Contig-U14029-1
Contig ID Contig-U14029-1
Contig update 2002.12.18
Contig sequence
>Contig-U14029-1 (Contig-U14029-1Q) /CSM_Contig/Contig-U14029-1Q.Seq.d
TAACACATCCAATTATAAAAACTAAACCCTATAGAATTAGAAATGAACCC
AGATTATCATTATTTATTTAAATTACTTTTAATCGGTGATAGTGGTGTAG
GTAAATCATGTCTTTTACTTAGATTTGCTGATGACACTTATTCAGAAAGT
TTCATCTCAACAATTGGTGTCGATTTCAAGATTAGAACTATCGAATTAAA
TGGTAAAACCATTAAATTACAAATTTGGGATACTGCAGGACAAGAAAGAT
TTAGAACAATTACATCATCATATTATCGTGGTGCCCATGGTATCATTGTT
GTTTATGATGTAACTGATAAATTAACATTTGAAAACGTTAGACAATGGTT
ACAAGAAATTGATAGATTTGCATGCGAAAATGTAAATAAACTTTTAGTTG
GAAACAAGAGTGATCTTGTCGCTAAAAAAGTTGTAGATTTCAATACCGCC
AAAGCTTTTGCCGACTCTCTTCAAATTCCTTTCCTCGAAACCTCTGCAAA
ACAATCAACAAACGTAGAACAAGCATTTATGACAATGGCCACTGAAATTA
AAAATAGATTAACAGCTTCTCAACCAACTCAAACCGTTGATAAAAATAAG
GTTGTACCAGGTTCCTCTGCTCCAATCTCTCCAAAATCTGGTTGTTGTTA
AAACTAAAATAATATATTTTATAATTTTTTCCAATTAAAGTCATCACACA
CACACATACATACCAACAAAAATTACAACCACACATATATACGAAGTTTA
ACTCAATCATCGTTATCATCAAAATCACTCTTCAACCAAACAAGTAAAAA
AAAAAAAACCCTATTTGTTGTATAAAACCTCCAACACACAAAAAAAAAAC
CACCCCCCCCCTTTCCACGTTTTCTATATATAAAAAAAAAATACA

Gap no gap
Contig length 895
Chromosome number (1..6, M) 4
Chromosome length 5430582
Start point 1246424
End point 1245529
Strand (PLUS/MINUS) MINUS
Number of clones 4
Number of EST 4
Link to clone list U14029
List of clone(s)

est1=SLC626E,-41,894
est2=AHD475F,2,643
est3=VSJ747Z,28,579
est4=SLG147Z,319,896
Translated Amino Acid sequence
*hiql*KLNPIELEMNPDYHYLFKLLLIGDSGVGKSCLLLRFADDTYSESFISTIGVDFK
IRTIELNGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDKLTFENVRQWLQEI
DRFACENVNKLLVGNKSDLVAKKVVDFNTAKAFADSLQIPFLETSAKQSTNVEQAFMTMA
TEIKNRLTASQPTQTVDKNKVVPGSSAPISPKSGCC*n*nnifynffqlksshthihtnk
nynhtyirsltqsslsskslfnqtskkkktlfvv*nlqhtkkkppppfprflyikkky


Translated Amino Acid sequence (All Frames)
Frame A:
*hiql*KLNPIELEMNPDYHYLFKLLLIGDSGVGKSCLLLRFADDTYSESFISTIGVDFK
IRTIELNGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDKLTFENVRQWLQEI
DRFACENVNKLLVGNKSDLVAKKVVDFNTAKAFADSLQIPFLETSAKQSTNVEQAFMTMA
TEIKNRLTASQPTQTVDKNKVVPGSSAPISPKSGCC*n*nnifynffqlksshthihtnk
nynhtyirsltqsslsskslfnqtskkkktlfvv*nlqhtkkkppppfprflyikkky


Frame B:
ntsnykn*tl*n*k*tqiiiiylnyf*svivv*vnhvfyldllmtliqkvssqqlvsisr
lelsn*mvkplnykfgilqdkkdleqlhhhiivvpmvsllfmm*lin*hlktldngykkl
idlhakm*inf*letrvilslkkl*isippkllptlfkflsskplqnnqqt*nkhl*qwp
lklkid*qllnqlkplikirlyqvpllqslqnlvvvktkiiyfiifsn*shhthtyiptk
ittthiyev*lnhryhqnhsstkqvkkkkpyllyktsntqkknhpppfhvfyi*kknt


Frame C:
thpiiktkpyrirneprlslfi*itfnr**wcr*imsft*ic**hlfrkfhlnnwcrfqd
*nyrikw*nh*itnlgycrtrki*nnyiiilswcpwyhccl*cn**ini*kr*tmvtrn*
*icmrkck*tfswkqe*scr*kscrfqyrqsfcrlssnsfprnlcktinkrrtsiydngh
*n*k*insfstnsnr**k*gctrflcsnlskiwlllklk*yil*ffpikviththtyqqk
lqphiytkfnsiiviikitlqpnk*kkknpiccikppthkkkttpplstfsiykkki


own update 2004. 6.10
Homology vs CSM-cDNA
Query= Contig-U14029-1 (Contig-U14029-1Q)
/CSM_Contig/Contig-U14029-1Q.Seq.d
(895 letters)

Database: CSM
6905 sequences; 5,674,871 total letters


Score E
Sequences producing significant alignments: (bits) Value

Contig-U14029-1 (Contig-U14029-1Q) /CSM_Contig/Conti... 1505 0.0
Contig-U12243-1 (Contig-U12243-1Q) /CSM_Contig/Conti... 236 3e-62
Contig-U10248-1 (Contig-U10248-1Q) /CSM_Contig/Conti... 84 3e-16
Contig-U12705-1 (Contig-U12705-1Q) /CSM_Contig/Conti... 74 3e-13
Contig-U04090-1 (Contig-U04090-1Q) /CSM_Contig/Conti... 72 1e-12
Contig-U14031-1 (Contig-U14031-1Q) /CSM_Contig/Conti... 70 5e-12
Contig-U11353-1 (Contig-U11353-1Q) /CSM_Contig/Conti... 42 0.001
Contig-U11206-1 (Contig-U11206-1Q) /CSM_Contig/Conti... 40 0.004
Contig-U14470-1 (Contig-U14470-1Q) /CSM_Contig/Conti... 38 0.016
Contig-U07963-1 (Contig-U07963-1Q) /CSM_Contig/Conti... 38 0.016

>Contig-U14029-1 (Contig-U14029-1Q) /CSM_Contig/Contig-U14029-1Q.Seq.d
Length = 895

Score = 1505 bits (759), Expect = 0.0
Identities = 783/795 (98%)
Strand = Plus / Plus


Query: 1 taacacatccaattataaaaactaaaccctatagaattagaaatgaacccagattatcat 60
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1 taacacatccaattataaaaactaaaccctatagaattagaaatgaacccagattatcat 60


Query: 61 tatttatttaaattacttttaatcggtgatagtggtgtaggtaaatcatgtcttttactt 120
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 61 tatttatttaaattacttttaatcggtgatagtggtgtaggtaaatcatgtcttttactt 120


Query: 121 agatttgctgatgacacttattcagaaagtttcatctcaacaattggtgtcgatttcaag 180
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 121 agatttgctgatgacacttattcagaaagtttcatctcaacaattggtgtcgatttcaag 180


Query: 181 attagaactatcgaattaaatggtaaaaccattaaattacaaatttgggatactgcagga 240
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 181 attagaactatcgaattaaatggtaaaaccattaaattacaaatttgggatactgcagga 240


Query: 241 caagaaagatttagaacaattacatcatcatattatcgtggtgcccatggtatcattgtt 300
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 241 caagaaagatttagaacaattacatcatcatattatcgtggtgcccatggtatcattgtt 300


Query: 301 gtttatgatgtaactgataaattaacatttgaaaacgttagacaatggttacaagaaatt 360
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 301 gtttatgatgtaactgataaattaacatttgaaaacgttagacaatggttacaagaaatt 360


Query: 361 gatagatttgcatgcgaaaatgtaaataaacttttagttggaaacaagagtgatcttgtc 420
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 361 gatagatttgcatgcgaaaatgtaaataaacttttagttggaaacaagagtgatcttgtc 420


Query: 421 gctaaaaaagttgtagatttcaataccgccaaagcttttgccgactctcttcaaattcct 480
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 421 gctaaaaaagttgtagatttcaataccgccaaagcttttgccgactctcttcaaattcct 480


Query: 481 ttcctcgaaacctctgcaaaacaatcaacaaacgtagaacaagcatttatgacaatggcc 540
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 481 ttcctcgaaacctctgcaaaacaatcaacaaacgtagaacaagcatttatgacaatggcc 540


Query: 541 actgaaattaaaaatagattaacagcttctcaaccaactcaaaccgttgataaaaataag 600
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 541 actgaaattaaaaatagattaacagcttctcaaccaactcaaaccgttgataaaaataag 600


Query: 601 gttgtaccaggttcctctgctccaatctctccaaaatctggttgttgttaaaactaaaat 660
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 601 gttgtaccaggttcctctgctccaatctctccaaaatctggttgttgttaaaactaaaat 660


Query: 661 aatatattttataattttttccaattaaagtcatnnnnnnnnnnnntacataccaacaaa 720
|||||||||||||||||||||||||||||||||| ||||||||||||||
Sbjct: 661 aatatattttataattttttccaattaaagtcatcacacacacacatacataccaacaaa 720


Query: 721 aattacaaccacacatatatacgaagtttaactcaatcatcgttatcatcaaaatcactc 780
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 721 aattacaaccacacatatatacgaagtttaactcaatcatcgttatcatcaaaatcactc 780


Query: 781 ttcaaccaaacaagt 795
|||||||||||||||
Sbjct: 781 ttcaaccaaacaagt 795


Score = 85.7 bits (43), Expect = 8e-17
Identities = 63/73 (86%)
Strand = Plus / Plus


Query: 809 ccctatttgttgtataaaacctccaacacacnnnnnnnnnnccaccccccccctttccac 868
||||||||||||||||||||||||||||||| |||||||||||||||||||
Sbjct: 809 ccctatttgttgtataaaacctccaacacacaaaaaaaaaaccaccccccccctttccac 868


