>Contig-U14072-1 (Contig-U14072-1Q) /CSM_Contig/Contig-U14072-1Q.Seq.d
NNNNNNNNNNACAACCAAAATTAATTTTAAATAATATCGATAATAAATAT
AAAATAAACGNCGNCGATAATGACGACGACGACGACGACGATGATGAGGA
TGGTTTAAATTTTAATATTTTAAAAAAAACAAATACATCTTCAGATATTG
CTTCAAATGCATTAAAAGATAATATGGGTAGTATAATGGGAGTTCATGCA
ATTGCTCAACAAGCTGTTGAGGAATTAACAGAGAAACAATTTTATCAATC
ACAAGAAAATATACATAATAAACCAATAGTTTTAGTGGTTGAAGGATAAT
CCAGAGATGAATAGATTCATTGCAGAGTTATTAAGTAAATATTATTTCGT
GGTCACAGCATTCGATGGTGTTGAGGGCATTGAAAAGACAAGAGCAATAA
CACCCGATCTCATTGTAACCGATTGTATGATGCCACGTATGAGTGGTGAT
GAAATGGTTGAACAATTAAGATCCGATGAACAATTTGATAATATTCCTAT
ACTTTTATTAAACTGC

est1=AHH574Z,1,507

XXXQPKLILNNIDNKYKINXXDNDDDDDDDDEDGLNFNILKKTNTSSDIASNALKDNMGS
IMGVHAIAQQAVEELTEKQFYQSQENIHNKPIVLVVEG*srde*ihcrvik*ilfrghsi
rwc*gh*kdksnntrshcnrlydatyew**ng*tikir*ti**ysytfikl

Frame A:
xxxxnqn*f*iisiinik*txximttttttmmrmv*ilif*kkqihlqillqmh*kiiwv
v*wefmqllnkllrn*qrnnfinhkkiyiinq*f*wlkdnpemnrfiaellskyyfvvta
fdgvegiektraitpdlivtdcmmprmsgdemveqlrsdeqfdnipilllnc


Frame B:
xxxttkinfk*yr**i*nkrrr**rrrrrr**gwfkf*yfkknkyifrycfkcikr*yg*
yngsscncstsc*ginretilsitrkyt**tnsfsg*riiqr*idslqsy*vniiswsqh
smvlralkrqeq*hpisl*piv*chv*vvmkwlnn*dpmnnliiflyfy*t


Frame C:
XXXQPKLILNNIDNKYKINXXDNDDDDDDDDEDGLNFNILKKTNTSSDIASNALKDNMGS
IMGVHAIAQQAVEELTEKQFYQSQENIHNKPIVLVVEG*srde*ihcrvik*ilfrghsi
rwc*gh*kdksnntrshcnrlydatyew**ng*tikir*ti**ysytfikl

Query= Contig-U14072-1 (Contig-U14072-1Q)
/CSM_Contig/Contig-U14072-1Q.Seq.d
         (516 letters)

Database: CSM
           6905 sequences; 5,674,871 total letters


                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

Contig-U14072-1 (Contig-U14072-1Q) /CSM_Contig/Conti...   795  0.0
Contig-U11921-1 (Contig-U11921-1Q) /CSM_Contig/Conti...    34  0.14
Contig-U09585-1 (Contig-U09585-1Q) /CSM_Contig/Conti...    34  0.14
Contig-U06322-1 (Contig-U06322-1Q) /CSM_Contig/Conti...    34  0.14
Contig-U06218-1 (Contig-U06218-1Q) /CSM_Contig/Conti...    34  0.14
Contig-U04466-1 (Contig-U04466-1Q) /CSM_Contig/Conti...    34  0.14
Contig-U14510-1 (Contig-U14510-1Q) /CSM_Contig/Conti...    32  0.56
Contig-U14476-1 (Contig-U14476-1Q) /CSM_Contig/Conti...    32  0.56
Contig-U13347-1 (Contig-U13347-1Q) /CSM_Contig/Conti...    32  0.56
Contig-U12230-1 (Contig-U12230-1Q) /CSM_Contig/Conti...    32  0.56

>Contig-U14072-1 (Contig-U14072-1Q) /CSM_Contig/Contig-U14072-1Q.Seq.d
          Length = 516

 Score =  795 bits (401), Expect = 0.0
 Identities = 417/425 (98%)
 Strand = Plus / Plus

                                                                       
Query: 92  tgatgaggatggtttaaattttaatattttnnnnnnnncaaatacatcttcagatattgc 151
           ||||||||||||||||||||||||||||||        ||||||||||||||||||||||
Sbjct: 92  tgatgaggatggtttaaattttaatattttaaaaaaaacaaatacatcttcagatattgc 151

                                                                       
Query: 152 ttcaaatgcattaaaagataatatgggtagtataatgggagttcatgcaattgctcaaca 211
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 152 ttcaaatgcattaaaagataatatgggtagtataatgggagttcatgcaattgctcaaca 211

                                                                       
Query: 212 agctgttgaggaattaacagagaaacaattttatcaatcacaagaaaatatacataataa 271
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 212 agctgttgaggaattaacagagaaacaattttatcaatcacaagaaaatatacataataa 271

                                                                       
Query: 272 accaatagttttagtggttgaaggataatccagagatgaatagattcattgcagagttat 331
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 272 accaatagttttagtggttgaaggataatccagagatgaatagattcattgcagagttat 331

                                                                       
Query: 332 taagtaaatattatttcgtggtcacagcattcgatggtgttgagggcattgaaaagacaa 391
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 332 taagtaaatattatttcgtggtcacagcattcgatggtgttgagggcattgaaaagacaa 391

                                                                       
Query: 392 gagcaataacacccgatctcattgtaaccgattgtatgatgccacgtatgagtggtgatg 451
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 392 gagcaataacacccgatctcattgtaaccgattgtatgatgccacgtatgagtggtgatg 451

                                                                       
Query: 452 aaatggttgaacaattaagatccgatgaacaatttgataatattcctatacttttattaa 511
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 452 aaatggttgaacaattaagatccgatgaacaatttgataatattcctatacttttattaa 511

                
Query: 512 actgc 516
           |||||
Sbjct: 512 actgc 516


>Contig-U11921-1 (Contig-U11921-1Q) /CSM_Contig/Contig-U11921-1Q.Seq.d
          Length = 2241

 Score = 34.2 bits (17), Expect = 0.14
 Identities = 17/17 (100%)
 Strand = Plus / Plus

                             
Query: 452  aaatggttgaacaatta 468
            |||||||||||||||||
Sbjct: 1741 aaatggttgaacaatta 1757


>Contig-U09585-1 (Contig-U09585-1Q) /CSM_Contig/Contig-U09585-1Q.Seq.d
          Length = 1299

 Score = 34.2 bits (17), Expect = 0.14
 Identities = 17/17 (100%)
 Strand = Plus / Plus

                            
Query: 105 ttaaattttaatatttt 121
           |||||||||||||||||
Sbjct: 6   ttaaattttaatatttt 22


  Database: CSM
    Posted date:  Jun 9, 2004  7:35 PM
  Number of letters in database: 5,674,871
  Number of sequences in database:  6905
  
Lambda     K      H
    1.37    0.711     1.31 

Gapped
Lambda     K      H
    1.37    0.711     1.31 


Matrix: blastn matrix:1 -3
Gap Penalties: Existence: 5, Extension: 2
Number of Hits to DB: 5677
Number of Sequences: 6905
Number of extensions: 5677
Number of successful extensions: 613
Number of sequences better than 10.0: 196
length of query: 516
length of database: 5,674,871
effective HSP length: 16
effective length of query: 500
effective length of database: 5,564,391
effective search space: 2782195500
effective search space used: 2782195500
T: 0
A: 40
X1: 6 (11.9 bits)
X2: 15 (29.7 bits)
S1: 12 (24.3 bits)
S2: 14 (28.2 bits)

Query= Contig-U14072-1 (Contig-U14072-1Q) /CSM_Contig/Contig-U14072-1Q.Seq.d
         (516 letters)

Database: ddbj_A
           92,845,959 sequences; 95,242,211,685 total letters

Searching..................................................done

                                                             Score    E
Sequences producing significant alignments:                  (bits) Value  N

