Brassica napus ... 56 9e-04 1
(ES835148) UFL_005_91 Cotton fiber 0-10 day post anthesis Go... 56 9e-04 1
(ES822475) UFL_381_33 Cotton fiber 0-10 day post anthesis Go... 56 9e-04 1
(DW224170) GH_HYPS_01-01-06R_G08_InvR_14Apr04_052_F Stem - 7... 56 9e-04 1
(BG444748) GA__Ea0025H01f Gossypium arboreum 7-10 dpa fiber ... 56 9e-04 1
(H74521) 481 Random-primed Brassica napus cDNA clone RRM1185... 56 9e-04 1
(EX074955) BR059599 root cDNA library KBRT Brassica rapa sub... 56 9e-04 1
(EV195641) 0096793 Brassica napus Cold acclimation - light B... 56 9e-04 1
(CX526853) s13dNF27D02AT026_514218 Aphid-Infected Shoots Med... 50 0.001 2
(CX528309) s13dNF54A07AT053_517130 Aphid-Infected Shoots Med... 50 0.001 2
(EV261198) MTYEG74TF JCVI-MT1 Medicago truncatula cDNA 5', m... 50 0.001 2
(BG447798) NF069H04EC1F1041 Elicited cell culture Medicago t... 50 0.001 2
(BF004732) EST433230 KV1 Medicago truncatula cDNA clone pKV1... 50 0.001 2
(BF004731) EST433229 KV1 Medicago truncatula cDNA clone pKV1... 50 0.001 2
(BG452152) NF085F04LF1F1043 Developing leaf Medicago truncat... 50 0.001 2
(AW685470) NF030B12NR1F1000 Nodulated root Medicago truncatu... 50 0.001 2
(BG450144) NF014G11DT1F1088 Drought Medicago truncatula cDNA... 50 0.001 2
(BG450786) NF093A10DT1F1071 Drought Medicago truncatula cDNA... 50 0.001 2
(BH012931) TDGAQ19TH cTOG Solanum lycopersicum genomic clone... 50 0.001 2
(AW584757) N210903e MHAM Medicago truncatula/Glomus versifor... 50 0.001 2
(CR334947) mte1-65K16FM1 BAC end, cultivar Jemalong A17 of M... 50 0.001 2
(Z26938) Aspergillus niger cprA gene for NADPH cytochrome P4... 54 0.003 1
(CU137640) M.truncatula DNA sequence from clone MTH2-50D4 on... 54 0.003 1
(CP000498) Pichia stipitis CBS 6054 chromosome 4, complete s... 54 0.003 1
>(BJ356756) Dictyostelium discoideum cDNA clone:dda61h08, 3' end,
single read.
Length = 350
Score = 680 bits (343), Expect = 0.0
Identities = 349/349 (100%)
Strand = Plus / Minus
Query: 11 agttccattatttgttagagaatctcactttaaattaccatctgccgccaccgaacaaaa 70
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 350 agttccattatttgttagagaatctcactttaaattaccatctgccgccaccgaacaaaa 291
Query: 71 acctgtcattatggttggtcctggtactggtttagctcctttcagaggtttccttcaaga 130
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 290 acctgtcattatggttggtcctggtactggtttagctcctttcagaggtttccttcaaga 231
Query: 131 attacaacatagaaatcattcacaacaacaacaatcactcttattctttggttgtcgttc 190
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 230 attacaacatagaaatcattcacaacaacaacaatcactcttattctttggttgtcgttc 171
Query: 191 cgatacagtcgactatatttacagagaagagttggaacaatatcatcaatcctcagtttt 250
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 170 cgatacagtcgactatatttacagagaagagttggaacaatatcatcaatcctcagtttt 111
Query: 251 aggtgatttggttgtagctttctcaagaaaaacttctcaaaaagtttatgtacaaaataa 310
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 110 aggtgatttggttgtagctttctcaagaaaaacttctcaaaaagtttatgtacaaaataa 51
Query: 311 attattggagcataaagaaaaggtttgggagttnantaaataaaggtgc 359
|||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 50 attattggagcataaagaaaaggtttgggagttnantaaataaaggtgc 2
Lambda K H
1.37 0.711 1.31
Matrix: blastn matrix:1 -3
Number of Sequences: 92845959
Number of Hits to DB: 442,546,216
Number of extensions: 28107830
Number of successful extensions: 3632409
Number of sequences better than 10.0: 321
Length of query: 359
Length of database: 95,242,211,685
Length adjustment: 23
Effective length of query: 336
Effective length of database: 93,106,754,628
Effective search space: 31283869555008
Effective search space used: 31283869555008
X1: 11 (21.8 bits)
S2: 21 (42.1 bits)
|
| protein update |
2009. 7.10 |
| Homology vs Protein |
Query= Contig-U14145-1 (Contig-U14145-1Q) /CSM_Contig/Contig-U14145-1Q.Seq.d
(359 letters)
Database: nrp_B
3,236,559 sequences; 1,051,180,864 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
FJ866626_1(FJ866626|pid:none) Citrus maxima NADPH cytochrome P45... 115 6e-25
FB899644_1(FB899644|pid:none) Sequence 118917 from Patent WO2008... 114 1e-24
AK290529_1(AK290529|pid:none) Homo sapiens cDNA FLJ77653 complet... 114 1e-24
BX648619_1(BX648619|pid:none) Homo sapiens mRNA; cDNA DKFZp686G0... 114 1e-24
DQ099544_1(DQ099544|pid:none) Petunia x hybrida cytochrome P450 ... 114 1e-24
FB899700_1(FB899700|pid:none) Sequence 118973 from Patent WO2008... 114 1e-24
AK293194_1(AK293194|pid:none) Homo sapiens cDNA FLJ50749 complet... 114 1e-24
BT061122_1(BT061122|pid:none) Zea mays full-length cDNA clone ZM... 114 1e-24
AK296096_1(AK296096|pid:none) Homo sapiens cDNA FLJ59702 complet... 114 1e-24
AK296639_1(AK296639|pid:none) Homo sapiens cDNA FLJ52316 complet... 114 1e-24
FJ719368_1(FJ719368|pid:none) Gossypium hirsutum cultivar CRI12 ... 114 1e-24
DQ099545_1(DQ099545|pid:none) Petunia x hybrida cytochrome P450 ... 113 2e-24
(P37039) RecName: Full=NADPH--cytochrome P450 reductase; ... 113 2e-24
RDPGO4(A25584;A00403)NADPH-ferrihemoprotein reductase (EC 1.6.2.... 113 2e-24
FB899630_1(FB899630|pid:none) Sequence 118903 from Patent WO2008... 113 2e-24
AB220442_1(AB220442|pid:none) Macaca fascicularis mRNA, clone Qc... 113 2e-24
EU447660_1(EU447660|pid:none) Equus caballus NADPH-cytochrome P4... 112 3e-24
AF123610_1(AF123610|pid:none) Triticum aestivum clone RED1-TA NA... 112 3e-24
FB899646_1(FB899646|pid:none) Sequence 118919 from Patent WO2008... 112 4e-24
FJ719369_1(FJ719369|pid:none) Gossypium hirsutum cultivar CRI12 ... 112 4e-24
L33893_1(L33893|pid:none) Sus scrofa NADPH-cytochrome P-450 oxid... 112 4e-24