Query: 869 gttttctatatat 881
|||||||||||||
Sbjct: 869 gttttctatatat 881


>Contig-U12243-1 (Contig-U12243-1Q) /CSM_Contig/Contig-U12243-1Q.Seq.d
Length = 1637

Score = 236 bits (119), Expect = 3e-62
Identities = 220/251 (87%), Gaps = 2/251 (0%)
Strand = Plus / Plus


Query: 70 aaattacttttaatcggtgatagtggtgtaggtaaatcatgtcttttac-ttagatttgc 128
|||||||| ||||||||||||||||||||||||||||||||| |||| ||||||||||
Sbjct: 907 aaattactcttaatcggtgatagtggtgtaggtaaatcatgttaattaccttagatttgc 966


Query: 129 tgatgacacttattcagaaagtt-tcatctcaacaattggtgtcgatttcaagattagaa 187
||||| || ||| |||| |||| | || |||||||||||||| ||||| || ||| | |
Sbjct: 967 agatgatacatatacagagagttattatttcaacaattggtgttgattttaaaattcgta 1026


Query: 188 ctatcgaattaaatggtaaaaccattaaattacaaatttgggatactgcaggacaagaaa 247
| || | ||| ||||||| | ||||||||||||||| ||||||||||||||||||||||
Sbjct: 1027 caattaatttagatggtaagatcattaaattacaaatctgggatactgcaggacaagaaa 1086


Query: 248 gatttagaacaattacatcatcatattatcgtggtgcccatggtatcattgttgtttatg 307
|||| |||||||||||||||||||||||||||||||| ||||||||||| ||||| ||||
Sbjct: 1087 gattcagaacaattacatcatcatattatcgtggtgcacatggtatcatcgttgtgtatg 1146


Query: 308 atgtaactgat 318
|||| ||||||
Sbjct: 1147 atgtcactgat 1157


Score = 56.0 bits (28), Expect = 7e-08
Identities = 58/68 (85%)
Strand = Plus / Plus


Query: 487 gaaacctctgcaaaacaatcaacaaacgtagaacaagcatttatgacaatggccactgaa 546
||||| ||||| ||| |||| |||| ||||||||||||||||||| ||||| | ||||
Sbjct: 1326 gaaacatctgccaaatcatcagcaaatgtagaacaagcatttatgattatggctagtgaa 1385


Query: 547 attaaaaa 554
||||||||
Sbjct: 1386 attaaaaa 1393


>Contig-U10248-1 (Contig-U10248-1Q) /CSM_Contig/Contig-U10248-1Q.Seq.d
Length = 773

Score = 83.8 bits (42), Expect = 3e-16
Identities = 54/58 (93%)
Strand = Plus / Plus


Query: 212 ttaaattacaaatttgggatactgcaggacaagaaagatttagaacaattacatcatc 269
|||| ||||||||||||||||| ||||||||||| ||||| |||||||||||||||||
Sbjct: 205 ttaatttacaaatttgggatacagcaggacaagagagattcagaacaattacatcatc 262


Database: CSM
Posted date: Jun 9, 2004 7:35 PM
Number of letters in database: 5,674,871
Number of sequences in database: 6905

Lambda K H
1.37 0.711 1.31

Gapped
Lambda K H
1.37 0.711 1.31


Matrix: blastn matrix:1 -3
Gap Penalties: Existence: 5, Extension: 2
Number of Hits to DB: 16,166
Number of Sequences: 6905
Number of extensions: 16166
Number of successful extensions: 1791
Number of sequences better than 10.0: 202
length of query: 895
length of database: 5,674,871
effective HSP length: 16
effective length of query: 879
effective length of database: 5,564,391
effective search space: 4891099689
effective search space used: 4891099689
T: 0
A: 40
X1: 6 (11.9 bits)
X2: 15 (29.7 bits)
S1: 12 (24.3 bits)
S2: 15 (30.2 bits)
dna update 2008.12.16
Homology vs DNA
Query= Contig-U14029-1 (Contig-U14029-1Q) /CSM_Contig/Contig-U14029-1Q.Seq.d
(895 letters)

Database: ddbj_A
92,845,959 sequences; 95,242,211,685 total letters

Searching..................................................done

Score E
Sequences producing significant alignments: (bits) Value N

(BJ331981) Dictyostelium discoideum cDNA clone:dda37f20, 5' ... 1257 0.0 1
(AU061016) Dictyostelium discoideum slug cDNA, clone SLC626. 1043 0.0 1
(L21009) Dictyostelium discoideum Rab1A mRNA, complete cds. 993 0.0 3
(AU270410) Dictyostelium discoideum vegetative cDNA clone:VS... 844 0.0 3
(AU039666) Dictyostelium discoideum slug cDNA, clone SLG147. 745 0.0 4
(AU034615) Dictyostelium discoideum slug cDNA, clone SLC626. 478 e-170 4
(C93909) Dictyostelium discoideum slug cDNA, clone SSL855. 172 2e-78 3
(C93756) Dictyostelium discoideum slug cDNA, clone SSL682. 172 1e-75 3
(BJ430080) Dictyostelium discoideum cDNA clone:ddv6c03, 3' e... 172 3e-75 3
(AU038347) Dictyostelium discoideum slug cDNA, clone SSH594. 172 1e-70 2
(L21010) Dictyostelium discoideum Rab1B mRNA, 3' end of cds. 125 2e-70 4
(EC762173) PSE00007879 rw_mgpallid Polysphondylium pallidum ... 178 4e-70 5
(C89695) Dictyostelium discoideum slug cDNA, clone SSA695. 149 1e-64 4
(C93260) Dictyostelium discoideum slug cDNA, clone SSM886. 172 9e-64 3
(C93700) Dictyostelium discoideum slug cDNA, clone SSL623. 145 4e-57 6
(EC824262) SME00007547 esmbsro2 Sawyeria marylandensis cDNA,... 98 7e-55 6
(EA200507) Sequence 64822 from patent US 7214786. 218 1e-54 2
(EC819807) SME00002670 esmbsro2 Sawyeria marylandensis cDNA,... 98 5e-54 4
(C90802) Dictyostelium discoideum slug cDNA, clone SSJ166. 125 6e-54 3
(C93305) Dictyostelium discoideum slug cDNA, clone SSM603. 172 2e-50 3
(C92440) Dictyostelium discoideum slug cDNA, clone SSE547. 172 3e-50 3
(C90430) Dictyostelium discoideum slug cDNA, clone SSI475. 172 1e-47 2
(BJ434188) Dictyostelium discoideum cDNA clone:ddv16l01, 3' ... 109 7e-47 3
(M34457) Dictyostelium discoideum GTP-binding protein SAS1 g... 109 3e-46 3
(BJ415110) Dictyostelium discoideum cDNA clone:ddv21o12, 5' ... 109 3e-46 3
(BJ327500) Dictyostelium discoideum cDNA clone:dda20m14, 5' ... 109 3e-46 3
(BJ412726) Dictyostelium discoideum cDNA clone:ddv9j18, 5' e... 109 3e-46 3
(BJ328400) Dictyostelium discoideum cDNA clone:dda28e03, 5' ... 109 3e-46 3
(BJ347346) Dictyostelium discoideum cDNA clone:dda26h20, 3' ... 109 3e-46 3
(AL440480) T3 end of clone BD0AA012F12 of library BD0AA from... 163 1e-45 3
(BJ397989) Dictyostelium discoideum cDNA clone:dds10d18, 3' ... 109 4e-45 3
(EE282655) SAAH-aab11d02.g1 Agen 0058 Schmidtea mediterranea... 157 2e-44 3
(EG416999) SAAH-aab55g07.b1 Agen 0058 Schmidtea mediterranea... 157 2e-44 3
(EG413517) SAAH-aab11d02.b1 Agen 0058 Schmidtea mediterranea... 157 2e-44 3
(EG409726) SAAH-aaa40d06.b1 Agen 0058 Schmidtea mediterranea... 157 2e-44 3
(EE666041) SAAH-aab55g07.g1 Agen 0058 Schmidtea mediterranea... 157 2e-44 3
(EC617428) SAAH-aaa40d06.g1 Agen 0058 Schmidtea mediterranea... 157 3e-44 3
(EE671325) SAAH-aac56f11.g1 Agen 0058 Schmidtea mediterranea... 157 3e-44 3
(BJ343136) Dictyostelium discoideum cDNA clone:dda22k04, 3' ... 109 6e-44 2
(BJ414563) Dictyostelium discoideum cDNA clone:ddv19j13, 5' ... 109 2e-43 2
(DN312681) PL06013B1D07 cDNA from juvenile hermaphodites Sch... 149 4e-42 3
(EC618058) SAAH-aaa63g09.g1 Agen 0058 Schmidtea mediterranea... 149 5e-42 3
(EG348194) SAAH-aac84f09.g1 Agen 0058 Schmidtea mediterranea... 149 5e-42 3
(EG351240) SAAH-aad16g09.g1 Agen 0058 Schmidtea mediterranea... 149 5e-42 3
(EE672460) SAAH-aab74f01.g1 Agen 0058 Schmidtea mediterranea... 149 5e-42 3
(EG350396) SAAH-aad11e09.g1 Agen 0058 Schmidtea mediterranea... 149 6e-42 3
(DN314465) PL06018A2F09 cDNA from juvenile hermaphodites Sch... 149 6e-42 3
(DN308618) PL05017A1F04 cDNA from sexually mature hermaphodi... 149 6e-42 3
(DN313077) PL06014B1F11 cDNA from juvenile hermaphodites Sch... 149 7e-42 3
(EC615581) SAAH-aaa66h03.g1 Agen 0058 Schmidtea mediterranea... 149 7e-42 3
(DN302017) PL04024A2H01 cDNA from sexually mature hermaphodi... 149 7e-42 3
(AU263839) Dictyostelium discoideum vegetative cDNA clone:VS... 98 1e-41 3
(BJ359917) Dictyostelium discoideum cDNA clone:ddc3a07, 5' e... 101 3e-39 2
(EG412200) SAAH-aaa93a01.b1 Agen 0058 Schmidtea mediterranea... 139 4e-39 3
(EE281430) SAAH-aaa93a01.g1 Agen 0058 Schmidtea mediterranea... 157 7e-39 2
(EG347207) SAAH-aaa75a09.g1 Agen 0058 Schmidtea mediterranea... 149 1e-38 3
(BG661470) kx02c10.y1 Parastrongyloides trichosuri IL SL1 TO... 60 1e-37 4
(CN141376) OX1_51_D09.b1_A002 Oxidatively-stressed leaves an... 92 1e-37 4
(DN297967) PL04011A1H10 cDNA from sexually mature hermaphodi... 121 1e-37 4
(AU071406) Dictyostelium discoideum slug cDNA, clone SSB424. 168 2e-37 1
(AU071405) Dictyostelium discoideum slug cDNA, clone SSB423. 168 2e-37 1
(DY889961) CeleSEQ6957 Cunninghamella elegans pBluescript (E... 86 3e-36 3
(DY894651) CeleSEQ14271 Cunninghamella elegans pBluescript (... 86 3e-36 3
(DY894599) CeleSEQ14208 Cunninghamella elegans pBluescript (... 86 3e-36 3
(C93361) Dictyostelium discoideum slug cDNA, clone SSM671. 127 1e-35 2
(BJ402782) Dictyostelium discoideum cDNA clone:dds18c10, 3' ... 103 2e-35 3
(AU284822) Dictyostelium discoideum gamete cDNA clone:FC-BM0... 117 5e-34 2
(C91481) Dictyostelium discoideum slug cDNA, clone SSK334. 100 6e-34 3
(AU060942) Dictyostelium discoideum slug cDNA, clone SLC331. 127 7e-34 2
(BX538352) Cryptosporidium parvum chromosome 6, complete seq... 78 2e-33 3
(BJ429793) Dictyostelium discoideum cDNA clone:ddv4l19, 3' e... 100 3e-33 2
(FK916725) EST_lsal_evj_941244 lsalevj mixed_tissue_mixed_st... 54 4e-33 6
(EX475279) EST_lsal_evj_792387 lsalevj mixed_tissue_mixed_st... 54 4e-33 6
(EX475278) EST_lsal_evj_788163 lsalevj mixed_tissue_mixed_st... 54 4e-33 6
(FK916733) EST_lsal_evj_941248 lsalevj mixed_tissue_mixed_st... 54 6e-33 6
(FK908030) EST_lsal_evj_939400 lsalevj mixed_tissue_mixed_st... 54 1e-32 6
(EC821471) SME00006372 esmbsro2 Sawyeria marylandensis cDNA,... 98 1e-32 4
(FK908029) EST_lsal_evj_932488 lsalevj mixed_tissue_mixed_st... 54 2e-32 6
(EG017620) EST02254_0906 Sporophyte cDNA Library Porphyra ha... 90 2e-32 4
(C25685) Dictyostelium discoideum slug cDNA, clone SSB187. 109 1e-31 2
(FK907645) EST_lsal_evj_938045 lsalevj mixed_tissue_mixed_st... 54 4e-31 6
(FK908146) EST_lsal_evj_939466 lsalevj mixed_tissue_mixed_st... 54 5e-31 6
(EX479839) EST_lsal_evj_790120 lsalevj mixed_tissue_mixed_st... 54 6e-31 6
(EX479838) EST_lsal_evj_789736 lsalevj mixed_tissue_mixed_st... 54 6e-31 6
(FK907644) EST_lsal_evj_934973 lsalevj mixed_tissue_mixed_st... 54 6e-31 6
(FK908145) EST_lsal_evj_932554 lsalevj mixed_tissue_mixed_st... 54 7e-31 6
(EY506892) EST_lsal_af_800476 lsalaf whole Lepeophtheirus sa... 54 7e-31 6
(FK927253) EST_lsal_evj_943207 lsalevj mixed_tissue_mixed_st... 54 7e-31 6
(FK927252) EST_lsal_evj_959719 lsalevj mixed_tissue_mixed_st... 54 7e-31 6
(FK930405) EST_lsal_evj_934082 lsalevj mixed_tissue_mixed_st... 54 8e-31 6
(FK900952) EST_lsal_evj_874807 lsalevj mixed_tissue_mixed_st... 54 6e-30 5
(FK900700) EST_lsal_evj_874515 lsalevj mixed_tissue_mixed_st... 54 6e-30 5
(AC114263) Dictyostelium discoideum chromosome 2 map 215673-... 94 9e-30 2
(M34456) Dictyostelium discoideum GTP-binding protein SAS2 m... 94 9e-30 2
(FK901579) EST_lsal_evj_853163 lsalevj mixed_tissue_mixed_st... 54 1e-29 6
(FF436463) G142P60204RD10.T0 Acorn worm juvenile pCMVSport6 ... 90 1e-29 4
(FF446253) G178P60071RA4.T0 Acorn worm gastrula/neurula pCMV... 90 1e-29 4
(FF431656) G142P60136RF7.T0 Acorn worm juvenile pCMVSport6 l... 90 2e-29 4
(FF429836) G142P60111RD6.T0 Acorn worm juvenile pCMVSport6 l... 90 2e-29 4
(FF440383) G142P60264RG12.T0 Acorn worm juvenile pCMVSport6 ... 90 2e-29 4