(BJ352438) Dictyostelium discoideum cDNA clone:dda46c19, 3' ...   767   0.0    2
(AF361475) Dictyostelium discoideum double histidine kinase ...   430   0.0    3
(AF029704) Dictyostelium discoideum hybrid histidine kinase ...   430   0.0    3
(EL490638) CHUS5703.b1_N10.ab1 CHU(LMS) puzzle sunflower Hel...    48   0.31   1
(CD854371) DH0AMM29ZG11ZZM1 HaDevR6 Helianthus annuus cDNA c...    48   0.31   1
(BC167129) Xenopus tropicalis hypothetical protein LOC100144...    46   1.2    1
(BC158146) Xenopus tropicalis cDNA clone MGC:135411 IMAGE:75...    46   1.2    1
(AC018926) Homo sapiens chromosome 15 clone RP11-139H15 map ...    46   1.2    1
(EL705246) CBSU4414.fwd NICHD_XGC_tropLimb_m Xenopus (Silura...    46   1.2    1
(EL705245) CBSU4414.rev NICHD_XGC_tropLimb_m Xenopus (Silura...    46   1.2    1
(DT531991) JGI_CABH4194.fwd NIH_XGC_tropSkeMus1 Xenopus (Sil...    46   1.2    1
(DT412949) JGI_CABI11649.fwd NIH_XGC_tropOvi1 Xenopus (Silur...    46   1.2    1
(DT412948) JGI_CABI11649.rev NIH_XGC_tropOvi1 Xenopus (Silur...    46   1.2    1
(DT391660) JGI_CABH8901.fwd NIH_XGC_tropSkeMus1 Xenopus (Sil...    46   1.2    1
(CX510034) JGI_XZG35810.fwd NIH_XGC_tropGas7 Xenopus (Silura...    46   1.2    1
(CR580816) Xenopus tropicalis EST, clone THdA026o02 5'.            46   1.2    1
(AW809422) MR4-ST0121-041199-019-d12 ST0121 Homo sapiens cDN...    46   1.2    1
(EY274123) BF01062A2D09.f2 Normalized subtracted keck librar...    46   1.2    1
(EY271108) BF01055A1C06.f1 Normalized subtracted keck librar...    46   1.2    1
(AE016877) Bacillus cereus ATCC 14579, complete genome.            46   1.2    1
(DU058675) 90513 Tomato HindIII BAC Library Solanum lycopers...    40   2.4    2
(AC021799) Homo sapiens clone RP11-25L7, LOW-PASS SEQUENCE S...    40   3.3    3
(CP000743) Methanococcus aeolicus Nankai-3, complete genome.       38   4.1    9
(AC025556) Homo sapiens chromosome 17 clone RP11-501C14, WOR...    40   4.8    2
(BV242952) S234P6284RD7.T0 EnglishShepherd Canis familiaris ...    44   4.9    1
(EF085015) Picea sitchensis clone WS0283_H23 unknown mRNA.         44   4.9    1
(AM483341) Vitis vinifera contig VV78X162738.5, whole genome...    44   4.9    1
(AM435741) Vitis vinifera contig VV78X175357.3, whole genome...    44   4.9    1
(CS604660) Sequence 3646 from Patent WO2007039234.                 44   4.9    1
(CS603012) Sequence 1998 from Patent WO2007039234.                 44   4.9    1
(AC226078) Oryza minuta clone OM__Ba0131O23, *** SEQUENCING ...    44   4.9    1
(AC216668) Oryza officinalis clone OO__Ba0089G05, *** SEQUEN...    44   4.9    1
(AC216667) Oryza officinalis clone OO__Ba0040E22, *** SEQUEN...    44   4.9    1
(AC023320) Homo sapiens chromosome 6 clone RP11-635K5 map 6,...    44   4.9    1
(DX447882) BE2006_D12_F IASMA L2 HindIII BAC library Vitis v...    44   4.9    1
(CU845356) A BAC library has been constructed from PN40024 g...    44   4.9    1
(CU781108) A BAC library has been constructed from PN40024 g...    44   4.9    1
(CT554074) A BAC library has been constructed from cultivar ...    44   4.9    1
(CT532933) A BAC library has been constructed from cultivar ...    44   4.9    1
(CT532102) A BAC library has been constructed from cultivar ...    44   4.9    1
(CT498449) A BAC library has been constructed from cultivar ...    44   4.9    1
(ES853576) WS02759.CR_C20 SS-IL-A-FL-14 Picea sitchensis cDN...    44   4.9    1
(DV993196) GQ02770.B3_C01 GQ099: Mixed spruce tissues Picea ...    44   4.9    1
(DR591451) WS00831.B21_F11 WS-X-N-A-9 Picea glauca cDNA clon...    44   4.9    1
(DR573982) WS00736.B21_H17 WS-PS-N-A-8 Picea glauca cDNA clo...    44   4.9    1
(DR556462) WS0328.C21_M24 WS-MC-N-A-20 Picea glauca cDNA clo...    44   4.9    1
(DR480548) WS0283.BR_H23 SS-IB-A-FL-13 Picea sitchensis cDNA...    44   4.9    1
(DR472723) WS00956.B21_P18 IS-B-N-A-10 Picea engelmannii x P...    44   4.9    1
(DR469316) WS00947.B21_G22 IS-B-N-A-10 Picea engelmannii x P...    44   4.9    1
(DR451918) WS00956.BR_P18 IS-B-N-A-10 Picea engelmannii x Pi...    44   4.9    1
(CO257576) WS0085.B21_N22 WS-X-N-A-9 Picea glauca cDNA clone...    44   4.9    1
(CO255747) WS0081.B21_A07 WS-X-N-A-9 Picea glauca cDNA clone...    44   4.9    1
(CO235349) WS0264.B21_F16 WS-PP-N-A-12 Picea glauca cDNA clo...    44   4.9    1
(CO222771) WS01017.B21.1_A17 SS-R-N-A-11 Picea sitchensis cD...    44   4.9    1
(CK443555) GQ0015b.TB.1_H09 GQ001: Male strobili development...    44   4.9    1
(CK443554) GQ0015b.BR_H09 GQ001: Male strobili developmental...    44   4.9    1
(CD232857) SS1_10_G04.b1_A012 Salt-stressed seedlings Sorghu...    44   4.9    1
(EX431254) GQ03907.B7_G20 GQ039 - Stem - Dormant Picea glauc...    44   4.9    1
(EX392036) GQ03321.B7_J02 GQ033 - Terminal leader (Normalize...    44   4.9    1
(EX372330) GQ03224.B7_L10 GQ032 - Shoot tip (Normalized libr...    44   4.9    1
(EX365443) GQ03209.SP6_M21 GQ032 - Shoot tip (Normalized lib...    44   4.9    1
(EX365081) GQ03209.B7_M21 GQ032 - Shoot tip (Normalized libr...    44   4.9    1
(EX363335) GQ03206.SP6_O22 GQ032 - Shoot tip (Normalized lib...    44   4.9    1
(EX362983) GQ03206.B7_O22 GQ032 - Shoot tip (Normalized libr...    44   4.9    1
(EX341461) GQ03011.SP6_A22 GQ030 - Xylem planings - daytime ...    44   4.9    1
(CU459141) Acinetobacter baumannii str. AYE, complete genome.      32   7.0    2
(CP000863) Acinetobacter baumannii ACICU, complete genome.         32   7.0    2
(EK178876) 1095458111369 Global-Ocean-Sampling_GS-31-01-01-1...    38   7.7    2
(AL160174) Human DNA sequence from clone RP11-333H4 on chrom...    42   7.8    5
(CT797480) Pig DNA sequence from clone CH242-209J20 on chrom...    32   8.8    2
(CU468869) Pig DNA sequence *** SEQUENCING IN PROGRESS *** f...    32   8.9    2
(ES394834) MUS06-C19.y1d-s SHGC-MUS Mytilus californianus cD...    34   9.6    2

>(BJ352438) Dictyostelium discoideum cDNA clone:dda46c19, 3' end,
           single read.
          Length = 507

 Score =  767 bits (387), Expect(2) = 0.0
 Identities = 387/387 (100%)
 Strand = Plus / Minus


Query: 130 caaatacatcttcagatattgcttcaaatgcattaaaagataatatgggtagtataatgg 189
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 388 caaatacatcttcagatattgcttcaaatgcattaaaagataatatgggtagtataatgg 329


Query: 190 gagttcatgcaattgctcaacaagctgttgaggaattaacagagaaacaattttatcaat 249
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 328 gagttcatgcaattgctcaacaagctgttgaggaattaacagagaaacaattttatcaat 269


Query: 250 cacaagaaaatatacataataaaccaatagttttagtggttgaaggataatccagagatg 309
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 268 cacaagaaaatatacataataaaccaatagttttagtggttgaaggataatccagagatg 209


Query: 310 aatagattcattgcagagttattaagtaaatattatttcgtggtcacagcattcgatggt 369
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 208 aatagattcattgcagagttattaagtaaatattatttcgtggtcacagcattcgatggt 149


Query: 370 gttgagggcattgaaaagacaagagcaataacacccgatctcattgtaaccgattgtatg 429
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 148 gttgagggcattgaaaagacaagagcaataacacccgatctcattgtaaccgattgtatg 89


Query: 430 atgccacgtatgagtggtgatgaaatggttgaacaattaagatccgatgaacaatttgat 489
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 88  atgccacgtatgagtggtgatgaaatggttgaacaattaagatccgatgaacaatttgat 29


Query: 490 aatattcctatacttttattaaactgc 516
           |||||||||||||||||||||||||||
Sbjct: 28  aatattcctatacttttattaaactgc 2

 Score = 60.0 bits (30), Expect(2) = 0.0
 Identities = 30/30 (100%)
 Strand = Plus / Minus


Query: 92  tgatgaggatggtttaaattttaatatttt 121
           ||||||||||||||||||||||||||||||
Sbjct: 426 tgatgaggatggtttaaattttaatatttt 397

Lambda     K      H
    1.37    0.711     1.31

Matrix: blastn matrix:1 -3
Number of Sequences: 92845959
Number of Hits to DB: 491,882,253
Number of extensions: 30405417
Number of successful extensions: 2448548
Number of sequences better than 10.0: 72
Length of query: 516
Length of database: 95,242,211,685
Length adjustment: 23
Effective length of query: 493
Effective length of database: 93,106,754,628
Effective search space: 45901630031604
Effective search space used: 45901630031604
X1: 11 (21.8 bits)
S2: 21 (42.1 bits)

Query= Contig-U14072-1 (Contig-U14072-1Q) /CSM_Contig/Contig-U14072-1Q.Seq.d
         (516 letters)

Database: nrp_B
           3,236,559 sequences; 1,051,180,864 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