FB899658_1(FB899658|pid:none) Sequence 118931 from Patent WO2008... 112 4e-24
FB899632_1(FB899632|pid:none) Sequence 118905 from Patent WO2008... 112 4e-24
AF302498_1(AF302498|pid:none) Hybrid poplar (Populus trichocarpa... 112 5e-24
AC135801_14(AC135801|pid:none) Medicago truncatula clone mth2-23... 111 7e-24
AF002698_1(AF002698|pid:none) Pisum sativum putative NADPH-cytoc... 111 7e-24
AF024634_1(AF024634|pid:none) Petroselinum crispum NADPH cytochr... 111 9e-24
EF144670_1(EF144670|pid:none) Populus trichocarpa clone WS01116_... 111 9e-24
AY532374_1(AY532374|pid:none) Ammi majus NADPH cytochrome P450 r... 111 9e-24
BT034782_1(BT034782|pid:none) Zea mays full-length cDNA clone ZM... 111 9e-24
AF302497_1(AF302497|pid:none) Hybrid poplar (Populus trichocarpa... 111 9e-24
AF367288_1(AF367288|pid:none) Arabidopsis thaliana AT4g30210/F9N... 110 1e-23
FB899692_1(FB899692|pid:none) Sequence 118965 from Patent WO2008... 110 1e-23
(Q3SYT8) RecName: Full=NADPH--cytochrome P450 reductase; ... 110 1e-23
FB899620_1(FB899620|pid:none) Sequence 118893 from Patent WO2008... 110 1e-23
A75961_1(A75961|pid:none) Sequence 3 from Patent WO9321326. &FB... 110 1e-23
BC103399_1(BC103399|pid:none) Bos taurus cytochrome P450 reducta... 110 1e-23
FB899694_1(FB899694|pid:none) Sequence 118967 from Patent WO2008... 110 1e-23
(P00388) RecName: Full=NADPH--cytochrome P450 reductase; ... 110 2e-23
FB899660_1(FB899660|pid:none) Sequence 118933 from Patent WO2008... 110 2e-23
M58937_1(M58937|pid:none) Rat NADPH-cytochrome P-450 oxidoreduct... 110 2e-23
U40578_2(U40578|pid:none) Cloning vector pOR262, pINIIIompA3-rat... 110 2e-23
(P37040) RecName: Full=NADPH--cytochrome P450 reductase; ... 110 2e-23
GQ144747_1(GQ144747|pid:none) Tigriopus japonicus clone TJ_040 N... 109 3e-23
(P00389) RecName: Full=NADPH--cytochrome P450 reductase; ... 109 3e-23
AX168067_1(AX168067|pid:none) Sequence 22 from Patent WO0144447. 109 3e-23
EU924793_1(EU924793|pid:none) Phascolarctos cinereus cytochrome ... 108 5e-23
AP005090_12(AP005090|pid:none) Oryza sativa Japonica Group genom... 108 5e-23
FB899634_1(FB899634|pid:none) Sequence 118907 from Patent WO2008... 108 5e-23
D83230_1(D83230|pid:none) Cricetulus griseus mRNA for NADPH-cyto... 108 6e-23
EU955593_1(EU955593|pid:none) Zea mays clone 1538546 NADPH--cyto... 108 6e-23
AB299160_1(AB299160|pid:none) Xenopus laevis NPR mRNA for NADPH-... 108 6e-23
BC059318_1(BC059318|pid:none) Xenopus laevis NADPH-P450 reductas... 108 6e-23
AY949986_1(AY949986|pid:none) Danio rerio NADPH-cytochrome P450 ... 108 8e-23
EU924792_1(EU924792|pid:none) Phascolarctos cinereus cytochrome ... 108 8e-23
AM980997_1(AM980997|pid:none) Solenostemon scutellarioides mRNA ... 107 1e-22
A75963_1(A75963|pid:none) Sequence 5 from Patent WO9321326. 107 1e-22
Z26250_1(Z26250|pid:none) H.tuberosus mRNA for NADPH-ferrihemopr... 107 1e-22
S37157(S37157)NADPH-ferrihemoprotein reductase (EC 1.6.2.4) - Je... 107 1e-22
FJ487605_1(FJ487605|pid:none) Ochlerotatus sollicitans cytochrom... 107 1e-22
AX370663_1(AX370663|pid:none) Sequence 13 from Patent WO0210407.... 107 1e-22
AY170374_1(AY170374|pid:none) Glycine max NADPH:P450 reductase m... 107 1e-22
AY520902_1(AY520902|pid:none) Hypericum androsaemum NADPH:cytoch... 107 1e-22
G88451(G88451) protein K10D2.6 [imported] - Caenorhabditis elega... 107 1e-22
EF104642_1(EF104642|pid:none) Artemisia annua cytochrome P450 re... 107 1e-22
DQ318192_1(DQ318192|pid:none) Artemisia annua cytochrome P450 re... 107 1e-22
EU956822_1(EU956822|pid:none) Zea mays clone 1574869 NADPH--cyto... 107 1e-22
(P37116) RecName: Full=NADPH--cytochrome P450 reductase; ... 107 2e-22
(Q05001) RecName: Full=NADPH--cytochrome P450 reductase; ... 107 2e-22
A47298(A47298)NADPH-ferrihemoprotein reductase (EC 1.6.2.4) - mu... 107 2e-22
FB899696_1(FB899696|pid:none) Sequence 118969 from Patent WO2008... 106 2e-22
AJ576025_1(AJ576025|pid:none) Gibberella fujikuroi cpr gene for ... 105 4e-22
EF152578_1(EF152578|pid:none) Anopheles funestus NADPH-cytochrom... 105 5e-22
AF024635_1(AF024635|pid:none) Petroselinum crispum NADPH cytochr... 104 9e-22
EF057735_1(EF057735|pid:none) Anopheles minimus NADPH-cytochrome... 104 1e-21
S37156(S37156) NADPH-ferrihemoprotein reductase (EC 1.6.2.4) - J... 104 1e-21
(Q07994) RecName: Full=NADPH--cytochrome P450 reductase; ... 103 2e-21
AP011115_3460(AP011115|pid:none) Rhodococcus opacus B4 DNA, comp... 103 2e-21
(Q6LM58) RecName: Full=Sulfite reductase [NADPH] flavoprotein al... 102 3e-21
EU111681_1(EU111681|pid:none) Cochliobolus lunatus cytochrome P4... 102 3e-21
AP007157_466(AP007157|pid:none) Aspergillus oryzae RIB40 genomic... 102 3e-21
(P19618) RecName: Full=NADPH--cytochrome P450 reductase; ... 102 4e-21
X93090_1(X93090|pid:none) D.melanogaster mRNA for NADPH-cytochro... 102 4e-21
AB439283_1(AB439283|pid:none) Phaeosphaeria sp. L487 phcpr mRNA ... 101 9e-21
BT058741_1(BT058741|pid:none) Salmo salar clone ssal-rgf-002-235... 100 2e-20
CP000581_478(CP000581|pid:none) Ostreococcus lucimarinus CCE9901... 100 2e-20
FM954972_264(FM954972|pid:none) Vibrio splendidus LGP32 chromoso... 99 4e-20
AX015713_1(AX015713|pid:none) Sequence 4 from Patent WO9950420. 99 6e-20
FM178379_402(FM178379|pid:none) Aliivibrio salmonicida LFI1238 c... 99 6e-20
(Q5E841) RecName: Full=Sulfite reductase [NADPH] flavoprotein al... 98 8e-20
AF012946_1(AF012946|pid:none) Dictyostelium discoideum RedA (red... 98 8e-20
(Q8DCK2) RecName: Full=Sulfite reductase [NADPH] flavoprotein al... 97 1e-19