>(BJ331981) Dictyostelium discoideum cDNA clone:dda37f20, 5' end,
single read.
Length = 642

Score = 1257 bits (634), Expect = 0.0
Identities = 640/642 (99%)
Strand = Plus / Plus


Query: 2 aacacatccaattataaaaactaaaccctatagaattagaaatgaacccagattatcatt 61
||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||
Sbjct: 1 aacacatccaattataaaaactaaattctatagaattagaaatgaacccagattatcatt 60


Query: 62 atttatttaaattacttttaatcggtgatagtggtgtaggtaaatcatgtcttttactta 121
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 61 atttatttaaattacttttaatcggtgatagtggtgtaggtaaatcatgtcttttactta 120


Query: 122 gatttgctgatgacacttattcagaaagtttcatctcaacaattggtgtcgatttcaaga 181
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 121 gatttgctgatgacacttattcagaaagtttcatctcaacaattggtgtcgatttcaaga 180


Query: 182 ttagaactatcgaattaaatggtaaaaccattaaattacaaatttgggatactgcaggac 241
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 181 ttagaactatcgaattaaatggtaaaaccattaaattacaaatttgggatactgcaggac 240


Query: 242 aagaaagatttagaacaattacatcatcatattatcgtggtgcccatggtatcattgttg 301
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 241 aagaaagatttagaacaattacatcatcatattatcgtggtgcccatggtatcattgttg 300


Query: 302 tttatgatgtaactgataaattaacatttgaaaacgttagacaatggttacaagaaattg 361
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 301 tttatgatgtaactgataaattaacatttgaaaacgttagacaatggttacaagaaattg 360


Query: 362 atagatttgcatgcgaaaatgtaaataaacttttagttggaaacaagagtgatcttgtcg 421
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 361 atagatttgcatgcgaaaatgtaaataaacttttagttggaaacaagagtgatcttgtcg 420


Query: 422 ctaaaaaagttgtagatttcaataccgccaaagcttttgccgactctcttcaaattcctt 481
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 421 ctaaaaaagttgtagatttcaataccgccaaagcttttgccgactctcttcaaattcctt 480


Query: 482 tcctcgaaacctctgcaaaacaatcaacaaacgtagaacaagcatttatgacaatggcca 541
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 481 tcctcgaaacctctgcaaaacaatcaacaaacgtagaacaagcatttatgacaatggcca 540


Query: 542 ctgaaattaaaaatagattaacagcttctcaaccaactcaaaccgttgataaaaataagg 601
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 541 ctgaaattaaaaatagattaacagcttctcaaccaactcaaaccgttgataaaaataagg 600


Query: 602 ttgtaccaggttcctctgctccaatctctccaaaatctggtt 643
||||||||||||||||||||||||||||||||||||||||||
Sbjct: 601 ttgtaccaggttcctctgctccaatctctccaaaatctggtt 642

Lambda K H
1.37 0.711 1.31

Matrix: blastn matrix:1 -3
Number of Sequences: 92845959
Number of Hits to DB: 1,014,866,077
Number of extensions: 68374118
Number of successful extensions: 6214817
Number of sequences better than 10.0: 10095
Length of query: 895
Length of database: 95,242,211,685
Length adjustment: 24
Effective length of query: 871
Effective length of database: 97,308,875,965
Effective search space: 84756030965515
Effective search space used: 84756030965515
X1: 11 (21.8 bits)
S2: 22 (44.1 bits)

protein update 2009. 7. 9
Homology vs Protein
Query= Contig-U14029-1 (Contig-U14029-1Q) /CSM_Contig/Contig-U14029-1Q.Seq.d
(895 letters)