(Q54SP4) RecName: Full=Hybrid signal transduction histidine kina...   147   1e-34
AF361475_1(AF361475|pid:none) Dictyostelium discoideum double hi...   147   1e-34
CP000230_2401(CP000230|pid:none) Rhodospirillum rubrum ATCC 1117...    86   5e-16
AE017354_2104(AE017354|pid:none) Legionella pneumophila subsp. p...    75   7e-13
CP000555_812(CP000555|pid:none) Methylibium petroleiphilum PM1, ...    75   1e-12
CP000675_2219(CP000675|pid:none) Legionella pneumophila str. Cor...    73   5e-12
CP000769_2644(CP000769|pid:none) Anaeromyxobacter sp. Fw109-5, c...    70   2e-11
AF180147_9(AF180147|pid:none) Pseudomonas putida toluene dioxyge...    70   4e-11
Y18245_11(Y18245|pid:none) Pseudomonas putida todX, todF, todC1,...    70   4e-11
DQ157469_33(DQ157469|pid:none) Pseudomonas putida strain KL47 cy...    68   1e-10
D89625_1(D89625|pid:none) Anabaena sp. cyaC gene for adenylate c...    68   1e-10
AC2426(AC2426) adenylate cyclase carring two-component hybrid se...    68   1e-10
AE015928_1635(AE015928|pid:none) Bacteroides thetaiotaomicron VP...    68   2e-10
CP000113_2539(CP000113|pid:none) Myxococcus xanthus DK 1622, com...    67   3e-10
CP000117_2231(CP000117|pid:none) Anabaena variabilis ATCC 29413,...    67   3e-10
AM746676_818(AM746676|pid:none) Sorangium cellulosum 'So ce 56' ...    66   5e-10
BA000039_345(BA000039|pid:none) Thermosynechococcus elongatus BP...    66   6e-10
CP000117_1084(CP000117|pid:none) Anabaena variabilis ATCC 29413,...    66   6e-10
CP001287_4164(CP001287|pid:none) Cyanothece sp. PCC 8801, comple...    65   8e-10
BA000045_2749(BA000045|pid:none) Gloeobacter violaceus PCC 7421 ...    65   8e-10
CP000685_3099(CP000685|pid:none) Flavobacterium johnsoniae UW101...    65   1e-09
AE015928_3096(AE015928|pid:none) Bacteroides thetaiotaomicron VP...    64   2e-09
CP000139_2156(CP000139|pid:none) Bacteroides vulgatus ATCC 8482,...    64   3e-09
CP000250_3800(CP000250|pid:none) Rhodopseudomonas palustris HaA2...    64   3e-09
AE015928_4109(AE015928|pid:none) Bacteroides thetaiotaomicron VP...    64   3e-09
AP006841_388(AP006841|pid:none) Bacteroides fragilis YCH46 DNA, ...    63   5e-09
CP000139_2820(CP000139|pid:none) Bacteroides vulgatus ATCC 8482,...    63   5e-09
CP000685_3835(CP000685|pid:none) Flavobacterium johnsoniae UW101...    63   5e-09
AE015928_2825(AE015928|pid:none) Bacteroides thetaiotaomicron VP...    63   5e-09
CP000140_3381(CP000140|pid:none) Parabacteroides distasonis ATCC...    62   6e-09
CP001037_2637(CP001037|pid:none) Nostoc punctiforme PCC 73102, c...    62   8e-09
CP000139_147(CP000139|pid:none) Bacteroides vulgatus ATCC 8482, ...    62   1e-08
CP000613_1491(CP000613|pid:none) Rhodospirillum centenum SW, com...    61   1e-08
AE015928_1754(AE015928|pid:none) Bacteroides thetaiotaomicron VP...    61   1e-08
D49692_1(D49692|pid:none) Spirulina platensis DNA for adenylate ...    61   1e-08
AE008692_79(AE008692|pid:none) Zymomonas mobilis subsp. mobilis ...    61   1e-08
CP000139_1097(CP000139|pid:none) Bacteroides vulgatus ATCC 8482,...    61   2e-08
AE015928_2896(AE015928|pid:none) Bacteroides thetaiotaomicron VP...    61   2e-08
CP000494_5448(CP000494|pid:none) Bradyrhizobium sp. BTAi1, compl...    60   2e-08
AE015928_981(AE015928|pid:none) Bacteroides thetaiotaomicron VPI...    60   2e-08
AE015928_3133(AE015928|pid:none) Bacteroides thetaiotaomicron VP...    60   2e-08
CP000909_1439(CP000909|pid:none) Chloroflexus aurantiacus J-10-f...    60   2e-08
CP000139_492(CP000139|pid:none) Bacteroides vulgatus ATCC 8482, ...    60   3e-08
CP001056_1651(CP001056|pid:none) Clostridium botulinum B str. Ek...    60   3e-08
AE010300_2221(AE010300|pid:none) Leptospira interrogans serovar ...    60   3e-08
CP000393_2753(CP000393|pid:none) Trichodesmium erythraeum IMS101...    60   4e-08
CP000089_3782(CP000089|pid:none) Dechloromonas aromatica RCB, co...    60   4e-08
CP000656_4396(CP000656|pid:none) Mycobacterium gilvum PYR-GCK, c...    60   4e-08
AP006841_4370(AP006841|pid:none) Bacteroides fragilis YCH46 DNA,...    59   6e-08
CP001504_1080(CP001504|pid:none) Burkholderia glumae BGR1 chromo...    59   6e-08
AP006841_3311(AP006841|pid:none) Bacteroides fragilis YCH46 DNA,...    59   6e-08
AE015928_3333(AE015928|pid:none) Bacteroides thetaiotaomicron VP...    59   7e-08
AE015928_3048(AE015928|pid:none) Bacteroides thetaiotaomicron VP...    59   7e-08
AE017126_194(AE017126|pid:none) Prochlorococcus marinus subsp. m...    59   7e-08
CP000239_1156(CP000239|pid:none) Synechococcus sp. JA-3-3Ab, com...    59   7e-08
CP001096_4389(CP001096|pid:none) Rhodopseudomonas palustris TIE-...    58   1e-07
CP000716_822(CP000716|pid:none) Thermosipho melanesiensis BI429,...    58   1e-07
CP000139_1762(CP000139|pid:none) Bacteroides vulgatus ATCC 8482,...    58   1e-07
BX572605_225(BX572605|pid:none) Rhodopseudomonas palustris CGA00...    58   1e-07
CP000685_2068(CP000685|pid:none) Flavobacterium johnsoniae UW101...    58   1e-07
AE015928_1734(AE015928|pid:none) Bacteroides thetaiotaomicron VP...    58   1e-07
CP000140_2668(CP000140|pid:none) Parabacteroides distasonis ATCC...    58   2e-07
CP000806_288(CP000806|pid:none) Cyanothece sp. ATCC 51142 circul...    58   2e-07
CP000155_5563(CP000155|pid:none) Hahella chejuensis KCTC 2396, c...    58   2e-07
CP000859_2803(CP000859|pid:none) Desulfococcus oleovorans Hxd3, ...    57   2e-07
CP000685_3845(CP000685|pid:none) Flavobacterium johnsoniae UW101...    57   2e-07
CU207366_1676(CU207366|pid:none) Gramella forsetii KT0803 comple...    57   2e-07
CP000139_1617(CP000139|pid:none) Bacteroides vulgatus ATCC 8482,...    57   2e-07
AM999887_357(AM999887|pid:none) Wolbachia endosymbiont of Culex ...    57   3e-07
CP001344_4323(CP001344|pid:none) Cyanothece sp. PCC 7425, comple...    57   3e-07
CP000300_1958(CP000300|pid:none) Methanococcoides burtonii DSM 6...    57   3e-07
CP000806_1184(CP000806|pid:none) Cyanothece sp. ATCC 51142 circu...    57   3e-07
CP000091_1068(CP000091|pid:none) Ralstonia eutropha JMP134 chrom...    57   4e-07
CP000854_727(CP000854|pid:none) Mycobacterium marinum M, complet...    57   4e-07
CP001131_2293(CP001131|pid:none) Anaeromyxobacter sp. K, complet...    57   4e-07
AE015928_2970(AE015928|pid:none) Bacteroides thetaiotaomicron VP...    57   4e-07
CP000815_308(CP000815|pid:none) Paulinella chromatophora chromat...    57   4e-07
CP001337_1999(CP001337|pid:none) Chloroflexus aggregans DSM 9485...    57   4e-07
CP001078_1789(CP001078|pid:none) Clostridium botulinum E3 str. A...    57   4e-07
AY548449_3(AY548449|pid:none) Fremyella diplosiphon clone 3109D1...    57   4e-07
CP001359_2374(CP001359|pid:none) Anaeromyxobacter dehalogenans 2...    57   4e-07
AE015928_2859(AE015928|pid:none) Bacteroides thetaiotaomicron VP...    57   4e-07
AE2439(AE2439) two-component response regulator all5069 [importe...    57   4e-07
CP000139_806(CP000139|pid:none) Bacteroides vulgatus ATCC 8482, ...    56   5e-07
AE003849_1941(AE003849|pid:none) Xylella fastidiosa 9a5c, comple...    56   5e-07
CP000551_188(CP000551|pid:none) Prochlorococcus marinus str. AS9...    56   5e-07
CP001037_1132(CP001037|pid:none) Nostoc punctiforme PCC 73102, c...    56   5e-07
CP001011_873(CP001011|pid:none) Xylella fastidiosa M23, complete...    56   5e-07
AE009442_808(AE009442|pid:none) Xylella fastidiosa Temecula1, co...    56   5e-07
AP009389_1831(AP009389|pid:none) Pelotomaculum thermopropionicum...    56   6e-07
BA000039_2437(BA000039|pid:none) Thermosynechococcus elongatus B...    56   6e-07
AE015928_958(AE015928|pid:none) Bacteroides thetaiotaomicron VPI...    56   6e-07
CP000384_349(CP000384|pid:none) Mycobacterium sp. MCS, complete ...    56   6e-07
CP000112_3705(CP000112|pid:none) Desulfovibrio desulfuricans G20...    56   6e-07
AM180355_2710(AM180355|pid:none) Clostridium difficile 630 compl...    56   6e-07
CP000481_1870(CP000481|pid:none) Acidothermus cellulolyticus 11B...    56   6e-07
CP000267_555(CP000267|pid:none) Rhodoferax ferrireducens T118, c...    56   6e-07
CP000117_3954(CP000117|pid:none) Anabaena variabilis ATCC 29413,...    56   6e-07
CP000113_4520(CP000113|pid:none) Myxococcus xanthus DK 1622, com...    56   6e-07
CP001001_4745(CP001001|pid:none) Methylobacterium radiotolerans ...    56   6e-07