CR954201_457(CR954201|pid:none) Ostreococcus tauri strain OTTH05... 97 2e-19
BC003240_1(BC003240|pid:none) Mus musculus P450 (cytochrome) oxi... 96 4e-19
(A5F3I4) RecName: Full=Sulfite reductase [NADPH] flavoprotein al... 96 4e-19
CP000498_301(CP000498|pid:none) Pichia stipitis CBS 6054 chromos... 96 4e-19
AY705446_1(AY705446|pid:none) Candida tropicalis NADPH-cytochrom... 94 2e-18
AY823228_1(AY823228|pid:none) Candida tropicalis NADPH-cytochrom... 94 2e-18
AL034463_1(AL034463|pid:none) S.pombe chromosome II cosmid c29A10. 94 2e-18
T40056(T40056)nadph-cytochrome p450 reductase - fission yeast (... 94 2e-18
(P36587) RecName: Full=NADPH--cytochrome P450 reductase; ... 94 2e-18
AF290425_1(AF290425|pid:none) Rhizopus stolonifer clone RNCPR1-F... 94 2e-18
FN392322_844(FN392322|pid:none) Pichia pastoris GS115 chromosome... 94 2e-18
CP000975_216(CP000975|pid:none) Methylacidiphilum infernorum V4,... 93 3e-18
DQ835527_1(DQ835527|pid:none) Physarum polycephalum nitric oxide... 93 3e-18
CT005266_130(CT005266|pid:none) Leishmania major strain Friedlin... 93 3e-18
CP000011_1035(CP000011|pid:none) Burkholderia mallei ATCC 23344 ... 93 3e-18
AF145040_1(AF145040|pid:none) Physarum polycephalum nitric oxide... 93 3e-18
CP000571_1741(CP000571|pid:none) Burkholderia pseudomallei 668 c... 93 3e-18
CP000573_1651(CP000573|pid:none) Burkholderia pseudomallei 1106a... 93 3e-18
CP000525_75(CP000525|pid:none) Burkholderia mallei SAVP1 chromos... 93 3e-18
CP000157_20(CP000157|pid:none) Erythrobacter litoralis HTCC2594,... 92 4e-18
AF195660_1(AF195660|pid:none) Cunninghamella echinulata NADPH-de... 92 4e-18
CP001052_1939(CP001052|pid:none) Burkholderia phytofirmans PsJN ... 92 7e-18
AE017333_1215(AE017333|pid:none) Bacillus licheniformis DSM 13, ... 92 7e-18
DQ835526_1(DQ835526|pid:none) Physarum polycephalum nitric oxide... 92 7e-18
CR954211_226(CR954211|pid:none) Ostreococcus tauri strain OTTH05... 92 7e-18
CR382139_748(CR382139|pid:none) Debaryomyces hansenii strain CBS... 92 7e-18
FM992691_286(FM992691|pid:none) Candida dubliniensis CD36 chromo... 92 7e-18
A83726(A83726) sulfite reductase (NADPH) BH0609 [imported] - Bac... 91 1e-17
AM181176_3351(AM181176|pid:none) Pseudomonas fluorescens SBW25 c... 91 1e-17
CP001504_909(CP001504|pid:none) Burkholderia glumae BGR1 chromos... 91 1e-17
AF195659_1(AF195659|pid:none) Cunninghamella elegans NADPH-depen... 91 2e-17
(P50126) RecName: Full=NADPH--cytochrome P450 reductase; ... 90 2e-17
AB126598_1(AB126598|pid:none) Yarrowia lipolytica YlCPR1 gene fo... 90 3e-17
CP001635_4738(CP001635|pid:none) Variovorax paradoxus S110 chrom... 89 4e-17
CP000507_2829(CP000507|pid:none) Shewanella amazonensis SB2B, co... 89 4e-17
AY283021_1(AY283021|pid:none) Trypanosoma brucei brucei P450 red... 89 5e-17
AL009126_3458(AL009126|pid:none) Bacillus subtilis subsp. subtil... 89 6e-17
AM942759_2227(AM942759|pid:none) Proteus mirabilis strain HI4320... 88 8e-17
CU458896_2416(CU458896|pid:none) Mycobacterium abscessus chromos... 88 8e-17
AM494965_134(AM494965|pid:none) Leishmania braziliensis chromoso... 88 1e-16
DQ417499_1(DQ417499|pid:none) Uncultured soil bacterium clone pE... 87 1e-16
CP001103_3561(CP001103|pid:none) Alteromonas macleodii 'Deep eco... 87 1e-16
DQ866862_1(DQ866862|pid:none) Mycobacterium smegmatis str. MC2 1... 87 1e-16
AE016814_66(AE016814|pid:none) Ashbya gossypii (= Eremothecium g... 87 2e-16
CP000029_2147(CP000029|pid:none) Staphylococcus epidermidis RP62... 87 2e-16
CR954246_144(CR954246|pid:none) Pseudoalteromonas haloplanktis s... 87 2e-16
BA000040_2882(BA000040|pid:none) Bradyrhizobium japonicum USDA 1... 87 2e-16
CP000750_1327(CP000750|pid:none) Kineococcus radiotolerans SRS30... 86 3e-16
CP000325_1217(CP000325|pid:none) Mycobacterium ulcerans Agy99, c... 86 3e-16
CP000511_3435(CP000511|pid:none) Mycobacterium vanbaalenii PYR-1... 86 3e-16
CP000854_3584(CP000854|pid:none) Mycobacterium marinum M, comple... 86 3e-16
CP001577_188(CP001577|pid:none) Micromonas sp. RCC299 chromosome... 86 3e-16
D25327_1(D25327|pid:none) Candida maltosa gene for NADPH cytochr... 86 4e-16
AP008955_5850(AP008955|pid:none) Brevibacillus brevis NBRC 10059... 86 5e-16
BA000030_2336(BA000030|pid:none) Streptomyces avermitilis MA-468... 86 5e-16
CR380950_178(CR380950|pid:none) Candida glabrata strain CBS138 c... 85 7e-16
CP000961_770(CP000961|pid:none) Shewanella woodyi ATCC 51908, co... 85 7e-16
CP000615_1692(CP000615|pid:none) Burkholderia vietnamiensis G4 c... 85 9e-16
AP009384_3520(AP009384|pid:none) Azorhizobium caulinodans ORS 57... 84 1e-15
DQ415920_14(DQ415920|pid:none) Cleome spinosa clone BAC Cs3, com... 84 1e-15
CP000557_1252(CP000557|pid:none) Geobacillus thermodenitrificans... 84 2e-15
AM933173_2749(AM933173|pid:none) Salmonella enterica subsp. ente... 84 2e-15
CP001026_1277(CP001026|pid:none) Burkholderia ambifaria MC40-6 c... 84 2e-15
AL954747_854(AL954747|pid:none) Nitrosomonas europaea ATCC 19718... 84 2e-15
CP000447_3167(CP000447|pid:none) Shewanella frigidimarina NCIMB ... 84 2e-15
CP000656_2997(CP000656|pid:none) Mycobacterium gilvum PYR-GCK, c... 84 2e-15
AE017282_420(AE017282|pid:none) Methylococcus capsulatus str. Ba... 84 2e-15
AP006618_5150(AP006618|pid:none) Nocardia farcinica IFM 10152 DN... 84 2e-15
CP000441_714(CP000441|pid:none) Burkholderia ambifaria AMMD chro... 84 2e-15
CP001113_2961(CP001113|pid:none) Salmonella enterica subsp. ente... 83 3e-15
CP000931_3510(CP000931|pid:none) Shewanella halifaxensis HAW-EB4... 83 3e-15