Database: nrp_B
3,236,559 sequences; 1,051,180,864 total letters

Searching..................................................done

Score E
Sequences producing significant alignments: (bits) Value

(P34139) RecName: Full=Ras-related protein Rab-1A; 404 e-111
BT070553_1(BT070553|pid:none) Picea sitchensis clone WS02735_N04... 315 1e-84
(Q05974) RecName: Full=Ras-related protein Rab-1A; &S38339(S383... 313 6e-84
(Q39571) RecName: Full=GTP-binding protein YPTC1; &DQ222936_1(D... 310 5e-83
BT078127_1(BT078127|pid:none) Lepeophtheirus salmonis Pacific fo... 310 5e-83
BT059700_1(BT059700|pid:none) Salmo salar clone ssal-rgf-002-342... 310 5e-83
BT070586_1(BT070586|pid:none) Picea sitchensis clone WS02737_M21... 309 7e-83
BT077899_1(BT077899|pid:none) Lepeophtheirus salmonis Pacific fo... 308 1e-82
(P22125) RecName: Full=Ras-related protein ORAB-1; &M38393_1(M3... 307 3e-82
BC045014_1(BC045014|pid:none) Xenopus laevis RAB1, member RAS on... 307 4e-82
DQ214474_1(DQ214474|pid:none) Taeniopygia guttata clone 0063P003... 306 6e-82
BT077861_1(BT077861|pid:none) Lepeophtheirus salmonis Pacific fo... 306 8e-82
EF103367_1(EF103367|pid:none) Haliotis discus discus Ras-related... 306 8e-82
EF146669_1(EF146669|pid:none) Populus trichocarpa clone WS01211_... 306 8e-82
AL606522_3(AL606522|pid:none) Mouse DNA sequence from clone RP23... 305 1e-81
(P62820) RecName: Full=Ras-related protein Rab-1A; AltName: Full... 305 1e-81
(Q52NJ2) RecName: Full=Ras-related protein Rab-1A; &AY996813_1(... 305 1e-81
CP000587_71(CP000587|pid:none) Ostreococcus lucimarinus CCE9901 ... 305 2e-81
AK151085_1(AK151085|pid:none) Mus musculus bone marrow macrophag... 304 2e-81
(Q9D1G1) RecName: Full=Ras-related protein Rab-1B; &AB232584_1(... 304 3e-81
BT057068_1(BT057068|pid:none) Salmo salar clone ssal-eve-570-039... 304 3e-81
CP001323_241(CP001323|pid:none) Micromonas sp. RCC299 chromosome... 304 3e-81
AK042020_1(AK042020|pid:none) Mus musculus 3 days neonate thymus... 303 5e-81
EU284879_1(EU284879|pid:none) TSA: Elaeis guineensis EgEfMPOB000... 303 5e-81
D38625(D38625)GTP-binding protein o-rab1 - electric ray (Discopy... 303 7e-81
AK129477_1(AK129477|pid:none) Mus musculus mRNA for mKIAA3012 pr... 303 7e-81
J02998_1(J02998|pid:none) Rat ras-related protein mRNA, clone NT... 303 7e-81
(Q5RE13) RecName: Full=Ras-related protein Rab-1B; &(Q9H0U4) Re... 303 7e-81
S06147(S06147;S03189)GTP-binding protein rab1B - rat 302 9e-81
CR533462_1(CR533462|pid:none) Homo sapiens full open reading fra... 301 1e-80
AE014297_3082(AE014297|pid:none) Drosophila melanogaster chromos... 301 1e-80
BT076429_1(BT076429|pid:none) Caligus rogercresseyi clone crog-e... 301 2e-80
(P10536) RecName: Full=Ras-related protein Rab-1B; &X13905_1(X1... 301 3e-80
GM977161_1(GM977161|pid:none) Sequence 69 from Patent WO20081456... 301 3e-80
DQ214475_1(DQ214475|pid:none) Taeniopygia guttata clone 0058P004... 300 3e-80
Z73932_1(Z73932|pid:none) L.japonicus mRNA for small GTP-binding... 300 4e-80
(Q2HJH2) RecName: Full=Ras-related protein Rab-1B; &BC105393_1(... 300 6e-80
AF013572_1(AF013572|pid:none) Bombyx mori small GTP-binding prot... 300 6e-80
S34253(S34253) GTP-binding protein, ras-related - common tobacco... 299 1e-79
GN106077_1(GN106077|pid:none) Sequence 10858 from Patent WO20090... 299 1e-79
(Q01890) RecName: Full=Ras-like GTP-binding protein YPT1; &JC53... 298 1e-79
BC097013_1(BC097013|pid:none) Danio rerio zgc:86773, mRNA (cDNA ... 298 1e-79
BT051367_1(BT051367|pid:none) Medicago truncatula clone MTYF1_F2... 298 1e-79
AF108883_1(AF108883|pid:none) Capsicum annuum small GTP-binding ... 298 2e-79
D12548_1(D12548|pid:none) Pisum sativum mRNA for GTP-binding pro... 298 2e-79
EF145603_1(EF145603|pid:none) Populus trichocarpa clone WS01126_... 298 2e-79
EF144402_1(EF144402|pid:none) Populus trichocarpa clone PX0019_E... 298 2e-79
GN106151_1(GN106151|pid:none) Sequence 10932 from Patent WO20090... 298 2e-79
BT081293_1(BT081293|pid:none) Caligus clemensi clone ccle-evs-51... 298 2e-79
Y08425_1(Y08425|pid:none) N.plumbaginifolia mRNA for small GTP-b... 298 2e-79
EF086613_1(EF086613|pid:none) Picea sitchensis clone WS02920_I20... 297 3e-79
EF091876_1(EF091876|pid:none) Solanum tuberosum ras-related GTP ... 297 3e-79
(P33723) RecName: Full=GTP-binding protein ypt1; &AL356324_15(A... 297 4e-79
GN105859_1(GN105859|pid:none) Sequence 10640 from Patent WO20090... 297 4e-79
(P40392) RecName: Full=Ras-related protein RIC1; &AK243597_1(AK... 296 5e-79
(P11620) RecName: Full=GTP-binding protein ypt1; &AL136536_10(A... 296 6e-79
AK059888_1(AK059888|pid:none) Oryza sativa Japonica Group cDNA c... 296 8e-79
AF101310_4(AF101310|pid:none) Caenorhabditis elegans cosmid C39F... 296 8e-79
AJ307662_21(AJ307662|pid:none) Oryza sativa genomic DNA fragment... 295 1e-78
GN106165_1(GN106165|pid:none) Sequence 10946 from Patent WO20090... 295 1e-78
BT034664_1(BT034664|pid:none) Zea mays full-length cDNA clone ZM... 295 2e-78
GM977157_1(GM977157|pid:none) Sequence 65 from Patent WO20081456... 295 2e-78
D12549_1(D12549|pid:none) Pisum sativum mRNA for GTP-binding pro... 295 2e-78
AJ277108_1(AJ277108|pid:none) Trichoderma reesei ypt1 gene for s... 295 2e-78
DQ414556_1(DQ414556|pid:none) Suberites domuncula Rab1 gene, com... 294 2e-78
GN105857_1(GN105857|pid:none) Sequence 10638 from Patent WO20090... 294 3e-78
GN106111_1(GN106111|pid:none) Sequence 10892 from Patent WO20090... 293 4e-78
GN106121_1(GN106121|pid:none) Sequence 10902 from Patent WO20090... 293 7e-78
BT039522_1(BT039522|pid:none) Zea mays full-length cDNA clone ZM... 292 9e-78
AE017352_188(AE017352|pid:none) Cryptococcus neoformans var. neo... 292 9e-78
AJ278659_1(AJ278659|pid:none) Aspergillus niger srgB gene for a ... 292 9e-78
B86153(B86153) ARA-5 [imported] - Arabidopsis thaliana &U89959_... 292 9e-78
AF244545_1(AF244545|pid:none) Aspergillus awamori YptA (yptA) ge... 291 2e-77
GN105977_1(GN105977|pid:none) Sequence 10758 from Patent WO20090... 291 2e-77
AJ810707_1(AJ810707|pid:none) Poa pratensis mRNA for RAB1-like (... 291 3e-77
GN106155_1(GN106155|pid:none) Sequence 10936 from Patent WO20090... 290 3e-77
AC183496_25(AC183496|pid:none) Brassica oleracea, *** SEQUENCING... 290 3e-77
GN106117_1(GN106117|pid:none) Sequence 10898 from Patent WO20090... 290 3e-77
GN106059_1(GN106059|pid:none) Sequence 10840 from Patent WO20090... 290 5e-77
GN105853_1(GN105853|pid:none) Sequence 10634 from Patent WO20090... 290 5e-77
GN080089_1(GN080089|pid:none) Sequence 692 from Patent WO2009027... 290 5e-77
GN106197_1(GN106197|pid:none) Sequence 10978 from Patent WO20090... 290 5e-77
AF324990_1(AF324990|pid:none) Arabidopsis thaliana AT5g47200 (AT... 290 6e-77
GN106013_1(GN106013|pid:none) Sequence 10794 from Patent WO20090... 290 6e-77
BC150404_1(BC150404|pid:none) Danio rerio zgc:171927, mRNA (cDNA... 289 8e-77
(P34140) RecName: Full=Ras-related protein Rab-1B; 289 8e-77
GN105983_1(GN105983|pid:none) Sequence 10764 from Patent WO20090... 289 1e-76
CR382130_329(CR382130|pid:none) Yarrowia lipolytica strain CLIB1... 289 1e-76
GM977149_1(GM977149|pid:none) Sequence 57 from Patent WO20081456... 288 1e-76
CS560194_1(CS560194|pid:none) Sequence 781 from Patent WO2006032... 288 2e-76
AP008208_2028(AP008208|pid:none) Oryza sativa (japonica cultivar... 287 4e-76
GM977145_1(GM977145|pid:none) Sequence 53 from Patent WO20081456... 286 6e-76
(Q92928) RecName: Full=Putative Ras-related protein Rab-1C; ... 286 8e-76
CS559708_1(CS559708|pid:none) Sequence 295 from Patent WO2006032... 285 1e-75
AY060495_1(AY060495|pid:none) Arabidopsis thaliana AT4g17530/dl4... 285 1e-75