CP000771_86(CP000771|pid:none) Fervidobacterium nodosum Rt17-B1,...    56   6e-07
CP000825_188(CP000825|pid:none) Prochlorococcus marinus str. MIT...    55   8e-07
CT025835_29(CT025835|pid:none) uncultured sulfate-reducing bacte...    55   8e-07
CP000139_79(CP000139|pid:none) Bacteroides vulgatus ATCC 8482, c...    55   8e-07
AP009153_2359(AP009153|pid:none) Gemmatimonas aurantiaca T-27 DN...    55   8e-07
CP000159_2238(CP000159|pid:none) Salinibacter ruber DSM 13855, c...    55   8e-07
CP000348_1413(CP000348|pid:none) Leptospira borgpetersenii serov...    55   1e-06
CP000117_2316(CP000117|pid:none) Anabaena variabilis ATCC 29413,...    55   1e-06
CP001037_5449(CP001037|pid:none) Nostoc punctiforme PCC 73102, c...    55   1e-06
CP001185_944(CP001185|pid:none) Thermosipho africanus TCF52B, co...    55   1e-06
AE017347_233(AE017347|pid:none) Cryptococcus neoformans var. neo...    55   1e-06
BX548174_176(BX548174|pid:none) Prochlorococcus marinus MED4 com...    55   1e-06
CP000111_180(CP000111|pid:none) Prochlorococcus marinus str. MIT...    55   1e-06
CP000316_3827(CP000316|pid:none) Polaromonas sp. JS666, complete...    55   1e-06
CP000251_1551(CP000251|pid:none) Anaeromyxobacter dehalogenans 2...    55   1e-06
CP000159_70(CP000159|pid:none) Salinibacter ruber DSM 13855, com...    55   1e-06
CP000576_190(CP000576|pid:none) Prochlorococcus marinus str. MIT...    55   1e-06
CP000300_755(CP000300|pid:none) Methanococcoides burtonii DSM 62...    55   1e-06
CP001037_767(CP001037|pid:none) Nostoc punctiforme PCC 73102, co...    55   1e-06
CP000097_2090(CP000097|pid:none) Synechococcus sp. CC9902, compl...    55   1e-06
CP000951_2482(CP000951|pid:none) Synechococcus sp. PCC 7002, com...    55   1e-06
CP000568_1784(CP000568|pid:none) Clostridium thermocellum ATCC 2...    55   1e-06
AP008231_2234(AP008231|pid:none) Synechococcus elongatus PCC 630...    55   1e-06
CU207211_2592(CU207211|pid:none) Herminiimonas arsenicoxydans ch...    55   1e-06
CP000139_723(CP000139|pid:none) Bacteroides vulgatus ATCC 8482, ...    54   2e-06
AE015928_1058(AE015928|pid:none) Bacteroides thetaiotaomicron VP...    54   2e-06
AE015928_3676(AE015928|pid:none) Bacteroides thetaiotaomicron VP...    54   2e-06
CP000095_224(CP000095|pid:none) Prochlorococcus marinus str. NAT...    54   2e-06
CP001147_1295(CP001147|pid:none) Thermodesulfovibrio yellowstoni...    54   2e-06
CP000553_245(CP000553|pid:none) Prochlorococcus marinus str. NAT...    54   2e-06
CP000239_90(CP000239|pid:none) Synechococcus sp. JA-3-3Ab, compl...    54   2e-06
AE000513_728(AE000513|pid:none) Deinococcus radiodurans R1 chrom...    54   2e-06
AM286690_104(AM286690|pid:none) Alcanivorax borkumensis SK2, com...    54   2e-06
CP000360_488(CP000360|pid:none) Acidobacteria bacterium Ellin345...    54   2e-06
CP001114_160(CP001114|pid:none) Deinococcus deserti VCD115, comp...    54   2e-06
AE2263(AE2263) two-component response regulator all3660 [importe...    54   2e-06
CP001147_451(CP001147|pid:none) Thermodesulfovibrio yellowstonii...    54   2e-06
AM889285_1684(AM889285|pid:none) Gluconacetobacter diazotrophicu...    54   2e-06
AE016853_4907(AE016853|pid:none) Pseudomonas syringae pv. tomato...    54   2e-06
CP000471_1462(CP000471|pid:none) Magnetococcus sp. MC-1, complet...    54   2e-06
AM746676_207(AM746676|pid:none) Sorangium cellulosum 'So ce 56' ...    54   2e-06
CP000435_2591(CP000435|pid:none) Synechococcus sp. CC9311, compl...    54   2e-06
CR626927_272(CR626927|pid:none) Bacteroides fragilis NCTC 9343, ...    54   2e-06
CP001111_3079(CP001111|pid:none) Stenotrophomonas maltophilia R5...    54   2e-06
CP000875_601(CP000875|pid:none) Herpetosiphon aurantiacus ATCC 2...    54   2e-06
CP000139_966(CP000139|pid:none) Bacteroides vulgatus ATCC 8482, ...    54   2e-06
CP000058_472(CP000058|pid:none) Pseudomonas syringae pv. phaseol...    54   3e-06
CP000471_3126(CP000471|pid:none) Magnetococcus sp. MC-1, complet...    54   3e-06
CP000482_3107(CP000482|pid:none) Pelobacter propionicus DSM 2379...    54   3e-06
CP000159_2544(CP000159|pid:none) Salinibacter ruber DSM 13855, c...    54   3e-06
CP000139_3714(CP000139|pid:none) Bacteroides vulgatus ATCC 8482,...    54   3e-06
CP001124_1692(CP001124|pid:none) Geobacter bemidjiensis Bem, com...    54   3e-06
CP000083_723(CP000083|pid:none) Colwellia psychrerythraea 34H, c...    51   3e-06
CP000633_2989(CP000633|pid:none) Agrobacterium vitis S4 chromoso...    53   4e-06
CP000685_4163(CP000685|pid:none) Flavobacterium johnsoniae UW101...    53   4e-06
CP000030_323(CP000030|pid:none) Anaplasma marginale str. St. Mar...    53   4e-06
CR543861_702(CR543861|pid:none) Acinetobacter sp. ADP1 complete ...    53   4e-06
CP001281_3518(CP001281|pid:none) Thauera sp. MZ1T, complete geno...    53   4e-06
CP000133_624(CP000133|pid:none) Rhizobium etli CFN 42, complete ...    53   4e-06
CP000961_822(CP000961|pid:none) Shewanella woodyi ATCC 51908, co...    53   4e-06
AM295250_1289(AM295250|pid:none) Staphylococcus carnosus subsp. ...    53   4e-06
(Q9K998) RecName: Full=Probable C4-dicarboxylate response regula...    53   4e-06
CP001074_701(CP001074|pid:none) Rhizobium etli CIAT 652, complet...    53   4e-06
CP001147_1293(CP001147|pid:none) Thermodesulfovibrio yellowstoni...    53   4e-06
CP001032_772(CP001032|pid:none) Opitutus terrae PB90-1, complete...    53   4e-06
AP007255_2659(AP007255|pid:none) Magnetospirillum magneticum AMB...    53   4e-06
AM743169_3468(AM743169|pid:none) Stenotrophomonas maltophilia K2...    53   4e-06
AF1922(AF1922) two-component system, regulatory protein all0929 ...    53   4e-06
FM177140_1377(FM177140|pid:none) Lactobacillus casei BL23 comple...    53   5e-06
CP001291_2928(CP001291|pid:none) Cyanothece sp. PCC 7424, comple...    53   5e-06
CP000828_4974(CP000828|pid:none) Acaryochloris marina MBIC11017,...    53   5e-06
AE017221_1132(AE017221|pid:none) Thermus thermophilus HB27, comp...    53   5e-06
CU633750_124(CU633750|pid:none) Cupriavidus taiwanensis str. LMG...    53   5e-06
CP000359_2081(CP000359|pid:none) Deinococcus geothermalis DSM 11...    53   5e-06
CT573072_204(CT573072|pid:none) Kuenenia stuttgartiensis genome ...    53   5e-06
CP000284_1243(CP000284|pid:none) Methylobacillus flagellatus KT,...    53   5e-06
CP000680_829(CP000680|pid:none) Pseudomonas mendocina ymp, compl...    53   5e-06
CP001147_387(CP001147|pid:none) Thermodesulfovibrio yellowstonii...    53   5e-06
CR925677_323(CR925677|pid:none) Ehrlichia ruminantium str. Garde...    53   5e-06
CP000236_736(CP000236|pid:none) Ehrlichia chaffeensis str. Arkan...    53   5e-06
AE017224_572(AE017224|pid:none) Brucella abortus biovar 1 str. 9...    52   7e-06
AP008981_1084(AP008981|pid:none) Orientia tsutsugamushi str. Ike...    52   7e-06
CU459003_3211(CU459003|pid:none) Magnetospirillum gryphiswaldens...    52   7e-06
CP000423_1129(CP000423|pid:none) Lactobacillus casei ATCC 334, c...    52   7e-06
AM746676_778(AM746676|pid:none) Sorangium cellulosum 'So ce 56' ...    52   7e-06
AM494475_330(AM494475|pid:none) Orientia tsutsugamushi Boryong c...    52   7e-06
CP001389_247(CP001389|pid:none) Rhizobium sp. NGR234, complete g...    52   7e-06
CT978603_2261(CT978603|pid:none) Synechococcus sp. RCC307 genomi...    52   7e-06
CP000301_4620(CP000301|pid:none) Rhodopseudomonas palustris BisB...    52   7e-06
CP001291_2136(CP001291|pid:none) Cyanothece sp. PCC 7424, comple...    52   7e-06
AC3592(AC3592) response regulator protein [imported] - Brucella ...    52   7e-06
CP000240_1889(CP000240|pid:none) Synechococcus sp. JA-2-3B'a(2-1...    52   7e-06
BX548175_2624(BX548175|pid:none) Prochlorococcus marinus MIT9313...    52   7e-06
CP000628_645(CP000628|pid:none) Agrobacterium radiobacter K84 ch...    52   9e-06
CP000875_583(CP000875|pid:none) Herpetosiphon aurantiacus ATCC 2...    52   9e-06
CP001230_1467(CP001230|pid:none) Persephonella marina EX-H1, com...    52   9e-06
CP000089_3867(CP000089|pid:none) Dechloromonas aromatica RCB, co...    52   9e-06
CP001037_2111(CP001037|pid:none) Nostoc punctiforme PCC 73102, c...    52   9e-06
CP001359_912(CP001359|pid:none) Anaeromyxobacter dehalogenans 2C...    52   9e-06
CP000239_2601(CP000239|pid:none) Synechococcus sp. JA-3-3Ab, com...    52   9e-06