CP001120_2937(CP001120|pid:none) Salmonella enterica subsp. ente... 83 3e-15
(Q8K9D3) RecName: Full=Sulfite reductase [NADPH] flavoprotein al... 83 3e-15
(Q9UHB4) RecName: Full=NADPH-dependent diflavin oxidoreductase 1... 83 3e-15
AM933172_2776(AM933172|pid:none) Salmonella enterica subsp. ente... 83 3e-15
CP000388_4005(CP000388|pid:none) Pseudoalteromonas atlantica T6c... 83 3e-15
BC015735_1(BC015735|pid:none) Homo sapiens NADPH dependent difla... 82 5e-15
AB506804_1(AB506804|pid:none) Lehmannia valentiana limNOS2 mRNA ... 82 5e-15
CP000891_947(CP000891|pid:none) Shewanella baltica OS195, comple... 82 6e-15
DQ399020_1(DQ399020|pid:none) Ictalurus punctatus clone SAG11 NA... 82 6e-15
(A4WDW1) RecName: Full=Sulfite reductase [NADPH] flavoprotein al... 82 6e-15
CP000563_3356(CP000563|pid:none) Shewanella baltica OS155, compl... 82 6e-15
CP001252_920(CP001252|pid:none) Shewanella baltica OS223, comple... 82 6e-15
CP000964_988(CP000964|pid:none) Klebsiella pneumoniae 342, compl... 82 6e-15
AK163207_1(AK163207|pid:none) Mus musculus 7 days neonate cerebe... 82 8e-15
(A0KTH4) RecName: Full=Sulfite reductase [NADPH] flavoprotein al... 82 8e-15
(Q0HYB4) RecName: Full=Sulfite reductase [NADPH] flavoprotein al... 82 8e-15
(P38039) RecName: Full=Sulfite reductase [NADPH] flavoprotein al... 82 8e-15
(Q8Z458) RecName: Full=Sulfite reductase [NADPH] flavoprotein al... 82 8e-15
(Q6PFP6) RecName: Full=NADPH-dependent diflavin oxidoreductase 1... 82 8e-15
(A2AI05) RecName: Full=NADPH-dependent diflavin oxidoreductase 1... 82 8e-15
(Q0HFL6) RecName: Full=Sulfite reductase [NADPH] flavoprotein al... 82 8e-15
CP000821_3798(CP000821|pid:none) Shewanella sediminis HAW-EB3, c... 81 1e-14
CP000379_874(CP000379|pid:none) Burkholderia cenocepacia AU 1054... 81 1e-14
(Q3YY94) RecName: Full=Sulfite reductase [NADPH] flavoprotein al... 81 1e-14
CP000959_2579(CP000959|pid:none) Burkholderia cenocepacia MC0-3 ... 81 1e-14
CP000450_1147(CP000450|pid:none) Nitrosomonas eutropha C91, comp... 81 1e-14
CU928179_682(CU928179|pid:none) Zygosaccharomyces rouxii strain ... 81 1e-14
(Q7N8L6) RecName: Full=Sulfite reductase [NADPH] flavoprotein al... 81 1e-14
CP000250_3628(CP000250|pid:none) Rhodopseudomonas palustris HaA2... 81 1e-14
BT045271_1(BT045271|pid:none) Salmo salar clone ssal-rgf-517-046... 81 1e-14
CP000083_4621(CP000083|pid:none) Colwellia psychrerythraea 34H, ... 81 1e-14
CU468135_307(CU468135|pid:none) Erwinia tasmaniensis strain ET1/... 81 1e-14
FP236842_322(FP236842|pid:none) Erwinia pyrifoliae strain Ep1/96... 81 1e-14
CP000777_1114(CP000777|pid:none) Leptospira biflexa serovar Pato... 81 1e-14
AM910989_204(AM910989|pid:none) Plasmodium knowlesi strain H chr... 81 1e-14
CP001138_2868(CP001138|pid:none) Salmonella enterica subsp. ente... 81 1e-14
D13788_1(D13788|pid:none) Saccharomyces cerevisiae gene for NADP... 80 2e-14
(O08394) RecName: Full=Probable bifunctional P-450/NADPH-P450 re... 80 2e-14
(P16603) RecName: Full=NADPH--cytochrome P450 reductase; ... 80 2e-14
CP000926_1293(CP000926|pid:none) Pseudomonas putida GB-1, comple... 80 2e-14
BC097171_1(BC097171|pid:none) Danio rerio similar to Mtrr protei... 80 2e-14
CP000580_3205(CP000580|pid:none) Mycobacterium sp. JLS, complete... 80 2e-14
CP001349_2765(CP001349|pid:none) Methylobacterium nodulans ORS 2... 80 2e-14
AF288780_1(AF288780|pid:none) Aplysia californica nitric oxide s... 80 2e-14
CU928164_2926(CU928164|pid:none) Escherichia coli IAI39 chromoso... 80 2e-14
AY266137_1(AY266137|pid:none) Sus scrofa endothelial nitric oxid... 80 2e-14
(Q31XM4) RecName: Full=Sulfite reductase [NADPH] flavoprotein al... 80 2e-14
(Q28969) RecName: Full=Nitric oxide synthase, endothelial; ... 80 2e-14
EU714327_1(EU714327|pid:none) Sus scrofa endothelial nitric oxid... 80 2e-14
AF146040_1(AF146040|pid:none) Cavia porcellus clone 1 endothelia... 80 2e-14
AF537961_3(AF537961|pid:none) Branchiostoma floridae RNA-directe... 80 2e-14
CP000949_1258(CP000949|pid:none) Pseudomonas putida W619, comple... 80 2e-14
M23008_1(M23008|pid:none) E.coli NADPH-sulfite reductase flavopr... 80 2e-14
CU928160_2787(CU928160|pid:none) Escherichia coli IAI1 chromosom... 80 2e-14
(Q6D1A1) RecName: Full=Sulfite reductase [NADPH] flavoprotein al... 80 2e-14
CP001063_2675(CP001063|pid:none) Shigella boydii CDC 3083-94, co... 80 2e-14
DQ469808_1(DQ469808|pid:none) Sus scrofa endothelial nitric oxid... 80 2e-14
(Q8EAZ9) RecName: Full=Sulfite reductase [NADPH] flavoprotein al... 80 3e-14
(Q968X7) RecName: Full=Pyruvate dehydrogenase [NADP+]; ... 80 3e-14
EU111680_1(EU111680|pid:none) Cochliobolus lunatus cytochrome P4... 80 3e-14
BX571856_2647(BX571856|pid:none) Staphylococcus aureus subsp. au... 79 4e-14
CT573326_1292(CT573326|pid:none) Pseudomonas entomophila str. L4... 79 4e-14
(A4TPY5) RecName: Full=Sulfite reductase [NADPH] flavoprotein al... 79 4e-14
CP000901_892(CP000901|pid:none) Yersinia pestis Angola, complete... 79 4e-14
CP000302_923(CP000302|pid:none) Shewanella denitrificans OS217, ... 79 4e-14
BA000033_2540(BA000033|pid:none) Staphylococcus aureus subsp. au... 79 4e-14
AP009324_2605(AP009324|pid:none) Staphylococcus aureus subsp. au... 79 4e-14
(A7MJ63) RecName: Full=Sulfite reductase [NADPH] flavoprotein al... 79 4e-14
CP000703_2605(CP000703|pid:none) Staphylococcus aureus subsp. au... 79 4e-14
(A7FLZ0) RecName: Full=Sulfite reductase [NADPH] flavoprotein al... 79 4e-14
(Q66ED4) RecName: Full=Sulfite reductase [NADPH] flavoprotein al... 79 4e-14