BT052509_1(BT052509|pid:none) Medicago truncatula clone MTYFD_FE... 285 1e-75
AC183493_34(AC183493|pid:none) Brassica oleracea Contig B, compl... 285 1e-75
Z73931_1(Z73931|pid:none) L.japonicus mRNA for small GTP-binding... 281 2e-74
DQ372931_1(DQ372931|pid:none) Pinus pinaster Rab1 mRNA, complete... 281 2e-74
FN392321_231(FN392321|pid:none) Pichia pastoris GS115 chromosome... 280 4e-74
GN106061_1(GN106061|pid:none) Sequence 10842 from Patent WO20090... 279 1e-73
D01027_1(D01027|pid:none) Arabidopsis thaliana mRNA for small GT... 278 2e-73
GN106103_1(GN106103|pid:none) Sequence 10884 from Patent WO20090... 277 4e-73
GM977155_1(GM977155|pid:none) Sequence 63 from Patent WO20081456... 276 5e-73
GM977167_1(GM977167|pid:none) Sequence 75 from Patent WO20081456... 276 5e-73
FM992688_325(FM992688|pid:none) Candida dubliniensis CD36 chromo... 276 5e-73
AF330211_1(AF330211|pid:none) Candida albicans small GTP-binding... 276 5e-73
AC140549_18(AC140549|pid:none) Medicago truncatula clone mth2-28... 276 9e-73
CP000497_244(CP000497|pid:none) Pichia stipitis CBS 6054 chromos... 276 9e-73
AM494964_85(AM494964|pid:none) Leishmania braziliensis chromosom... 276 9e-73
EF147099_1(EF147099|pid:none) Populus trichocarpa clone WS01227_... 275 1e-72
AC159407_36(AC159407|pid:none) Trypanosoma brucei chromosome 8 c... 274 3e-72
D12547_1(D12547|pid:none) Pisum sativum mRNA for GTP-binding pro... 273 6e-72
AY321327_1(AY321327|pid:none) Rattus norvegicus Ac2-048 mRNA, co... 271 2e-71
AP007162_533(AP007162|pid:none) Aspergillus oryzae RIB40 genomic... 271 2e-71
L21010_1(L21010|pid:none) Dictyostelium discoideum Rab1B mRNA, 3... 270 4e-71
AE016815_434(AE016815|pid:none) Ashbya gossypii (= Eremothecium ... 270 6e-71
GN080135_1(GN080135|pid:none) Sequence 738 from Patent WO2009027... 269 1e-70
CR382124_213(CR382124|pid:none) Kluyveromyces lactis strain NRRL... 268 2e-70
GN080095_1(GN080095|pid:none) Sequence 698 from Patent WO2009027... 268 2e-70
CU928171_789(CU928171|pid:none) Kluyveromyces thermotolerans str... 268 2e-70
GN105981_1(GN105981|pid:none) Sequence 10762 from Patent WO20090... 266 7e-70
EU069503_1(EU069503|pid:none) Gymnochlora stellata Rab1B mRNA, c... 266 9e-70
L12031_1(L12031|pid:none) Leishmania major V121 GTP-binding prot... 265 2e-69
L48181_1(L48181|pid:none) Brassica campestris L. pekinensis ypt-... 265 2e-69
AC183498_22(AC183498|pid:none) Brassica oleracea, *** SEQUENCING... 264 3e-69
(P01123) RecName: Full=GTP-binding protein YPT1; AltName: Full=R... 263 6e-69
X00209_2(X00209|pid:none) Yeast YP2 gene The YP2 protein shows h... 263 6e-69
AC104285_6(AC104285|pid:none) Oryza sativa (japonica cultivar-gr... 263 6e-69
AY223134_1(AY223134|pid:none) Schistosoma japonicum SJCHGC02833 ... 263 6e-69
FN320591_1(FN320591|pid:none) Schistosoma japonicum isolate Anhu... 263 8e-69
(Q9ZRE2) RecName: Full=Ras-related protein RABD1; AltName: Full=... 262 1e-68
CR380957_540(CR380957|pid:none) Candida glabrata strain CBS138 c... 261 2e-68
BT071594_1(BT071594|pid:none) Picea sitchensis clone WS02926_J12... 259 9e-68
GM977163_1(GM977163|pid:none) Sequence 71 from Patent WO20081456... 257 4e-67
DQ397201_1(DQ397201|pid:none) Saccharum officinarum small GTP bi... 256 6e-67
FN315276_1(FN315276|pid:none) Schistosoma japonicum isolate Anhu... 256 7e-67
AF542024_1(AF542024|pid:none) Griffithsia japonica GTP-binding p... 256 9e-67
AB241242_1(AB241242|pid:none) Symbiotic protist of Reticuliterme... 249 7e-65
AB241241_1(AB241241|pid:none) Symbiotic protist of Reticuliterme... 249 1e-64
FN357538_13(FN357538|pid:none) Schistosoma mansoni genome sequen... 248 2e-64
DQ222937_1(DQ222937|pid:none) Chlamydomonas incerta YptC1 (yptC1... 247 3e-64
CR932686_1(CR932686|pid:none) Paramecium tetraurelia, Small GTPa... 239 7e-62
AM910992_200(AM910992|pid:none) Plasmodium knowlesi strain H chr... 239 9e-62
AB241243_1(AB241243|pid:none) Symbiotic protist of Reticuliterme... 238 2e-61
EU069501_1(EU069501|pid:none) Gymnochlora stellata Rab1A1 mRNA, ... 238 3e-61
(P20790) RecName: Full=Ras-related protein Rab-8A; AltName: Full... 237 3e-61
AL162751_30(AL162751|pid:none) Arabidopsis thaliana DNA chromoso... 236 8e-61
AK104346_1(AK104346|pid:none) Oryza sativa Japonica Group cDNA c... 236 8e-61
BT070243_1(BT070243|pid:none) Picea sitchensis clone WS02711_M12... 236 8e-61
AC183495_42(AC183495|pid:none) Brassica oleracea Contig A, compl... 235 1e-60
AC117265_12(AC117265|pid:none) Oryza sativa (japonica cultivar-g... 235 2e-60
BT035355_1(BT035355|pid:none) Zea mays full-length cDNA clone ZM... 235 2e-60
AY576526_1(AY576526|pid:none) Oryza sativa (japonica cultivar-gr... 234 2e-60
AY087058_1(AY087058|pid:none) Arabidopsis thaliana clone 3115 mR... 234 3e-60
(O76173) RecName: Full=Ras-related protein Rab-1C; &AB015237_1(... 234 4e-60
CR932696_1(CR932696|pid:none) Paramecium tetraurelia, Small GTPa... 233 5e-60
GM977141_1(GM977141|pid:none) Sequence 49 from Patent WO20081456... 233 7e-60
BC103436_1(BC103436|pid:none) Bos taurus RAB1A, member RAS oncog... 232 1e-59
AC125368_16(AC125368|pid:none) Medicago truncatula clone mth2-13... 232 1e-59
(P20791) RecName: Full=Ras-related protein Rab-8B; AltName: Full... 232 1e-59
GM977111_1(GM977111|pid:none) Sequence 19 from Patent WO20081456... 232 1e-59
S57478(S57478) GTP-binding protein GTP13 - garden pea &Z49902_1... 232 1e-59
AB079020_1(AB079020|pid:none) Nicotiana tabacum mRNA for ras-rel... 232 1e-59
AB054578_1(AB054578|pid:none) Entamoeba histolytica EhRab1A mRNA... 231 2e-59
GN105821_1(GN105821|pid:none) Sequence 10602 from Patent WO20090... 230 4e-59
CR932639_1(CR932639|pid:none) Paramecium tetraurelia, Small GTPa... 230 4e-59
GM977153_1(GM977153|pid:none) Sequence 61 from Patent WO20081456... 230 6e-59
CR954205_238(CR954205|pid:none) Ostreococcus tauri strain OTTH05... 230 6e-59
GN106049_1(GN106049|pid:none) Sequence 10830 from Patent WO20090... 230 6e-59
AB241220_1(AB241220|pid:none) Pyrsonympha grandis RsSmRab1_1 mRN... 229 7e-59
AJ001367_1(AJ001367|pid:none) Daucus carota mRNA for Rab8-like s... 229 9e-59
AE017343_437(AE017343|pid:none) Cryptococcus neoformans var. neo... 229 9e-59
GN106127_1(GN106127|pid:none) Sequence 10908 from Patent WO20090... 229 1e-58
DQ393575_1(DQ393575|pid:none) Metarhizium anisopliae RAB/GTPase ... 229 1e-58
GN106011_1(GN106011|pid:none) Sequence 10792 from Patent WO20090... 228 2e-58
AJ272025_1(AJ272025|pid:none) Colletotrichum lindemuthianum pt1 ... 228 2e-58
AF096249_1(AF096249|pid:none) Lycopersicon esculentum ethylene-r... 228 2e-58
GN106091_1(GN106091|pid:none) Sequence 10872 from Patent WO20090... 228 2e-58
GN106033_1(GN106033|pid:none) Sequence 10814 from Patent WO20090... 228 2e-58
AB241230_1(AB241230|pid:none) Dinenympha exilis RsSmRab1_2 mRNA ... 228 2e-58
GN105943_1(GN105943|pid:none) Sequence 10724 from Patent WO20090... 228 3e-58
AB079024_1(AB079024|pid:none) Nicotiana tabacum mRNA for ras-rel... 228 3e-58
S57474(S57474) GTP-binding protein - garden pea &Z49899_1(Z4989... 227 5e-58
S33900(S33900;JQ2233) GTP-binding protein ypt2 - tomato &X69980... 227 5e-58
GM977117_1(GM977117|pid:none) Sequence 25 from Patent WO20081456... 226 6e-58
AB015475_6(AB015475|pid:none) Arabidopsis thaliana genomic DNA, ... 226 6e-58
GN106021_1(GN106021|pid:none) Sequence 10802 from Patent WO20090... 226 1e-57
GN106051_1(GN106051|pid:none) Sequence 10832 from Patent WO20090... 226 1e-57
EF144772_1(EF144772|pid:none) Populus trichocarpa clone WS01118_... 226 1e-57
(P34141) RecName: Full=Ras-related protein RabA; 225 1e-57
Z73946_1(Z73946|pid:none) L.japonicus mRNA for small GTP-binding... 225 2e-57
GN106009_1(GN106009|pid:none) Sequence 10790 from Patent WO20090... 224 2e-57