CP001147_178(CP001147|pid:none) Thermodesulfovibrio yellowstonii...    52   9e-06
AP009484_1361(AP009484|pid:none) Macrococcus caseolyticus JCSC54...    52   9e-06
CP000089_722(CP000089|pid:none) Dechloromonas aromatica RCB, com...    52   9e-06
CP001100_2333(CP001100|pid:none) Chloroherpeton thalassium ATCC ...    52   9e-06
CP000153_1238(CP000153|pid:none) Sulfurimonas denitrificans DSM ...    52   9e-06
CP000393_2832(CP000393|pid:none) Trichodesmium erythraeum IMS101...    52   9e-06
CP000379_741(CP000379|pid:none) Burkholderia cenocepacia AU 1054...    52   9e-06
A75476(A75476) response regulator, OmpR/PhoB family - Deinococcu...    52   9e-06
CP000507_3422(CP000507|pid:none) Shewanella amazonensis SB2B, co...    52   9e-06
CP000094_1055(CP000094|pid:none) Pseudomonas fluorescens Pf0-1, ...    52   1e-05
AM167904_3087(AM167904|pid:none) Bordetella avium 197N complete ...    52   1e-05
CP001124_1846(CP001124|pid:none) Geobacter bemidjiensis Bem, com...    52   1e-05
AM920689_1253(AM920689|pid:none) Xanthomonas campestris pv. camp...    52   1e-05
CP000494_6329(CP000494|pid:none) Bradyrhizobium sp. BTAi1, compl...    52   1e-05
CP000107_297(CP000107|pid:none) Ehrlichia canis str. Jake, compl...    52   1e-05
AE008922_2874(AE008922|pid:none) Xanthomonas campestris pv. camp...    52   1e-05
CP000141_1994(CP000141|pid:none) Carboxydothermus hydrogenoforma...    52   1e-05
BA000022_1804(BA000022|pid:none) Synechocystis sp. PCC 6803 DNA,...    52   1e-05
AE015927_1614(AE015927|pid:none) Clostridium tetani E88, complet...    51   1e-05
AM181176_1194(AM181176|pid:none) Pseudomonas fluorescens SBW25 c...    51   1e-05
CP000449_940(CP000449|pid:none) Maricaulis maris MCS10, complete...    51   1e-05
CP000393_814(CP000393|pid:none) Trichodesmium erythraeum IMS101,...    51   1e-05
AP008229_1651(AP008229|pid:none) Xanthomonas oryzae pv. oryzae M...    51   1e-05
CP000875_4093(CP000875|pid:none) Herpetosiphon aurantiacus ATCC ...    51   1e-05
CP001172_632(CP001172|pid:none) Acinetobacter baumannii AB307-02...    51   1e-05
AE015928_3798(AE015928|pid:none) Bacteroides thetaiotaomicron VP...    51   1e-05
CP000863_3059(CP000863|pid:none) Acinetobacter baumannii ACICU, ...    51   1e-05
CP000804_3219(CP000804|pid:none) Roseiflexus castenholzii DSM 13...    51   1e-05
CP000661_1454(CP000661|pid:none) Rhodobacter sphaeroides ATCC 17...    51   1e-05
CP000521_3080(CP000521|pid:none) Acinetobacter baumannii ATCC 17...    51   1e-05
CP000103_334(CP000103|pid:none) Nitrosospira multiformis ATCC 25...    51   1e-05
CP001098_1315(CP001098|pid:none) Halothermothrix orenii H 168, c...    51   1e-05
CP000644_1956(CP000644|pid:none) Aeromonas salmonicida subsp. sa...    51   1e-05
CP000141_2488(CP000141|pid:none) Carboxydothermus hydrogenoforma...    51   1e-05
CP000353_350(CP000353|pid:none) Ralstonia metallidurans CH34 meg...    51   1e-05
CP000117_613(CP000117|pid:none) Anabaena variabilis ATCC 29413, ...    51   1e-05
CP001291_174(CP001291|pid:none) Cyanothece sp. PCC 7424, complet...    51   1e-05
CP001032_800(CP001032|pid:none) Opitutus terrae PB90-1, complete...    51   1e-05
CP001344_4127(CP001344|pid:none) Cyanothece sp. PCC 7425, comple...    51   1e-05
CP000113_4317(CP000113|pid:none) Myxococcus xanthus DK 1622, com...    51   1e-05
AG1955(AG1955) two-component response regulator alr1194 [importe...    51   1e-05
CP001348_2272(CP001348|pid:none) Clostridium cellulolyticum H10,...    51   1e-05
CP001053_3018(CP001053|pid:none) Burkholderia phytofirmans PsJN ...    51   1e-05
AP006716_1232(AP006716|pid:none) Staphylococcus haemolyticus JCS...    51   1e-05
CP001114_2125(CP001114|pid:none) Deinococcus deserti VCD115, com...    51   2e-05
CP000453_355(CP000453|pid:none) Alkalilimnicola ehrlichii MLHE-1...    51   2e-05
CP001027_548(CP001027|pid:none) Burkholderia ambifaria MC40-6 ch...    51   2e-05
CP000716_1118(CP000716|pid:none) Thermosipho melanesiensis BI429...    51   2e-05
CP000686_3786(CP000686|pid:none) Roseiflexus sp. RS-1, complete ...    51   2e-05
AM167904_1020(AM167904|pid:none) Bordetella avium 197N complete ...    51   2e-05
CP000448_1404(CP000448|pid:none) Syntrophomonas wolfei subsp. wo...    51   2e-05
CP001280_1959(CP001280|pid:none) Methylocella silvestris BL2, co...    51   2e-05
CP000300_1640(CP000300|pid:none) Methanococcoides burtonii DSM 6...    51   2e-05
AY673996_52(AY673996|pid:none) Gracilaria tenuistipitata var. li...    51   2e-05
CP000472_4244(CP000472|pid:none) Shewanella piezotolerans WP3, c...    51   2e-05
CP001472_645(CP001472|pid:none) Acidobacterium capsulatum ATCC 5...    51   2e-05
CP000804_4044(CP000804|pid:none) Roseiflexus castenholzii DSM 13...    51   2e-05
CP001344_3388(CP001344|pid:none) Cyanothece sp. PCC 7425, comple...    51   2e-05
CP000769_2239(CP000769|pid:none) Anaeromyxobacter sp. Fw109-5, c...    51   2e-05
CP001291_4103(CP001291|pid:none) Cyanothece sp. PCC 7424, comple...    51   2e-05
CP001097_167(CP001097|pid:none) Chlorobium limicola DSM 245, com...    51   2e-05
CP001027_407(CP001027|pid:none) Burkholderia ambifaria MC40-6 ch...    51   2e-05
CP000628_1412(CP000628|pid:none) Agrobacterium radiobacter K84 c...    51   2e-05
AF327739_3(AF327739|pid:none) Streptococcus thermophilus Peb1 (p...    50   3e-05
AB2023(AB2023) two-component response regulator all1736 [importe...    50   3e-05
DQ383470_1(DQ383470|pid:none) Cryptococcus neoformans var. grubi...    50   3e-05
CP000859_1145(CP000859|pid:none) Desulfococcus oleovorans Hxd3, ...    50   3e-05
AP009552_2215(AP009552|pid:none) Microcystis aeruginosa NIES-843...    50   3e-05
CP001089_947(CP001089|pid:none) Geobacter lovleyi SZ, complete g...    50   3e-05
CP001029_144(CP001029|pid:none) Methylobacterium populi BJ001, c...    50   3e-05
CP001390_2138(CP001390|pid:none) Geobacter sp. FRC-32, complete ...    50   3e-05
CP000875_1214(CP000875|pid:none) Herpetosiphon aurantiacus ATCC ...    50   3e-05
CP000089_3428(CP000089|pid:none) Dechloromonas aromatica RCB, co...    50   3e-05
CP000117_301(CP000117|pid:none) Anabaena variabilis ATCC 29413, ...    50   3e-05
AE017194_2725(AE017194|pid:none) Bacillus cereus ATCC 10987, com...    50   3e-05
CP000109_2065(CP000109|pid:none) Thiomicrospira crunogena XCL-2,...    50   3e-05
CP001114_2119(CP001114|pid:none) Deinococcus deserti VCD115, com...    50   3e-05
CP000521_3084(CP000521|pid:none) Acinetobacter baumannii ATCC 17...    50   3e-05
CR555306_948(CR555306|pid:none) Azoarcus sp. EbN1 complete genome.     50   3e-05
CP000024_1089(CP000024|pid:none) Streptococcus thermophilus CNRZ...    50   3e-05
AM778925_32(AM778925|pid:none) Microcystis aeruginosa PCC 7806 g...    50   3e-05
CP001147_384(CP001147|pid:none) Thermodesulfovibrio yellowstonii...    50   3e-05
CP000386_770(CP000386|pid:none) Rubrobacter xylanophilus DSM 994...    50   3e-05
CP000542_2132(CP000542|pid:none) Verminephrobacter eiseniae EF01...    50   3e-05
CU468230_593(CU468230|pid:none) Acinetobacter baumannii str. SDF...    50   3e-05
CP001037_5791(CP001037|pid:none) Nostoc punctiforme PCC 73102, c...    50   3e-05
AM747721_830(AM747721|pid:none) Burkholderia cenocepacia J2315 c...    50   3e-05
CP000817_3938(CP000817|pid:none) Lysinibacillus sphaericus C3-41...    50   3e-05
CP001124_1827(CP001124|pid:none) Geobacter bemidjiensis Bem, com...    50   3e-05
CP001287_1193(CP001287|pid:none) Cyanothece sp. PCC 8801, comple...    50   3e-05
CP000825_146(CP000825|pid:none) Prochlorococcus marinus str. MIT...    50   3e-05
CP001026_573(CP001026|pid:none) Burkholderia ambifaria MC40-6 ch...    50   3e-05
CP000235_504(CP000235|pid:none) Anaplasma phagocytophilum HZ, co...    50   3e-05
CP000140_3298(CP000140|pid:none) Parabacteroides distasonis ATCC...    50   3e-05
AM181176_2214(AM181176|pid:none) Pseudomonas fluorescens SBW25 c...    50   3e-05
CP001287_699(CP001287|pid:none) Cyanothece sp. PCC 8801, complet...    50   3e-05
CP000716_1120(CP000716|pid:none) Thermosipho melanesiensis BI429...    50   3e-05
CP001087_3066(CP001087|pid:none) Desulfobacterium autotrophicum ...    50   3e-05
CP000606_702(CP000606|pid:none) Shewanella loihica PV-4, complet...    50   3e-05
CP000254_955(CP000254|pid:none) Methanospirillum hungatei JF-1, ...    50   3e-05