CU458896_2470(CU458896|pid:none) Mycobacterium abscessus chromos... 79 5e-14
AF380137_1(AF380137|pid:none) Takifugu poecilonotus neuronal nit... 79 5e-14
(A9N2E6) RecName: Full=Sulfite reductase [NADPH] flavoprotein al... 79 5e-14
(Q8FEI7) RecName: Full=Sulfite reductase [NADPH] flavoprotein al... 79 7e-14
AK292928_1(AK292928|pid:none) Homo sapiens cDNA FLJ77889 complet... 79 7e-14
(P29474) RecName: Full=Nitric oxide synthase, endothelial; ... 79 7e-14
(A8G9X6) RecName: Full=Sulfite reductase [NADPH] flavoprotein al... 79 7e-14
BC063294_1(BC063294|pid:none) Homo sapiens nitric oxide synthase... 79 7e-14
FM180568_3027(FM180568|pid:none) Escherichia coli 0127:H6 E2348/... 79 7e-14
X76303_1(X76303|pid:none) H.sapiens endothelial nitric oxidase s... 79 7e-14
D26607_1(D26607|pid:none) Homo sapiens endothelial nitric oxide ... 79 7e-14
(A1AEV0) RecName: Full=Sulfite reductase [NADPH] flavoprotein al... 79 7e-14
A46717_1(A46717|pid:none) Sequence 3 from Patent WO9527070. &M9... 79 7e-14
CU928162_3135(CU928162|pid:none) Escherichia coli ED1a chromosom... 79 7e-14
AK300390_1(AK300390|pid:none) Homo sapiens cDNA FLJ50216 complet... 79 7e-14
AE003849_1495(AE003849|pid:none) Xylella fastidiosa 9a5c, comple... 78 9e-14
(P14779) RecName: Full=Bifunctional P-450/NADPH-P450 reductase; ... 78 9e-14
CS165301_1(CS165301|pid:none) Sequence 7 from Patent WO2005083100. 78 9e-14
AX025034_1(AX025034|pid:none) Sequence 2 from Patent WO0031273. ... 78 9e-14
AB065368_1(AB065368|pid:none) Coriolus versicolor CPR mRNA for C... 78 9e-14
AX078738_1(AX078738|pid:none) Sequence 34 from Patent WO0107573.... 78 9e-14
AY179960_1(AY179960|pid:none) Oryctolagus cuniculus endothelial ... 78 9e-14
AF240673_1(AF240673|pid:none) Pseudomonas putida KT2442 sulfite ... 78 9e-14
AP007171_774(AP007171|pid:none) Aspergillus oryzae RIB40 genomic... 78 1e-13
AC009755_6(AC009755|pid:none) Arabidopsis thaliana chromosome II... 78 1e-13
CP000253_2790(CP000253|pid:none) Staphylococcus aureus subsp. au... 78 1e-13
(Q9TUX8) RecName: Full=Nitric oxide synthase, endothelial; ... 78 1e-13
CP001091_1930(CP001091|pid:none) Actinobacillus pleuropneumoniae... 78 1e-13
CU928171_270(CU928171|pid:none) Kluyveromyces thermotolerans str... 78 1e-13
AK229452_1(AK229452|pid:none) Arabidopsis thaliana mRNA for hypo... 78 1e-13
AE016879_2956(AE016879|pid:none) Bacillus anthracis str. Ames, c... 78 1e-13
CP000569_1817(CP000569|pid:none) Actinobacillus pleuropneumoniae... 78 1e-13
CP000250_1749(CP000250|pid:none) Rhodopseudomonas palustris HaA2... 78 1e-13
CP000127_1248(CP000127|pid:none) Nitrosococcus oceani ATCC 19707... 77 1e-13
CU651637_2623(CU651637|pid:none) Escherichia coli LF82 chromosom... 77 1e-13
AC148995_22(AC148995|pid:none) Medicago truncatula chromosome 7 ... 77 1e-13
(Q2NVN4) RecName: Full=Sulfite reductase [NADPH] flavoprotein al... 77 1e-13
CP000476_197(CP000476|pid:none) Arthrobacter aurescens TC1 plasm... 77 2e-13
CP000908_2202(CP000908|pid:none) Methylobacterium extorquens PA1... 77 2e-13
AY904363_1(AY904363|pid:none) Carassius auratus inducible nitric... 77 2e-13
CU468135_2711(CU468135|pid:none) Erwinia tasmaniensis strain ET1... 77 2e-13
AY582749_1(AY582749|pid:none) Sepia officinalis nitric oxide syn... 77 2e-13
BC100107_1(BC100107|pid:none) Rattus norvegicus 5-methyltetrahyd... 76 3e-13
BC025942_1(BC025942|pid:none) Mus musculus 5-methyltetrahydrofol... 76 3e-13
AK028628_1(AK028628|pid:none) Mus musculus 10 days neonate skin ... 76 3e-13
CP000943_3540(CP000943|pid:none) Methylobacterium sp. 4-46, comp... 76 4e-13
CP000903_2853(CP000903|pid:none) Bacillus weihenstephanensis KBA... 76 4e-13
AY533030_1(AY533030|pid:none) Fundulus heteroclitus putative neu... 76 4e-13
CP001001_1752(CP001001|pid:none) Methylobacterium radiotolerans ... 76 4e-13
FJ864729_1(FJ864729|pid:none) Bacillus cereus strain BC002 NADPH... 76 4e-13
CP001407_3085(CP001407|pid:none) Bacillus cereus 03BB102, comple... 76 4e-13
CP001349_1741(CP001349|pid:none) Methylobacterium nodulans ORS 2... 75 6e-13
CP001177_3075(CP001177|pid:none) Bacillus cereus AH187, complete... 75 6e-13
BX572605_3(BX572605|pid:none) Rhodopseudomonas palustris CGA009 ... 75 6e-13
CP001096_4165(CP001096|pid:none) Rhodopseudomonas palustris TIE-... 75 6e-13
CP001176_3082(CP001176|pid:none) Bacillus cereus B4264, complete... 75 6e-13
CP000941_773(CP000941|pid:none) Xylella fastidiosa M12, complete... 75 6e-13
CP000001_2889(CP000001|pid:none) Bacillus cereus E33L, complete ... 75 7e-13
CP001032_3773(CP001032|pid:none) Opitutus terrae PB90-1, complet... 75 7e-13
CP000016_154(CP000016|pid:none) Candidatus Blochmannia pennsylva... 75 7e-13
BC052636_1(BC052636|pid:none) Mus musculus nitric oxide synthase... 75 7e-13
(P70313) RecName: Full=Nitric oxide synthase, endothelial; ... 75 7e-13
AL929554_18(AL929554|pid:none) Human DNA sequence from clone RP1... 75 7e-13
EF043802_1(EF043802|pid:none) Synthetic construct clone ATCC 103... 75 7e-13
AJ011116_1(AJ011116|pid:none) Rattus norvegicus mRNA for endothe... 75 7e-13
CU234118_3590(CU234118|pid:none) Bradyrhizobium sp. ORS278,compl... 75 7e-13
(Q65T53) RecName: Full=Sulfite reductase [NADPH] flavoprotein al... 75 7e-13
(Q62600) RecName: Full=Nitric oxide synthase, endothelial; ... 75 7e-13
(A9MF16) RecName: Full=Sulfite reductase [NADPH] flavoprotein al... 75 7e-13
AE009442_677(AE009442|pid:none) Xylella fastidiosa Temecula1, co... 75 9e-13
AY695391_1(AY695391|pid:none) Rattus norvegicus strain SS/JrHsdM... 75 9e-13