L21011_1(L21011|pid:none) Dictyostelium discoideum RabA mRNA, 3'... 224 4e-57
BT070448_1(BT070448|pid:none) Picea sitchensis clone WS0272_O15 ... 223 5e-57
(Q9TVU5) RecName: Full=Ras-related protein Rab-1; AltName: Full=... 223 5e-57
EF125738_1(EF125738|pid:none) Nyctotherus ovalis Rab A61 gene, c... 221 3e-56
AY232027_1(AY232027|pid:none) Drosophila yakuba clone yak-ad_Rab... 220 4e-56
AY324134_1(AY324134|pid:none) Babesia bovis Rab1a mRNA, complete... 220 6e-56
AJ278658_1(AJ278658|pid:none) Aspergillus niger srgA gene for a ... 220 6e-56
CR933446_1(CR933446|pid:none) Paramecium tetraurelia, Small GTPa... 218 2e-55
EU244427_1(EU244427|pid:none) Capra hircus RAB1A-like protein mR... 218 2e-55
DQ440351_1(DQ440351|pid:none) Aedes aegypti clone AET-452 RAB pr... 214 2e-54
CR933412_1(CR933412|pid:none) Paramecium tetraurelia, Small GTPa... 214 3e-54
DQ414563_1(DQ414563|pid:none) Suberites domuncula Rab10 gene, co... 214 3e-54
AP008213_447(AP008213|pid:none) Oryza sativa (japonica cultivar-... 214 3e-54
BC142846_1(BC142846|pid:none) Danio rerio RAB8B, member RAS onco... 214 4e-54
EU960755_1(EU960755|pid:none) Zea mays clone 228324 unknown mRNA. 214 4e-54
BC129421_1(BC129421|pid:none) Danio rerio zgc:158741, mRNA (cDNA... 213 7e-54
BC077124_1(BC077124|pid:none) Danio rerio zgc:100812, mRNA (cDNA... 213 7e-54
T33855(T33855)hypothetical protein D1037.4 - Caenorhabditis eleg... 213 7e-54
AB112929_1(AB112929|pid:none) Caenorhabditis elegans rab8 mRNA f... 213 7e-54
AJ851375_1(AJ851375|pid:none) Gallus gallus mRNA for hypothetica... 213 9e-54
BC127330_1(BC127330|pid:none) Xenopus tropicalis RAB8B, member R... 212 1e-53
CR382125_525(CR382125|pid:none) Kluyveromyces lactis strain NRRL... 212 1e-53
AY231907_1(AY231907|pid:none) Drosophila yakuba clone yak-em_Rab... 212 2e-53
BC135798_1(BC135798|pid:none) Xenopus tropicalis RAB8B, member R... 212 2e-53
AY893660_1(AY893660|pid:none) Synthetic construct Homo sapiens c... 212 2e-53
BT044760_1(BT044760|pid:none) Salmo salar clone ssal-rgf-502-322... 211 2e-53
DQ414573_1(DQ414573|pid:none) Suberites domuncula Rab35 gene, co... 211 2e-53
BC041759_1(BC041759|pid:none) Xenopus laevis similar to RAB35, m... 211 3e-53
(P22128) RecName: Full=Ras-related protein Rab-8; AltName: Full=... 211 3e-53
BC068969_1(BC068969|pid:none) Xenopus laevis similar to RAB35, m... 211 3e-53
BC099268_1(BC099268|pid:none) Xenopus laevis similar to RAB35, m... 211 3e-53
BX538352_67(BX538352|pid:none) Cryptosporidium parvum chromosome... 210 5e-53
AL117202_29(AL117202|pid:none) Caenorhabditis elegans YAC Y47D3A... 210 5e-53
(Q92930) RecName: Full=Ras-related protein Rab-8B; &AB038995_1(... 210 5e-53
AB112933_1(AB112933|pid:none) Drosophila melanogaster rab8 mRNA ... 210 5e-53
AB018117_6(AB018117|pid:none) Arabidopsis thaliana genomic DNA, ... 210 6e-53
BC060015_1(BC060015|pid:none) Xenopus laevis hypothetical protei... 210 6e-53
CR859178_1(CR859178|pid:none) Pongo abelii mRNA; cDNA DKFZp459K2... 209 8e-53
(Q558I0) RecName: Full=Ras-related protein RabF1; 209 8e-53
(P61026) RecName: Full=Ras-related protein Rab-10; &(P61027) Re... 209 8e-53
AK008725_1(AK008725|pid:none) Mus musculus adult male stomach cD... 209 8e-53
BT081291_1(BT081291|pid:none) Caligus clemensi clone ccle-evs-51... 209 1e-52
BC057747_1(BC057747|pid:none) Xenopus laevis hypothetical protei... 209 1e-52
(P24409) RecName: Full=Ras-related protein Rab-10; &D36364(D363... 209 1e-52
AC139707_26(AC139707|pid:none) Medicago truncatula clone mth2-16... 209 1e-52
BC134059_1(BC134059|pid:none) Danio rerio RAB8A, member RAS onco... 209 1e-52
AB006189_1(AB006189|pid:none) Drosophila melanogaster mRNA for R... 209 1e-52
AY896243_1(AY896243|pid:none) Trichomonas vaginalis strain G3 sm... 209 1e-52
(Q5R4A3) RecName: Full=Ras-related protein Rab-8A; &CR861352_1(... 208 2e-52
AL136650_1(AL136650|pid:none) Homo sapiens mRNA; cDNA DKFZp564L1... 208 2e-52
AY892042_1(AY892042|pid:none) Synthetic construct Homo sapiens c... 208 2e-52
BC078493_1(BC078493|pid:none) Xenopus laevis MGC85265 protein, m... 208 2e-52
(P35280) RecName: Full=Ras-related protein Rab-8A; &(P55258) Re... 208 2e-52
S53268_1(S53268|pid:none) Homo sapiens RAS-related protein MEL (... 208 2e-52
I78851(I78851) GTP-binding protein MEL - mouse &S53270_1(S53270... 208 2e-52
(Q2HJI8) RecName: Full=Ras-related protein Rab-8B; &BC105330_1(... 208 2e-52
AK147178_1(AK147178|pid:none) Mus musculus 17 days pregnant adul... 208 2e-52
BT076103_1(BT076103|pid:none) Caligus rogercresseyi clone crog-e... 207 3e-52
S51495(S51495;S70850)GTP-binding protein RYL1 - yeast (Yarrowia ... 207 3e-52
(P22127) RecName: Full=Ras-related protein Rab-10; Shor... 207 4e-52
BT080552_1(BT080552|pid:none) Caligus clemensi clone ccle-evs-51... 207 5e-52
CR382138_325(CR382138|pid:none) Debaryomyces hansenii strain CBS... 207 5e-52
CR932504_1(CR932504|pid:none) Paramecium tetraurelia, Small GTPa... 206 9e-52
CR932581_1(CR932581|pid:none) Paramecium tetraurelia, Small GTPa... 206 1e-51
AY439005_1(AY439005|pid:none) Fucus distichus Rab family GTPase ... 206 1e-51
DQ286060_1(DQ286060|pid:none) Hydra vulgaris RAS related GTP-bin... 205 1e-51
AB232608_1(AB232608|pid:none) Mus musculus mRNA for Rab13, compl... 205 1e-51
(Q9DD03) RecName: Full=Ras-related protein Rab-13; &AK002303_1(... 205 1e-51
B38625(B38625)GTP-binding protein ora2 - electric ray (Discopyge... 205 2e-51
(P07560) RecName: Full=Ras-related protein SEC4; AltName: Full=S... 205 2e-51
BT080187_1(BT080187|pid:none) Caligus clemensi clone ccle-evs-50... 204 3e-51
AM910992_188(AM910992|pid:none) Plasmodium knowlesi strain H chr... 204 4e-51
DQ443136_1(DQ443136|pid:none) Bombyx mori small GTP binding prot... 203 6e-51
(P35281) RecName: Full=Ras-related protein Rab-10; &M83677_1(M8... 203 7e-51
AY893729_1(AY893729|pid:none) Synthetic construct Homo sapiens c... 202 9e-51
BC094846_1(BC094846|pid:none) Homo sapiens RAB13, member RAS onc... 202 9e-51
BT078096_1(BT078096|pid:none) Lepeophtheirus salmonis Pacific fo... 202 9e-51
(P51153) RecName: Full=Ras-related protein Rab-13; AltName: Full... 202 9e-51
AY813938_1(AY813938|pid:none) Schistosoma japonicum SJCHGC06150 ... 202 1e-50
(Q5KTJ6) RecName: Full=Ras-related protein Rab-13; &AB158369_1(... 202 2e-50
T28971(T28971) hypothetical protein T23H2.5 - Caenorhabditis ele... 202 2e-50
(Q58DS5) RecName: Full=Ras-related protein Rab-13; &BT021522_1(... 201 2e-50
AJ237914_1(AJ237914|pid:none) Plasmodium falciparum putative rab... 201 3e-50
AF201953_1(AF201953|pid:none) Plasmodium falciparum isolate FCC1... 201 3e-50
BC061274_1(BC061274|pid:none) Xenopus tropicalis hypothetical pr... 201 4e-50
U41269_1(U41269|pid:none) Plasmodium falciparum Rab1 protein (Pf... 199 8e-50
Z73945_1(Z73945|pid:none) L.japonicus mRNA for small GTP-binding... 199 1e-49
CP000499_197(CP000499|pid:none) Pichia stipitis CBS 6054 chromos... 199 1e-49
BC124978_1(BC124978|pid:none) Xenopus laevis hypothetical protei... 199 1e-49
BC009227_1(BC009227|pid:none) Homo sapiens RAB13, member RAS onc... 198 2e-49
AF389109_1(AF389109|pid:none) Entamoeba histolytica small GTP-bi... 197 3e-49
AK297598_1(AK297598|pid:none) Homo sapiens cDNA FLJ52970 complet... 197 3e-49
AC116984_79(AC116984|pid:none) Dictyostelium discoideum chromoso... 196 7e-49
CR932630_1(CR932630|pid:none) Paramecium tetraurelia, Small GTPa... 196 7e-49
(Q54E92) RecName: Full=Ras-related protein RabG1; 196 7e-49
FN357316_32(FN357316|pid:none) Schistosoma mansoni genome sequen... 195 2e-48
CR932644_1(CR932644|pid:none) Paramecium tetraurelia, Small GTPa... 194 3e-48