CP000103_332(CP000103|pid:none) Nitrosospira multiformis ATCC 25...    50   3e-05
CP000473_4237(CP000473|pid:none) Solibacter usitatus Ellin6076, ...    50   3e-05
CP001131_438(CP001131|pid:none) Anaeromyxobacter sp. K, complete...    50   3e-05
CP000113_5881(CP000113|pid:none) Myxococcus xanthus DK 1622, com...    50   3e-05
AJ012050_1(AJ012050|pid:none) Enterococcus faecalis vic operon a...    50   3e-05
AF135389_1(AF135389|pid:none) Tolypothrix PCC7601 DNA binding re...    50   3e-05
EU744231_1(EU744231|pid:none) Myxococcus fulvus HW-1 clone Tc118...    50   3e-05
AP006841_2131(AP006841|pid:none) Bacteroides fragilis YCH46 DNA,...    50   3e-05
CP000240_892(CP000240|pid:none) Synechococcus sp. JA-2-3B'a(2-13...    50   3e-05
CP001124_2005(CP001124|pid:none) Geobacter bemidjiensis Bem, com...    50   3e-05
CP000441_2290(CP000441|pid:none) Burkholderia ambifaria AMMD chr...    50   3e-05
CP001344_542(CP001344|pid:none) Cyanothece sp. PCC 7425, complet...    50   3e-05
CP001013_1589(CP001013|pid:none) Leptothrix cholodnii SP-6, comp...    50   3e-05
CP001390_1962(CP001390|pid:none) Geobacter sp. FRC-32, complete ...    50   3e-05
CT573072_908(CT573072|pid:none) Kuenenia stuttgartiensis genome ...    50   3e-05
AI1822(AI1822) two-component response regulator rpaA [imported] ...    50   3e-05
AM286690_265(AM286690|pid:none) Alcanivorax borkumensis SK2, com...    50   4e-05
CP000438_432(CP000438|pid:none) Pseudomonas aeruginosa UCBPP-PA1...    50   4e-05
AE010299_2377(AE010299|pid:none) Methanosarcina acetivorans str....    50   4e-05
CP000442_792(CP000442|pid:none) Burkholderia ambifaria AMMD chro...    50   4e-05
CP000744_512(CP000744|pid:none) Pseudomonas aeruginosa PA7, comp...    50   4e-05
CP001510_2816(CP001510|pid:none) Methylobacterium extorquens AM1...    50   4e-05
CP001337_1545(CP001337|pid:none) Chloroflexus aggregans DSM 9485...    50   4e-05
AP009179_2380(AP009179|pid:none) Sulfurovum sp. NBC37-1 genomic ...    50   4e-05
AJ006687_1(AJ006687|pid:none) Caulobacter crescentus major chemo...    50   4e-05
CP000139_522(CP000139|pid:none) Bacteroides vulgatus ATCC 8482, ...    50   4e-05
CP001298_2933(CP001298|pid:none) Methylobacterium chloromethanic...    50   4e-05
AE017180_1211(AE017180|pid:none) Geobacter sulfurreducens PCA, c...    50   4e-05
CP001037_3246(CP001037|pid:none) Nostoc punctiforme PCC 73102, c...    50   4e-05
CP000387_382(CP000387|pid:none) Streptococcus sanguinis SK36, co...    50   4e-05
CP000110_2334(CP000110|pid:none) Synechococcus sp. CC9605, compl...    50   4e-05
CP001390_1038(CP001390|pid:none) Geobacter sp. FRC-32, complete ...    50   4e-05
CP001124_78(CP001124|pid:none) Geobacter bemidjiensis Bem, compl...    50   4e-05
CP000089_3523(CP000089|pid:none) Dechloromonas aromatica RCB, co...    50   4e-05
CP000909_2454(CP000909|pid:none) Chloroflexus aurantiacus J-10-f...    50   4e-05
CR555306_1702(CR555306|pid:none) Azoarcus sp. EbN1 complete geno...    50   4e-05
U79580_1(U79580|pid:none) Pseudomonas aeruginosa pilK gene, part...    50   4e-05
AE017348_155(AE017348|pid:none) Cryptococcus neoformans var. neo...    50   4e-05
CP000252_3074(CP000252|pid:none) Syntrophus aciditrophicus SB, c...    50   4e-05
FM209186_411(FM209186|pid:none) Pseudomonas aeruginosa LESB58 co...    50   4e-05
CP001344_3468(CP001344|pid:none) Cyanothece sp. PCC 7425, comple...    50   4e-05
CU207366_1403(CU207366|pid:none) Gramella forsetii KT0803 comple...    50   4e-05
CP000930_2287(CP000930|pid:none) Heliobacterium modesticaldum Ic...    50   4e-05
A97740(A97740) hypothetical protein RC0321 [imported] - Ricketts...    50   4e-05
CP001291_1489(CP001291|pid:none) Cyanothece sp. PCC 7424, comple...    50   4e-05
CP001053_2190(CP001053|pid:none) Burkholderia phytofirmans PsJN ...    50   4e-05
AE010299_3318(AE010299|pid:none) Methanosarcina acetivorans str....    50   4e-05
CP000148_1718(CP000148|pid:none) Geobacter metallireducens GS-15...    50   4e-05
AE005673_431(AE005673|pid:none) Caulobacter crescentus CB15, com...    50   4e-05
CP000661_1774(CP000661|pid:none) Rhodobacter sphaeroides ATCC 17...    50   4e-05
CP001227_190(CP001227|pid:none) Rickettsia peacockii str. Rustic...    50   4e-05
AE004091_414(AE004091|pid:none) Pseudomonas aeruginosa PAO1, com...    50   4e-05
CP000885_2116(CP000885|pid:none) Clostridium phytofermentans ISD...    50   4e-05
AE016853_1462(AE016853|pid:none) Pseudomonas syringae pv. tomato...    50   4e-05
AP006618_4984(AP006618|pid:none) Nocardia farcinica IFM 10152 DN...    50   4e-05
CP001358_1364(CP001358|pid:none) Desulfovibrio desulfuricans sub...    50   4e-05
CP000713_2138(CP000713|pid:none) Psychrobacter sp. PRwf-1, compl...    50   4e-05
CP000513_1037(CP000513|pid:none) Dichelobacter nodosus VCS1703A,...    50   4e-05
CP001280_1426(CP001280|pid:none) Methylocella silvestris BL2, co...    50   4e-05
BX640427_186(BX640427|pid:none) Bordetella parapertussis strain ...    49   6e-05
CP000393_4322(CP000393|pid:none) Trichodesmium erythraeum IMS101...    49   6e-05
AF135388_2(AF135388|pid:none) Tolypothrix PCC7601 RadA gene, par...    49   6e-05
CP000139_581(CP000139|pid:none) Bacteroides vulgatus ATCC 8482, ...    49   6e-05
AM114193_2306(AM114193|pid:none) Uncultured methanogenic archaeo...    49   6e-05
CP000449_480(CP000449|pid:none) Maricaulis maris MCS10, complete...    49   6e-05
CP000239_936(CP000239|pid:none) Synechococcus sp. JA-3-3Ab, comp...    49   6e-05
CP001175_94(CP001175|pid:none) Listeria monocytogenes HCC23, com...    49   6e-05
CP000698_1527(CP000698|pid:none) Geobacter uraniireducens Rf4, c...    49   6e-05
CP000438_1305(CP000438|pid:none) Pseudomonas aeruginosa UCBPP-PA...    49   6e-05
CP001070_37(CP001070|pid:none) Ralstonia pickettii 12J plasmid p...    49   6e-05
AM746676_2209(AM746676|pid:none) Sorangium cellulosum 'So ce 56'...    49   6e-05
CP000393_3787(CP000393|pid:none) Trichodesmium erythraeum IMS101...    49   6e-05
AM902716_2116(AM902716|pid:none) Bordetella petrii strain DSM 12...    49   6e-05
CP000817_2063(CP000817|pid:none) Lysinibacillus sphaericus C3-41...    49   6e-05
CP000076_5730(CP000076|pid:none) Pseudomonas fluorescens Pf-5, c...    49   6e-05
AM263198_2449(AM263198|pid:none) Listeria welshimeri serovar 6b ...    49   6e-05
CP000698_3079(CP000698|pid:none) Geobacter uraniireducens Rf4, c...    49   6e-05
AM942444_545(AM942444|pid:none) Corynebacterium urealyticum DSM ...    49   6e-05
CP000576_148(CP000576|pid:none) Prochlorococcus marinus str. MIT...    49   6e-05
CP000111_138(CP000111|pid:none) Prochlorococcus marinus str. MIT...    49   6e-05
CP000908_942(CP000908|pid:none) Methylobacterium extorquens PA1,...    49   6e-05
CP001581_1095(CP001581|pid:none) Clostridium botulinum A2 str. K...    49   6e-05
CP000612_1531(CP000612|pid:none) Desulfotomaculum reducens MI-1,...    49   6e-05
CP000815_283(CP000815|pid:none) Paulinella chromatophora chromat...    49   6e-05
CP000698_2737(CP000698|pid:none) Geobacter uraniireducens Rf4, c...    49   6e-05
AJ620477_2(AJ620477|pid:none) Angiococcus disciformis partial OR...    49   6e-05
CP000951_2818(CP000951|pid:none) Synechococcus sp. PCC 7002, com...    49   6e-05
CT573071_225(CT573071|pid:none) Kuenenia stuttgartiensis genome ...    49   6e-05
CP000462_1212(CP000462|pid:none) Aeromonas hydrophila subsp. hyd...    49   6e-05
EU345411_1(EU345411|pid:none) Listeria monocytogenes clone FSL R...    49   6e-05
CP001032_3777(CP001032|pid:none) Opitutus terrae PB90-1, complet...    49   6e-05
CP001037_5283(CP001037|pid:none) Nostoc punctiforme PCC 73102, c...    49   6e-05
CP000698_2260(CP000698|pid:none) Geobacter uraniireducens Rf4, c...    49   6e-05
CP000551_146(CP000551|pid:none) Prochlorococcus marinus str. AS9...    49   6e-05
CP000633_3173(CP000633|pid:none) Agrobacterium vitis S4 chromoso...    49   6e-05
CP000804_966(CP000804|pid:none) Roseiflexus castenholzii DSM 139...    49   6e-05
CP001504_306(CP001504|pid:none) Burkholderia glumae BGR1 chromos...    49   6e-05
EU345402_1(EU345402|pid:none) Listeria monocytogenes clone FSL J...    49   7e-05
AE1387(AE1387) two-component response phosphate regulator phoP [...    49   7e-05
BX572593_144(BX572593|pid:none) Rhodopseudomonas palustris CGA00...    49   7e-05