CP001158_389(CP001158|pid:none) Buchnera aphidicola str. Tuc7 (A... 75 9e-13
CP001196_540(CP001196|pid:none) Oligotropha carboxidovorans OM5 ... 75 9e-13
(Q1LTP1) RecName: Full=Sulfite reductase [NADPH] flavoprotein al... 75 9e-13
CP001161_391(CP001161|pid:none) Buchnera aphidicola str. 5A (Acy... 75 9e-13
(P57503) RecName: Full=Sulfite reductase [NADPH] flavoprotein al... 75 9e-13
AK066744_1(AK066744|pid:none) Oryza sativa Japonica Group cDNA c... 75 9e-13
CP001011_733(CP001011|pid:none) Xylella fastidiosa M23, complete... 75 9e-13
(P29476) RecName: Full=Nitric oxide synthase, brain; EC... 75 9e-13
CP000697_2763(CP000697|pid:none) Acidiphilium cryptum JF-5, comp... 75 9e-13
U17326_1(U17326|pid:none) Homo sapiens neuronal nitric oxide syn... 74 1e-12
CP001186_3147(CP001186|pid:none) Bacillus cereus G9842, complete... 74 1e-12
CP001029_2160(CP001029|pid:none) Methylobacterium populi BJ001, ... 74 1e-12
(P29475) RecName: Full=Nitric oxide synthase, brain; EC... 74 1e-12
EU961065_1(EU961065|pid:none) Zea mays clone 232573 NADPH reduct... 74 1e-12
A46716_1(A46716|pid:none) Sequence 2 from Patent WO9527070. &L0... 74 1e-12
CP000943_5211(CP000943|pid:none) Methylobacterium sp. 4-46, comp... 74 1e-12
CP001298_4749(CP001298|pid:none) Methylobacterium chloromethanic... 74 2e-12
CP000115_589(CP000115|pid:none) Nitrobacter winogradskyi Nb-255,... 74 2e-12
(O19132) RecName: Full=Nitric oxide synthase, brain; EC... 74 2e-12
CP000908_4430(CP000908|pid:none) Methylobacterium extorquens PA1... 74 2e-12
BT034984_1(BT034984|pid:none) Zea mays full-length cDNA clone ZM... 74 2e-12
AM295250_58(AM295250|pid:none) Staphylococcus carnosus subsp. ca... 74 2e-12
AM743169_2612(AM743169|pid:none) Stenotrophomonas maltophilia K2... 74 2e-12
CP001029_4907(CP001029|pid:none) Methylobacterium populi BJ001, ... 74 2e-12
CP000746_1657(CP000746|pid:none) Actinobacillus succinogenes 130... 74 2e-12
FJ362508_1(FJ362508|pid:none) Sus scrofa nitric oxide synthase (... 74 2e-12
CP001510_4573(CP001510|pid:none) Methylobacterium extorquens AM1... 73 3e-12
AY211528_1(AY211528|pid:none) Danio rerio neuronal nitric oxide ... 73 3e-12
(A9LZ73) RecName: Full=Sulfite reductase [NADPH] flavoprotein al... 73 3e-12
U67309_1(U67309|pid:none) Rattus norvegicus neuronal nitric oxid... 73 3e-12
BA000040_4570(BA000040|pid:none) Bradyrhizobium japonicum USDA 1... 73 4e-12
CP001050_1002(CP001050|pid:none) Neisseria gonorrhoeae NCCP11945... 73 4e-12
AE017344_125(AE017344|pid:none) Cryptococcus neoformans var. neo... 73 4e-12
AY043287_1(AY043287|pid:none) Aplysia californica nitric oxide s... 73 4e-12
DQ084520_1(DQ084520|pid:none) Bos taurus 5-methyltetrahydrofolat... 72 5e-12
CP000813_1658(CP000813|pid:none) Bacillus pumilus SAFR-032, comp... 72 5e-12
AM902716_3059(AM902716|pid:none) Bordetella petrii strain DSM 12... 72 6e-12
CR858039_1(CR858039|pid:none) Pongo abelii mRNA; cDNA DKFZp459J1... 72 6e-12
CR382134_644(CR382134|pid:none) Debaryomyces hansenii strain CBS... 72 6e-12
(Q9JS45) RecName: Full=Sulfite reductase [NADPH] flavoprotein al... 72 6e-12
AB333805_1(AB333805|pid:none) Lehmannia valentiana limNOS mRNA f... 72 6e-12
CP000109_1890(CP000109|pid:none) Thiomicrospira crunogena XCL-2,... 72 6e-12
(A1KU06) RecName: Full=Sulfite reductase [NADPH] flavoprotein al... 72 6e-12
AF223942_1(AF223942|pid:none) Ovis aries inducible nitric oxide ... 72 6e-12
CP000498_441(CP000498|pid:none) Pichia stipitis CBS 6054 chromos... 72 8e-12
EU332350_1(EU332350|pid:none) Danio rerio nitric oxide synthase ... 72 8e-12
AM920427_858(AM920427|pid:none) Penicillium chrysogenum Wisconsi... 72 8e-12
(O54705) RecName: Full=Nitric oxide synthase, inducible; ... 72 8e-12
AF025794_1(AF025794|pid:none) Homo sapiens methionine synthase r... 71 1e-11
(Q9HDG2) RecName: Full=NADPH--cytochrome P450 reductase; ... 71 1e-11
CP000463_1250(CP000463|pid:none) Rhodopseudomonas palustris BisA... 71 1e-11
JC5028(JC5028)nitric-oxide synthase (EC 1.14.13.39) L - rat 71 1e-11
AP007154_514(AP007154|pid:none) Aspergillus oryzae RIB40 genomic... 71 1e-11
AF121213_1(AF121213|pid:none) Homo sapiens methionine synthase r... 71 1e-11
BC054816_1(BC054816|pid:none) Homo sapiens 5-methyltetrahydrofol... 71 1e-11
AF049656_1(AF049656|pid:none) Homo sapiens inducible nitric oxid... 71 1e-11
EF562453_1(EF562453|pid:none) Bubalus bubalis inducible nitric o... 71 1e-11
S47647(S47647;JC1472) nitric-oxide synthase (EC 1.14.13.39) - ra... 71 1e-11
AL929357_73(AL929357|pid:none) Plasmodium falciparum strain 3D7,... 71 1e-11
I56575(I56575) nitric-oxide synthase (EC 1.14.13.39) [similarity... 71 1e-11
(O19114) RecName: Full=Nitric oxide synthase, inducible; ... 71 1e-11
D12520_1(D12520|pid:none) Rattus norvegicus mRNA for nitric oxid... 71 1e-11
AJ230462_1(AJ230462|pid:none) Rattus norvegicus gene encoding in... 71 1e-11
D14051_1(D14051|pid:none) Rattus norvegicus mRNA for nitric oxid... 71 1e-11
(Q7VQH2) RecName: Full=Sulfite reductase [NADPH] flavoprotein al... 71 1e-11
CP000113_2269(CP000113|pid:none) Myxococcus xanthus DK 1622, com... 71 1e-11
U43428_1(U43428|pid:none) Mus musculus inducible nitric oxide sy... 70 2e-11
AM884176_689(AM884176|pid:none) Chlamydia trachomatis strain L2/... 70 2e-11
AY211532_1(AY211532|pid:none) Rattus norvegicus inducible nitric... 70 2e-11
EU000565_1(EU000565|pid:none) Numida meleagris iNOS mRNA, partia... 70 2e-11
AY027883_1(AY027883|pid:none) Equus caballus inducible nitric ox... 70 2e-11
AE008922_3124(AE008922|pid:none) Xanthomonas campestris pv. camp... 70 2e-11