DQ836048_1(DQ836048|pid:none) Trichomonas vaginalis small Rab GT... 194 3e-48
(O14462) RecName: Full=Ras-related protein SEC4; &AF015306_1(AF... 194 3e-48
BT051484_1(BT051484|pid:none) Medicago truncatula clone MTYF1_F2... 194 4e-48
CR932703_1(CR932703|pid:none) Paramecium tetraurelia, Small GTPa... 194 4e-48
FN359283_3(FN359283|pid:none) Schistosoma mansoni genome sequenc... 194 4e-48
(P36412) RecName: Full=Ras-related protein Rab-11A; &U02925_1(U... 190 6e-47
AF127669_1(AF127669|pid:none) Mus musculus small GTPase (Rab11a)... 189 1e-46
AB197057_1(AB197057|pid:none) Entamoeba histolytica gene for sma... 188 2e-46
BC081187_1(BC081187|pid:none) Xenopus laevis MGC84419 protein, m... 188 2e-46
(Q39572) RecName: Full=Ras-related protein YPTC6; &JC4108(JC410... 187 3e-46
(Q2TA29) RecName: Full=Ras-related protein Rab-11A; &BC111143_1... 187 4e-46
BC055141_1(BC055141|pid:none) Danio rerio zgc:63565, mRNA (cDNA ... 187 4e-46
CR932510_1(CR932510|pid:none) Paramecium tetraurelia, Small GTPa... 187 5e-46
BC082421_1(BC082421|pid:none) Xenopus laevis hypothetical LOC494... 187 5e-46
AY220456_1(AY220456|pid:none) Limulus polyphemus rab11-2 mRNA, c... 187 5e-46
AB035354_1(AB035354|pid:none) Drosophila melanogaster mRNA for D... 187 5e-46
EU069500_1(EU069500|pid:none) Karlodinium micrum Rab1D mRNA, com... 187 5e-46
BT001785_1(BT001785|pid:none) Drosophila melanogaster RH21315 fu... 187 5e-46
BT056265_1(BT056265|pid:none) Drosophila melanogaster FI09227 fu... 187 5e-46
AJ851582_1(AJ851582|pid:none) Gallus gallus mRNA for hypothetica... 186 7e-46
(P22129) RecName: Full=Ras-related protein Rab-11B; AltName: Ful... 186 7e-46
AY552054_1(AY552054|pid:none) Aedes aegypti RAB-like GTP binding... 186 7e-46
AE014296_1491(AE014296|pid:none) Drosophila melanogaster chromos... 186 7e-46
CR933428_1(CR933428|pid:none) Paramecium tetraurelia, Small GTPa... 186 1e-45
CR932657_1(CR932657|pid:none) Paramecium tetraurelia, Small GTPa... 186 1e-45
BC087498_1(BC087498|pid:none) Xenopus laevis hypothetical LOC496... 185 2e-45
BC041250_1(BC041250|pid:none) Xenopus laevis RAB11B, member RAS ... 185 2e-45
BC152630_1(BC152630|pid:none) Danio rerio zgc:92772, mRNA (cDNA ... 185 2e-45
EF366951_1(EF366951|pid:none) Phytophthora infestans isolate B04... 185 2e-45
BC075268_1(BC075268|pid:none) Xenopus tropicalis RAB11B, member ... 185 2e-45
AY896281_1(AY896281|pid:none) Trichomonas vaginalis strain G3 sm... 185 2e-45
BC076247_1(BC076247|pid:none) Danio rerio zgc:92772, mRNA (cDNA ... 185 2e-45
EU244432_1(EU244432|pid:none) Capra hircus RAB11B (rab11b) mRNA,... 184 3e-45
AY894025_1(AY894025|pid:none) Synthetic construct Homo sapiens c... 184 3e-45
EF560724_1(EF560724|pid:none) Homo sapiens clone DKFZp564C1023 R... 184 3e-45
(P46638) RecName: Full=Ras-related protein Rab-11B; &A55005(A55... 184 3e-45
CR541691_1(CR541691|pid:none) Homo sapiens full open reading fra... 184 3e-45
(O35509) RecName: Full=Ras-related protein Rab-11B; &(Q15907) R... 184 3e-45
AL670003_2(AL670003|pid:none) Neurospora crassa DNA linkage grou... 184 3e-45
(Q550H6) RecName: Full=Ras-related protein Rab-11C; 184 3e-45
JC2487(JC2487) GTP-binding protein H-YPT3 - human &X79780_1(X79... 184 3e-45
EF678326_1(EF678326|pid:none) Picea sitchensis clone WS02914_M23... 184 3e-45
EU090128_1(EU090128|pid:none) Aiptasia pulchella Rab3 mRNA, comp... 184 5e-45
BT075660_1(BT075660|pid:none) Osmerus mordax clone omor-eva-509-... 184 5e-45
EF145933_1(EF145933|pid:none) Populus trichocarpa clone WS0114_G... 184 5e-45
AY220749_1(AY220749|pid:none) Limulus polyphemus Rab11-1a mRNA, ... 184 5e-45
(P25766) RecName: Full=Ras-related protein RGP1; AltName: Full=G... 183 6e-45
AM920437_2206(AM920437|pid:none) Penicillium chrysogenum Wiscons... 183 6e-45
AY220748_1(AY220748|pid:none) Limulus polyphemus Rab11-1c mRNA, ... 183 6e-45
CR536494_1(CR536494|pid:none) Homo sapiens full open reading fra... 183 6e-45
BC048889_1(BC048889|pid:none) Danio rerio RAB11B, member RAS onc... 183 8e-45
DQ157704_1(DQ157704|pid:none) Aiptasia pulchella Rab11 protein m... 183 8e-45
CR954202_213(CR954202|pid:none) Ostreococcus tauri strain OTTH05... 183 8e-45
BT036850_1(BT036850|pid:none) Zea mays full-length cDNA clone ZM... 182 1e-44
CR933476_1(CR933476|pid:none) Paramecium tetraurelia, Small GTPa... 182 1e-44
BC097569_1(BC097569|pid:none) Xenopus laevis hypothetical protei... 182 1e-44
BT080652_1(BT080652|pid:none) Caligus clemensi clone ccle-evs-51... 182 1e-44
AF003139_1(AF003139|pid:none) Caenorhabditis elegans cosmid F53G... 182 1e-44
AL035708_16(AL035708|pid:none) Arabidopsis thaliana DNA chromoso... 182 1e-44
U46926_1(U46926|pid:none) Arabidopsis thaliana GTP-binding prote... 182 1e-44
BT049157_1(BT049157|pid:none) Salmo salar clone ssal-rgb2-591-24... 182 1e-44
BT038097_1(BT038097|pid:none) Zea mays full-length cDNA clone ZM... 182 2e-44
DQ105562_1(DQ105562|pid:none) Euplotes octocarinatus Rab protein... 182 2e-44
L21013_1(L21013|pid:none) Dictyostelium discoideum RabC mRNA, co... 182 2e-44
(Q40193) RecName: Full=Ras-related protein Rab11C; &Z73951_1(Z7... 182 2e-44
(Q39222) RecName: Full=Ras-related protein RABA1b; AltName: Full... 182 2e-44
BT045814_1(BT045814|pid:none) Salmo salar clone ssal-rgf-532-060... 182 2e-44
EU958646_1(EU958646|pid:none) Zea mays clone 1707478 ras-related... 181 2e-44
EF192426_1(EF192426|pid:none) Ipomoea batatas ARF small GTPase m... 181 3e-44
AY632359_2(AY632359|pid:none) Gossypium hirsutum BAC 155C17, com... 181 3e-44
(Q40723) RecName: Full=Ras-related protein RGP2; AltName: Full=G... 181 3e-44
BT051415_1(BT051415|pid:none) Medicago truncatula clone MTYF1_F2... 181 3e-44
BT068335_1(BT068335|pid:none) Zea mays full-length cDNA clone ZM... 181 4e-44
EU365390_1(EU365390|pid:none) Euplotes octocarinatus Rab GTPase ... 181 4e-44
EU626442_7(EU626442|pid:none) Gossypium raimondii clone BAC 031J... 181 4e-44
AB470307_1(AB470307|pid:none) Nicotiana tabacum NtRab11D mRNA fo... 181 4e-44
FN357326_31(FN357326|pid:none) Schistosoma mansoni genome sequen... 181 4e-44
D12542_1(D12542|pid:none) Pisum sativum mRNA for GTP-binding pro... 181 4e-44
BT037150_1(BT037150|pid:none) Zea mays full-length cDNA clone ZM... 180 5e-44
A43958(A43958;C43958) GTP-binding protein, synaptic vesicle spec... 180 5e-44
U68256_1(U68256|pid:none) Caenorhabditis elegans rab8-like mRNA,... 180 5e-44
AE014298_1596(AE014298|pid:none) Drosophila melanogaster chromos... 180 5e-44
BT069763_1(BT069763|pid:none) Zea mays full-length cDNA clone ZM... 180 5e-44
EU965206_1(EU965206|pid:none) Zea mays clone 284484 ras-related ... 180 5e-44
AK297498_1(AK297498|pid:none) Homo sapiens cDNA FLJ61134 complet... 180 5e-44
AK071303_1(AK071303|pid:none) Oryza sativa Japonica Group cDNA c... 180 5e-44
BC076437_1(BC076437|pid:none) Danio rerio RAB30, member RAS onco... 180 7e-44
AY088624_1(AY088624|pid:none) Arabidopsis thaliana clone 8545 mR... 180 7e-44
GN105993_1(GN105993|pid:none) Sequence 10774 from Patent WO20090... 180 7e-44
DQ019037_1(DQ019037|pid:none) Trichomonas vaginalis strain G3 sm... 180 7e-44
(P25228) RecName: Full=Ras-related protein Rab-3; &AB112932_1(A... 180 7e-44
CR932579_1(CR932579|pid:none) Paramecium tetraurelia, Small GTPa... 180 7e-44
CU638743_340(CU638743|pid:none) Podospora anserina genomic DNA c... 180 7e-44
L49400_1(L49400|pid:none) Loligo pealii Rab3 gene, complete cds. 180 7e-44
BT033192_1(BT033192|pid:none) Zea mays full-length cDNA clone ZM... 179 9e-44
(Q9FK68) RecName: Full=Ras-related protein RABA1c; &AB012245_16... 179 9e-44
BC159385_1(BC159385|pid:none) Xenopus tropicalis hypothetical pr... 179 9e-44
AY809861_1(AY809861|pid:none) Schistosoma japonicum SJCHGC02927 ... 179 9e-44