CP001037_3320(CP001037|pid:none) Nostoc punctiforme PCC 73102, c...    49   7e-05
CP000117_1874(CP000117|pid:none) Anabaena variabilis ATCC 29413,...    49   7e-05
CP000431_5566(CP000431|pid:none) Rhodococcus jostii RHA1, comple...    49   7e-05
EU345386_1(EU345386|pid:none) Listeria monocytogenes clone FSL F...    49   7e-05
BA000045_3122(BA000045|pid:none) Gloeobacter violaceus PCC 7421 ...    49   7e-05
CP000094_5299(CP000094|pid:none) Pseudomonas fluorescens Pf0-1, ...    49   7e-05
AE008691_1518(AE008691|pid:none) Thermoanaerobacter tengcongensi...    49   7e-05
EU345392_1(EU345392|pid:none) Listeria monocytogenes clone FSL F...    49   7e-05
CP000473_6559(CP000473|pid:none) Solibacter usitatus Ellin6076, ...    49   7e-05
AE017262_2449(AE017262|pid:none) Listeria monocytogenes str. 4b ...    49   7e-05
CP001287_1525(CP001287|pid:none) Cyanothece sp. PCC 8801, comple...    49   7e-05
CP001052_3909(CP001052|pid:none) Burkholderia phytofirmans PsJN ...    49   7e-05
CP000254_2663(CP000254|pid:none) Methanospirillum hungatei JF-1,...    49   7e-05
(A0PWB4) RecName: Full=Response regulator mprA; AltName: Full=My...    49   7e-05
CP000435_2546(CP000435|pid:none) Synechococcus sp. CC9311, compl...    49   7e-05
FM242711_2433(FM242711|pid:none) Listeria monocytogenes Clip8145...    49   7e-05
CP000482_2615(CP000482|pid:none) Pelobacter propionicus DSM 2379...    49   7e-05
AM746676_714(AM746676|pid:none) Sorangium cellulosum 'So ce 56' ...    49   7e-05
CP000562_294(CP000562|pid:none) Methanoculleus marisnigri JR1, c...    49   7e-05
CP000828_3950(CP000828|pid:none) Acaryochloris marina MBIC11017,...    49   7e-05
CP000686_3834(CP000686|pid:none) Roseiflexus sp. RS-1, complete ...    49   7e-05
AE017282_788(AE017282|pid:none) Methylococcus capsulatus str. Ba...    49   7e-05
CP000252_2795(CP000252|pid:none) Syntrophus aciditrophicus SB, c...    49   7e-05
CP001344_4341(CP001344|pid:none) Cyanothece sp. PCC 7425, comple...    49   7e-05
CP000419_914(CP000419|pid:none) Streptococcus thermophilus LMD-9...    49   7e-05
Y09666_1(Y09666|pid:none) B.japonicum ragA, ragB and rpoH3 genes.      49   7e-05
AE015928_4661(AE015928|pid:none) Bacteroides thetaiotaomicron VP...    49   7e-05
CP000239_461(CP000239|pid:none) Synechococcus sp. JA-3-3Ab, comp...    49   7e-05
CP000959_544(CP000959|pid:none) Burkholderia cenocepacia MC0-3 c...    49   7e-05
CP000725_756(CP000725|pid:none) Streptococcus gordonii str. Chal...    49   7e-05
EU345385_1(EU345385|pid:none) Listeria monocytogenes clone FSL F...    49   7e-05
CP000082_1813(CP000082|pid:none) Psychrobacter arcticus 273-4, c...    49   7e-05
CP000828_2224(CP000828|pid:none) Acaryochloris marina MBIC11017,...    49   1e-04
CP000113_5056(CP000113|pid:none) Myxococcus xanthus DK 1622, com...    49   1e-04
CP001089_3487(CP001089|pid:none) Geobacter lovleyi SZ, complete ...    49   1e-04
CR555306_93(CR555306|pid:none) Azoarcus sp. EbN1 complete genome.      49   1e-04
CU207211_1231(CU207211|pid:none) Herminiimonas arsenicoxydans ch...    49   1e-04
AL009126_3014(AL009126|pid:none) Bacillus subtilis subsp. subtil...    49   1e-04
CP000680_406(CP000680|pid:none) Pseudomonas mendocina ymp, compl...    49   1e-04
CP001322_3587(CP001322|pid:none) Desulfatibacillum alkenivorans ...    49   1e-04
BX571865_106(BX571865|pid:none) Photorhabdus luminescens subsp. ...    49   1e-04
CP000096_1182(CP000096|pid:none) Pelodictyon luteolum DSM 273, c...    49   1e-04
CP001344_3142(CP001344|pid:none) Cyanothece sp. PCC 7425, comple...    49   1e-04
(P13792) RecName: Full=Alkaline phosphatase synthesis transcript...    49   1e-04
U67196_1(U67196|pid:none) Thermotoga maritima DNA-binding respon...    49   1e-04
CP000481_2095(CP000481|pid:none) Acidothermus cellulolyticus 11B...    49   1e-04
BX548175_2561(BX548175|pid:none) Prochlorococcus marinus MIT9313...    49   1e-04
CT971583_2271(CT971583|pid:none) Synechococcus WH7803 complete g...    49   1e-04
CP000806_3718(CP000806|pid:none) Cyanothece sp. ATCC 51142 circu...    49   1e-04
CP000254_2604(CP000254|pid:none) Methanospirillum hungatei JF-1,...    49   1e-04
CP000117_4860(CP000117|pid:none) Anabaena variabilis ATCC 29413,...    49   1e-04
CP000539_3642(CP000539|pid:none) Acidovorax sp. JS42, complete g...    49   1e-04
AE003852_1328(AE003852|pid:none) Vibrio cholerae O1 biovar eltor...    49   1e-04
AE000512_1628(AE000512|pid:none) Thermotoga maritima MSB8, compl...    49   1e-04
CP000686_2279(CP000686|pid:none) Roseiflexus sp. RS-1, complete ...    49   1e-04
CP001344_855(CP001344|pid:none) Cyanothece sp. PCC 7425, complet...    49   1e-04
CP001013_236(CP001013|pid:none) Leptothrix cholodnii SP-6, compl...    49   1e-04
CP000512_4301(CP000512|pid:none) Acidovorax citrulli AAC00-1, co...    49   1e-04
CP000282_3624(CP000282|pid:none) Saccharophagus degradans 2-40, ...    49   1e-04
CP000828_5524(CP000828|pid:none) Acaryochloris marina MBIC11017,...    49   1e-04
AM743169_3397(AM743169|pid:none) Stenotrophomonas maltophilia K2...    49   1e-04
CP000152_2298(CP000152|pid:none) Burkholderia sp. 383 chromosome...    49   1e-04
CP000909_3773(CP000909|pid:none) Chloroflexus aurantiacus J-10-f...    49   1e-04
CP001635_4101(CP001635|pid:none) Variovorax paradoxus S110 chrom...    49   1e-04
AP008231_439(AP008231|pid:none) Synechococcus elongatus PCC 6301...    49   1e-04
CP001390_2145(CP001390|pid:none) Geobacter sp. FRC-32, complete ...    49   1e-04
CP001147_1294(CP001147|pid:none) Thermodesulfovibrio yellowstoni...    49   1e-04
CP000416_1936(CP000416|pid:none) Lactobacillus brevis ATCC 367, ...    49   1e-04
CP000951_1352(CP000951|pid:none) Synechococcus sp. PCC 7002, com...    49   1e-04
CP000764_764(CP000764|pid:none) Bacillus cereus subsp. cytotoxis...    49   1e-04
AE2276(AE2276) two-component hybrid sensor and regulator all3764...    49   1e-04
CP000390_1339(CP000390|pid:none) Mesorhizobium sp. BNC1, complet...    49   1e-04
CP000627_936(CP000627|pid:none) Vibrio cholerae O395 chromosome ...    49   1e-04
CP000117_239(CP000117|pid:none) Anabaena variabilis ATCC 29413, ...    49   1e-04
AP009324_1680(AP009324|pid:none) Staphylococcus aureus subsp. au...    48   1e-04
CP000435_2540(CP000435|pid:none) Synechococcus sp. CC9311, compl...    48   1e-04
CP000904_37(CP000904|pid:none) Bacillus weihenstephanensis KBAB4...    48   1e-04
CP000661_2314(CP000661|pid:none) Rhodobacter sphaeroides ATCC 17...    48   1e-04
CP000097_312(CP000097|pid:none) Synechococcus sp. CC9902, comple...    48   1e-04
CT971583_2270(CT971583|pid:none) Synechococcus WH7803 complete g...    48   1e-04
CP000393_3631(CP000393|pid:none) Trichodesmium erythraeum IMS101...    48   1e-04
CP001291_2812(CP001291|pid:none) Cyanothece sp. PCC 7424, comple...    48   1e-04
CP000284_1279(CP000284|pid:none) Methylobacillus flagellatus KT,...    48   1e-04
CU633750_1719(CU633750|pid:none) Cupriavidus taiwanensis str. LM...    48   1e-04
AP008231_684(AP008231|pid:none) Synechococcus elongatus PCC 6301...    48   1e-04
CP001013_4151(CP001013|pid:none) Leptothrix cholodnii SP-6, comp...    48   1e-04
CP001124_2397(CP001124|pid:none) Geobacter bemidjiensis Bem, com...    48   1e-04
AY548383_1(AY548383|pid:none) Alcaligenes faecalis strain WM2072...    48   1e-04
BX571659_109(BX571659|pid:none) Wolinella succinogenes, complete...    48   1e-04
AM747722_235(AM747722|pid:none) Burkholderia cenocepacia J2315 c...    48   1e-04
CP001291_5082(CP001291|pid:none) Cyanothece sp. PCC 7424, comple...    48   1e-04
AE008691_444(AE008691|pid:none) Thermoanaerobacter tengcongensis...    48   1e-04
CP001087_3959(CP001087|pid:none) Desulfobacterium autotrophicum ...    48   1e-04
CP000269_2096(CP000269|pid:none) Janthinobacterium sp. Marseille...    48   1e-04
CP000821_2858(CP000821|pid:none) Shewanella sediminis HAW-EB3, c...    48   1e-04
AF2109(AF2109) two-component response regulator alr2429 [importe...    48   1e-04
CP000702_447(CP000702|pid:none) Thermotoga petrophila RKU-1, com...    48   1e-04
CP000116_1614(CP000116|pid:none) Thiobacillus denitrificans ATCC...    48   1e-04
CU459003_3466(CU459003|pid:none) Magnetospirillum gryphiswaldens...    48   1e-04
CP001072_378(CP001072|pid:none) Helicobacter pylori Shi470, comp...    48   1e-04