AF065922_1(AF065922|pid:none) Mus musculus strain SJL/J nitric o... 70 2e-11
AE001273_445(AE001273|pid:none) Chlamydia trachomatis D/UW-3/CX,... 70 2e-11
AJ242906_1(AJ242906|pid:none) Cyprinus carpio mRNA for inducible... 70 2e-11
L12562_1(L12562|pid:none) Rat nitric oxide synthase mRNA, comple... 70 2e-11
AF065923_1(AF065923|pid:none) Mus musculus strain NOD/LtJ nitric... 70 2e-11
U05810_1(U05810|pid:none) Human inducible nitric oxide synthase ... 70 2e-11
AB022318_1(AB022318|pid:none) Homo sapiens mRNA for inducible ni... 70 2e-11
AJ295231_1(AJ295231|pid:none) Oncorhynchus mykiss iNOS/NOS2 gene... 70 2e-11
AB477987_1(AB477987|pid:none) Gryllus bimaculatus NOS mRNA for n... 70 3e-11
AY904362_1(AY904362|pid:none) Carassius auratus inducible nitric... 69 4e-11
AF065919_1(AF065919|pid:none) Mus musculus strain BALB/cByJ nitr... 69 4e-11
CP001132_2650(CP001132|pid:none) Acidithiobacillus ferrooxidans ... 69 4e-11
BA000030_579(BA000030|pid:none) Streptomyces avermitilis MA-4680... 69 4e-11
AB485776_1(AB485776|pid:none) Bombyx mori mRNA for nitric-oxide ... 69 5e-11
CP000875_2508(CP000875|pid:none) Herpetosiphon aurantiacus ATCC ... 69 5e-11
AB360590_1(AB360590|pid:none) Bombyx mori NSL mRNA for nitric-ox... 69 7e-11
AY046510_1(AY046510|pid:none) Adenoviral expression vector Ad-hi... 69 7e-11
AF051164_1(AF051164|pid:none) Homo sapiens heart muscle inducibl... 68 9e-11
S65440(S65440)nitric-oxide synthase (EC 1.14.13.39) - rat 68 1e-10
AL132858_8(AL132858|pid:none) Caenorhabditis elegans YAC Y113G7A... 67 2e-10
CP000150_276(CP000150|pid:none) Burkholderia sp. 383 chromosome ... 67 2e-10
AB304919_1(AB304919|pid:none) Luciola lateralis LlNOS mRNA for n... 67 2e-10
T13254(T13254) nitric-oxide synthase (EC 1.14.13.39) - fruit fly... 67 2e-10
CP000656_345(CP000656|pid:none) Mycobacterium gilvum PYR-GCK, co... 67 3e-10
CP000581_287(CP000581|pid:none) Ostreococcus lucimarinus CCE9901... 67 3e-10
CT005271_281(CT005271|pid:none) Leishmania major strain Friedlin... 66 3e-10
(Q9Y8G7) RecName: Full=Bifunctional P-450:NADPH-P450 reductase; ... 66 3e-10
EU304749_1(EU304749|pid:none) Anopheles bwambae isolate BWA11_A ... 66 3e-10
CR382131_669(CR382131|pid:none) Yarrowia lipolytica strain CLIB1... 66 4e-10
AE015925_192(AE015925|pid:none) Chlamydophila caviae GPIC, compl... 66 4e-10
AY878119_1(AY878119|pid:none) Pichia pastoris sulfite reductase ... 66 4e-10
CP000094_796(CP000094|pid:none) Pseudomonas fluorescens Pf0-1, c... 66 4e-10
FN392322_381(FN392322|pid:none) Pichia pastoris GS115 chromosome... 66 4e-10
AM260480_994(AM260480|pid:none) Ralstonia eutropha H16 chromosom... 65 6e-10
AB304920_1(AB304920|pid:none) Luciola cruciata LcNOS mRNA for ni... 65 6e-10
AE002160_705(AE002160|pid:none) Chlamydia muridarum Nigg, comple... 65 6e-10
EU871591_1(EU871591|pid:none) Saccharomyces cerevisiae sulfite r... 65 7e-10
EF058171_1(EF058171|pid:none) Saccharomyces cerevisiae isolate U... 65 7e-10
EF058165_1(EF058165|pid:none) Saccharomyces cerevisiae isolate U... 65 7e-10
EU304779_1(EU304779|pid:none) Anopheles merus isolate MER569_A N... 65 7e-10
EU304761_1(EU304761|pid:none) Anopheles gambiae isolate GAM08_B ... 65 7e-10
EF058167_1(EF058167|pid:none) Saccharomyces cerevisiae isolate U... 65 7e-10
EU304742_1(EU304742|pid:none) Anopheles arabiensis isolate ARA01... 65 7e-10
EF058164_1(EF058164|pid:none) Saccharomyces cerevisiae isolate U... 65 7e-10
EU304746_1(EU304746|pid:none) Anopheles arabiensis isolate ARA06... 65 7e-10
EU304743_1(EU304743|pid:none) Anopheles arabiensis isolate ARA03... 65 7e-10
CR380950_223(CR380950|pid:none) Candida glabrata strain CBS138 c... 65 7e-10
EF058170_1(EF058170|pid:none) Saccharomyces cerevisiae isolate U... 65 7e-10
EU304754_1(EU304754|pid:none) Anopheles bwambae isolate BWA14_B ... 65 7e-10
EF058166_1(EF058166|pid:none) Saccharomyces cerevisiae isolate U... 65 7e-10
EU304786_1(EU304786|pid:none) Anopheles quadriannulatus isolate ... 65 7e-10
EU304751_1(EU304751|pid:none) Anopheles bwambae isolate BWA12_A ... 65 7e-10
EU304762_1(EU304762|pid:none) Anopheles gambiae isolate GAM63 NO... 65 7e-10
AM494957_223(AM494957|pid:none) Leishmania braziliensis chromoso... 65 7e-10
AM502252_228(AM502252|pid:none) Leishmania infantum chromosome 34. 65 1e-09
BX950211_4(BX950211|pid:none) Zebrafish DNA sequence from clone ... 65 1e-09
CU633897_331(CU633897|pid:none) Podospora anserina genomic DNA c... 64 1e-09
EU871590_1(EU871590|pid:none) Saccharomyces cerevisiae sulfite r... 64 1e-09
EU304758_1(EU304758|pid:none) Anopheles gambiae isolate GAM06 NO... 64 1e-09
EF215204_1(EF215204|pid:none) Callithrix jacchus clone C12-53.3_... 64 2e-09
CR848038_190(CR848038|pid:none) Chlamydophila abortus strain S26... 64 2e-09
AY036119_1(AY036119|pid:none) Discosoma striata nitric oxide syn... 64 2e-09
EU304775_1(EU304775|pid:none) Anopheles merus isolate MER317_B N... 64 2e-09
CU928169_198(CU928169|pid:none) Kluyveromyces thermotolerans str... 64 2e-09
AC087325_14(AC087325|pid:none) Trypanosoma brucei chromosome 4 c... 63 3e-09
EU449979_3(EU449979|pid:none) Fusarium oxysporum strain FRC O-18... 63 4e-09
CP000927_3979(CP000927|pid:none) Caulobacter sp. K31, complete g... 63 4e-09
CP000949_4292(CP000949|pid:none) Pseudomonas putida W619, comple... 62 6e-09
EF058169_1(EF058169|pid:none) Saccharomyces cerevisiae isolate U... 62 6e-09
AE015451_851(AE015451|pid:none) Pseudomonas putida KT2440 comple... 62 6e-09
CP000749_225(CP000749|pid:none) Marinomonas sp. MWYL1, complete ... 62 8e-09
CP000076_843(CP000076|pid:none) Pseudomonas fluorescens Pf-5, co... 61 1e-08
AM181176_788(AM181176|pid:none) Pseudomonas fluorescens SBW25 co... 61 1e-08
BX908810_14(BX908810|pid:none) Neurospora crassa DNA linkage gro... 60 2e-08
AE005673_3037(AE005673|pid:none) Caulobacter crescentus CB15, co... 60 2e-08
AB071182_1(AB071182|pid:none) Bombyx mori BmNOS mRNA for nitric ... 60 2e-08
FN357385_7(FN357385|pid:none) Schistosoma mansoni genome sequenc... 60 2e-08
AP009384_3425(AP009384|pid:none) Azorhizobium caulinodans ORS 57... 60 2e-08
CP000560_2338(CP000560|pid:none) Bacillus amyloliquefaciens FZB4... 60 2e-08
CP000926_897(CP000926|pid:none) Pseudomonas putida GB-1, complet... 60 2e-08
CU207211_3223(CU207211|pid:none) Herminiimonas arsenicoxydans ch... 60 2e-08
(Q4HZQ1) RecName: Full=Probable NADPH reductase TAH18; ... 59 4e-08
AP009384_1828(AP009384|pid:none) Azorhizobium caulinodans ORS 57... 59 4e-08
CU633901_208(CU633901|pid:none) Podospora anserina genomic DNA c... 59 4e-08
(Q4P3D8) RecName: Full=Probable NADPH reductase TAH18; ... 59 5e-08
AF198443_1(AF198443|pid:none) Oryctolagus cuniculus inducible ni... 59 5e-08
AE016853_4463(AE016853|pid:none) Pseudomonas syringae pv. tomato... 59 5e-08
AY051726_1(AY051726|pid:none) Drosophila melanogaster LD25514 fu... 59 7e-08
AE014296_1532(AE014296|pid:none) Drosophila melanogaster chromos... 59 7e-08
CR954217_4(CR954217|pid:none) Ostreococcus tauri strain OTTH0595... 58 9e-08
CP000744_5067(CP000744|pid:none) Pseudomonas aeruginosa PA7, com... 57 2e-07
EU826018_1(EU826018|pid:none) Magnaporthe oryzae isolate P131 Pm... 57 2e-07
AF093837_1(AF093837|pid:none) Rattus norvegicus nitric oxide syn... 57 2e-07
CP000304_986(CP000304|pid:none) Pseudomonas stutzeri A1501, comp... 57 2e-07
CR382136_912(CR382136|pid:none) Debaryomyces hansenii chromosome... 57 2e-07
CP000496_21(CP000496|pid:none) Pichia stipitis CBS 6054 chromoso... 57 3e-07
CP000712_2695(CP000712|pid:none) Pseudomonas putida F1, complete... 57 3e-07
AM270385_19(AM270385|pid:none) Aspergillus niger contig An17c003... 56 3e-07
DQ980196_1(DQ980196|pid:none) Trypanosoma cruzi cytochrome P450 ... 56 3e-07
AB035645_1(AB035645|pid:none) Zea mays L-FNRII mRNA for ferredox... 56 3e-07
AY813027_1(AY813027|pid:none) Schistosoma japonicum SJCHGC07242 ... 56 3e-07
BT038551_1(BT038551|pid:none) Zea mays full-length cDNA clone ZM... 56 3e-07
AE004091_4512(AE004091|pid:none) Pseudomonas aeruginosa PAO1, co... 55 6e-07
FM209186_4893(FM209186|pid:none) Pseudomonas aeruginosa LESB58 c... 55 6e-07
AF051690_3(AF051690|pid:none) Pseudomonas aeruginosa iron-uptake... 55 6e-07
BX640428_192(BX640428|pid:none) Bordetella parapertussis strain ... 55 6e-07
CP000353_1761(CP000353|pid:none) Ralstonia metallidurans CH34 me... 55 8e-07
CP000680_786(CP000680|pid:none) Pseudomonas mendocina ymp, compl... 55 8e-07
CP000393_3190(CP000393|pid:none) Trichodesmium erythraeum IMS101... 55 1e-06
CR543861_714(CR543861|pid:none) Acinetobacter sp. ADP1 complete ... 55 1e-06
CP000284_427(CP000284|pid:none) Methylobacillus flagellatus KT, ... 55 1e-06
AK065309_1(AK065309|pid:none) Oryza sativa Japonica Group cDNA c... 54 1e-06
CP000544_186(CP000544|pid:none) Halorhodospira halophila SL1, co... 54 2e-06
CP001157_1196(CP001157|pid:none) Azotobacter vinelandii DJ, comp... 54 2e-06
AB113346_1(AB113346|pid:none) Arthrospira platensis petH gene fo... 54 2e-06
AY810022_1(AY810022|pid:none) Schistosoma japonicum SJCHGC02355 ... 54 2e-06
AJ457980_1(AJ457980|pid:none) Triticum aestivum mRNA for ferredo... 54 2e-06
AF453501_8(AF453501|pid:none) Actinosynnema pretiosum subsp. aur... 54 2e-06
BT040810_1(BT040810|pid:none) Zea mays full-length cDNA clone ZM... 54 2e-06
AK226411_1(AK226411|pid:none) Arabidopsis thaliana mRNA for ferr... 54 2e-06
CP000934_2468(CP000934|pid:none) Cellvibrio japonicus Ueda107, c... 54 2e-06
EU961740_1(EU961740|pid:none) Zea mays clone 237984 ferredoxin--... 53 3e-06
AM270362_9(AM270362|pid:none) Aspergillus niger contig An16c0100... 53 3e-06
>FJ866626_1(FJ866626|pid:none) Citrus maxima NADPH cytochrome P450
reductase mRNA, partial cds.
Length = 209
Score = 115 bits (287), Expect = 6e-25
Identities = 58/110 (52%), Positives = 77/110 (70%), Gaps = 2/110 (1%)
Frame = +3
Query: 15 PLFVRESHFKLPSAATEQKPVIMVGPGTGLAPFRGFLQELQHRNHSQQQ--QSLLFFGCR 188
P+FVR+S+FKLP+ A + P+IM+GPGTGLAPFRGFLQE + + SLLFFGCR
Sbjct: 43 PIFVRQSNFKLPADA--KVPIIMIGPGTGLAPFRGFLQERFALKEAGAELGPSLLFFGCR 100
Query: 189 SDTVDYIYREELEQYHQSSVLGDLVVAFSRKTSQKVYVQNKLLEHKEKVW 338
+ +DYIY +EL + QS L L+VAFSR+ K YVQ+K++E +W
Sbjct: 101 NRKMDYIYEDELNNFVQSGALSQLIVAFSREGPTKEYVQHKMMEKSSDIW 150
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3236559
Number of Hits to DB: 518,299,795
Number of extensions: 8590250
Number of successful extensions: 23821
Number of sequences better than 10.0: 743
Number of HSP's gapped: 23062
Number of HSP's successfully gapped: 745
Length of query: 119
Length of database: 1,051,180,864
Length adjustment: 85
Effective length of query: 34
Effective length of database: 776,073,349
Effective search space: 26386493866
Effective search space used: 26386493866
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 28 (15.4 bits)
|
| PSORT |
|
| VS (DIR, S) |
0 |
| VH (FL, L) |
0 |
| VF (FL, S) |
0 |
| AH (FL, L) |
1 |
| AF (FL, S) |
0 |
| SL (DIR, L) |
0 |
| SS (DIR, S) |
0 |
| SH (FL, L) |
0 |
| SF (FL, S) |
0 |
| CH (FL, L) |
0 |
| CF (FL, S) |
0 |
| FCL (DIR, L) |
0 |
| FC (DIR, S) |
0 |
| FC-IC (SUB) |
0 |