>(Q54SP4) RecName: Full=Hybrid signal transduction histidine kinase
           D;          EC=2.7.13.3;
          Length = 1546

 Score =  147 bits (372), Expect = 1e-34
 Identities = 75/89 (84%), Positives = 81/89 (91%)
 Frame = +1

Query: 244 INHKKIYIINQ*F*WLKDNPEMNRFIAELLSKYYFVVTAFDGVEGIEKTRAITPDLIVTD 423
           I++K I ++      ++DNPEMNRFIAELLSKYYFVVTAFDGVEGIEKTRAITPDLIVTD
Sbjct: 566 IHNKPIVLV------VEDNPEMNRFIAELLSKYYFVVTAFDGVEGIEKTRAITPDLIVTD 619

Query: 424 CMMPRMSGDEMVEQLRSDEQFDNIPILLL 510
           CMMPRMSGDEMVEQLRSDEQFDNIPILLL
Sbjct: 620 CMMPRMSGDEMVEQLRSDEQFDNIPILLL 648

 Score =  120 bits (302), Expect = 2e-26
 Identities = 61/61 (100%), Positives = 61/61 (100%)
 Frame = +3

Query: 111 FNILKKTNTSSDIASNALKDNMGSIMGVHAIAQQAVEELTEKQFYQSQENIHNKPIVLVV 290
           FNILKKTNTSSDIASNALKDNMGSIMGVHAIAQQAVEELTEKQFYQSQENIHNKPIVLVV
Sbjct: 516 FNILKKTNTSSDIASNALKDNMGSIMGVHAIAQQAVEELTEKQFYQSQENIHNKPIVLVV 575

Query: 291 E 293
           E
Sbjct: 576 E 576

Lambda     K      H
   0.318    0.134    0.401

Gapped
Lambda     K      H
   0.267   0.0410    0.140

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3236559
Number of Hits to DB: 603,477,313
Number of extensions: 9795028
Number of successful extensions: 32360
Number of sequences better than 10.0: 6024
Number of HSP's gapped: 32297
Number of HSP's successfully gapped: 6110
Length of query: 172
Length of database: 1,051,180,864
Length adjustment: 119
Effective length of query: 53
Effective length of database: 666,030,343
Effective search space: 35299608179
Effective search space used: 35299608179
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 30 (16.2 bits)

 psg: 0.50  gvh: 0.31  alm: 0.51  top: 0.53  tms: 0.00  mit: 0.21  mip: 0.00
 nuc: 0.00  erl: 0.00  erm: 0.00  pox: 0.00  px2: 0.00  vac: 0.00  rnp: 0.00
 act: 0.00  caa: 0.00  yqr: 0.00  tyr: 0.00  leu: 0.00  gpi: 0.00  myr: 0.00
 dna: 0.00  rib: 0.00  bac: 0.00  m1a: 0.00  m1b: 0.00  m2 : 0.00  mNt: 0.00
 m3a: 0.00  m3b: 0.00  m_ : 1.00 

	 48.0 %: nuclear
	 28.0 %: cytoplasmic
	 12.0 %: mitochondrial
	  4.0 %: cytoskeletal
	  4.0 %: vacuolar
	  4.0 %: vesicles of secretory system

>> prediction for Contig-U14072-1 is nuc