EU117168_1(EU117168|pid:none) Danio rerio Rab8 mRNA, partial cds. 179 1e-43
AC093018_9(AC093018|pid:none) Oryza sativa chromosome 3 BAC OSJN... 179 1e-43
EU626443_5(EU626443|pid:none) Gossypioides kirkii clone BAC 096G... 179 1e-43
AF014120_1(AF014120|pid:none) Strongylocentrotus purpuratus GTP-... 179 1e-43
AB013395_22(AB013395|pid:none) Arabidopsis thaliana genomic DNA,... 179 1e-43
CU928171_64(CU928171|pid:none) Kluyveromyces thermotolerans stra... 179 1e-43
AK051218_1(AK051218|pid:none) Mus musculus 12 days embryo spinal... 179 1e-43
(Q39434) RecName: Full=Ras-related protein Rab2BV; &T14566(T145... 179 1e-43
AB016890_5(AB016890|pid:none) Arabidopsis thaliana genomic DNA, ... 179 1e-43
AY690483_1(AY690483|pid:none) Triticum aestivum rab GTP-binding ... 179 1e-43
AC140549_17(AC140549|pid:none) Medicago truncatula clone mth2-28... 178 2e-43
FN314406_1(FN314406|pid:none) Schistosoma japonicum isolate Anhu... 178 2e-43
AC155344_30(AC155344|pid:none) Brassica rapa subsp. pekinensis c... 178 2e-43
DQ414564_1(DQ414564|pid:none) Suberites domuncula Rab11 gene, co... 178 2e-43
T28972(T28972)hypothetical protein T23H2.6 - Caenorhabditis eleg... 178 2e-43
AL021710_9(AL021710|pid:none) Arabidopsis thaliana DNA chromosom... 178 2e-43
BC135348_1(BC135348|pid:none) Xenopus tropicalis RAB3B, member R... 178 2e-43
AM459225_1(AM459225|pid:none) Vitis vinifera contig VV78X087264.... 178 2e-43
AM438608_1(AM438608|pid:none) Vitis vinifera contig VV78X052328.... 178 2e-43
AX885835_1(AX885835|pid:none) Sequence 1698 from Patent EP1033401. 178 2e-43
AM432734_2(AM432734|pid:none) Vitis vinifera contig VV78X219500.... 178 2e-43
CR933419_1(CR933419|pid:none) Paramecium tetraurelia, Small GTPa... 177 3e-43
AC130603_13(AC130603|pid:none) Oryza sativa (japonica cultivar-g... 177 3e-43
AM269968_23(AM269968|pid:none) Aspergillus niger contig An01c021... 177 3e-43
CR932818_1(CR932818|pid:none) Paramecium tetraurelia, Small GTPa... 177 3e-43
AC183493_10(AC183493|pid:none) Brassica oleracea Contig B, compl... 177 3e-43
AF532625_1(AF532625|pid:none) Glycine max GTP-binding protein mR... 177 4e-43
(Q40191) RecName: Full=Ras-related protein Rab11A; &Z73949_1(Z7... 177 4e-43
(Q15771) RecName: Full=Ras-related protein Rab-30; &(Q17QB7) Re... 177 4e-43
(P35294) RecName: Full=Ras-related protein Rab-19; &AB232613_1(... 177 4e-43
CR932610_1(CR932610|pid:none) Paramecium tetraurelia, Small GTPa... 177 4e-43
AC183494_13(AC183494|pid:none) Brassica oleracea Contig C, compl... 177 6e-43
AM462529_1(AM462529|pid:none) Vitis vinifera contig VV78X101776.... 177 6e-43
DQ525204_1(DQ525204|pid:none) Bombyx mori ras-related GTP-bindin... 177 6e-43
AM471469_2(AM471469|pid:none) Vitis vinifera contig VV78X014719.... 177 6e-43
BT077510_1(BT077510|pid:none) Lepeophtheirus salmonis Pacific fo... 177 6e-43
BT037200_1(BT037200|pid:none) Zea mays full-length cDNA clone ZM... 176 7e-43
M19885_1(M19885|pid:none) Bovine GTP-binding protein (smg p25A) ... 176 7e-43
CR933443_1(CR933443|pid:none) Paramecium tetraurelia, Small GTPa... 176 7e-43
(Q86YS6) RecName: Full=Ras-related protein Rab-43; AltName: Full... 176 7e-43
AK071461_1(AK071461|pid:none) Oryza sativa Japonica Group cDNA c... 176 7e-43
GN106119_1(GN106119|pid:none) Sequence 10900 from Patent WO20090... 176 7e-43
AF030183_1(AF030183|pid:none) Entamoeba histolytica GTP-binding ... 176 7e-43
AY084274_1(AY084274|pid:none) Arabidopsis thaliana clone 102017 ... 176 7e-43
AP008215_340(AP008215|pid:none) Oryza sativa (japonica cultivar-... 176 7e-43
EF086736_1(EF086736|pid:none) Picea sitchensis clone WS02731_C01... 176 7e-43
CR932553_1(CR932553|pid:none) Paramecium tetraurelia, Small GTPa... 176 7e-43
EU951907_1(EU951907|pid:none) Zea mays clone 1062297 ras-related... 176 7e-43
BX510928_2(BX510928|pid:none) Zebrafish DNA sequence from clone ... 176 9e-43
AC124143_12(AC124143|pid:none) Oryza sativa (japonica cultivar-g... 176 9e-43
GN106085_1(GN106085|pid:none) Sequence 10866 from Patent WO20090... 176 9e-43
EU954271_1(EU954271|pid:none) Zea mays clone 1460642 ras-related... 176 9e-43
AY891536_1(AY891536|pid:none) Synthetic construct Homo sapiens c... 176 9e-43
(O95716) RecName: Full=Ras-related protein Rab-3D; &AF081353_1(... 176 9e-43
(P11023) RecName: Full=Ras-related protein Rab-3A; AltName: Full... 176 9e-43
GN106149_1(GN106149|pid:none) Sequence 10930 from Patent WO20090... 176 9e-43
GN106065_1(GN106065|pid:none) Sequence 10846 from Patent WO20090... 176 9e-43
U28944_14(U28944|pid:none) Caenorhabditis elegans cosmid C18A3, ... 176 9e-43
(Q94986) RecName: Full=Ras-related protein Rab-3; &AB112928_1(A... 176 9e-43
(A4D1S5) RecName: Full=Ras-related protein Rab-19; &BC140796_1(... 176 9e-43
FN314407_1(FN314407|pid:none) Schistosoma japonicum isolate Anhu... 176 9e-43
S01765(S01765;C39963) GTP-binding protein rab3 - rat &X06889_1(... 176 9e-43
U00986_1(U00986|pid:none) Aplysia californica Rab3 mRNA, complet... 176 1e-42
CR762386_2(CR762386|pid:none) Zebrafish DNA sequence from clone ... 176 1e-42
AB024025_4(AB024025|pid:none) Arabidopsis thaliana genomic DNA, ... 176 1e-42
(Q28IZ3) RecName: Full=Ras-related protein Rab-19; &CR760145_1(... 176 1e-42
DQ414558_1(DQ414558|pid:none) Suberites domuncula Rab2 gene, com... 176 1e-42
CR933454_1(CR933454|pid:none) Paramecium tetraurelia, Small GTPa... 176 1e-42
AF254795_1(AF254795|pid:none) Homo sapiens GTP-binding protein R... 176 1e-42
AY904354_1(AY904354|pid:none) Gracilariopsis lemaneiformis small... 176 1e-42
CR932514_1(CR932514|pid:none) Paramecium tetraurelia, Small GTPa... 176 1e-42
(Q40520) RecName: Full=Ras-related protein Rab11C; &L29268_1(L2... 176 1e-42
AE016818_773(AE016818|pid:none) Ashbya gossypii (= Eremothecium ... 176 1e-42
CR380949_94(CR380949|pid:none) Candida glabrata strain CBS138 ch... 176 1e-42
DQ446594_1(DQ446594|pid:none) Arabidopsis thaliana clone pENTR22... 176 1e-42
BC107443_1(BC107443|pid:none) Rattus norvegicus RAB2B, member RA... 175 2e-42
BT043430_1(BT043430|pid:none) Zea mays full-length cDNA clone ZM... 175 2e-42
BT078211_1(BT078211|pid:none) Lepeophtheirus salmonis Pacific fo... 175 2e-42
JC5066(JC5066) GTP-binding protein rab 3C - rat &U54807_1(U5480... 175 2e-42
BT035344_1(BT035344|pid:none) Zea mays full-length cDNA clone ZM... 175 2e-42
BC074481_1(BC074481|pid:none) Xenopus laevis MGC84786 protein, m... 175 2e-42
GN080103_1(GN080103|pid:none) Sequence 706 from Patent WO2009027... 175 2e-42
AY815506_1(AY815506|pid:none) Schistosoma japonicum SJCHGC02859 ... 175 2e-42
EU162609_23(EU162609|pid:none) Cleome spinosa clone contig83 BAC... 175 2e-42
(Q9CZT8) RecName: Full=Ras-related protein Rab-3B; &AB232588_1(... 175 2e-42
BT084300_1(BT084300|pid:none) Zea mays full-length cDNA clone ZM... 175 2e-42
(Q3ZC27) RecName: Full=Ras-related protein Rab-19; &BC102961_1(... 175 2e-42
AC010155_2(AC010155|pid:none) Genomic sequence for Arabidopsis t... 175 2e-42
EZ000003_1(EZ000003|pid:none) TSA: Schistosoma japonicum SJCHGC0... 174 3e-42
(Q63941) RecName: Full=Ras-related protein Rab-3B; &Y14019_1(Y1... 174 3e-42
(Q96E17) RecName: Full=Ras-related protein Rab-3C; &AY026936_1(... 174 3e-42
AY223137_1(AY223137|pid:none) Schistosoma japonicum clone ZZD146... 174 3e-42
CR932694_1(CR932694|pid:none) Paramecium tetraurelia, Small GTPa... 174 4e-42
BC066913_1(BC066913|pid:none) Homo sapiens RAB26, member RAS onc... 174 4e-42
BC135626_1(BC135626|pid:none) Xenopus tropicalis RAB3A, member R... 174 4e-42
(Q9ULW5) RecName: Full=Ras-related protein Rab-26; &AY646153_1(... 174 4e-42
(Q504M8) RecName: Full=Ras-related protein Rab-26; &AB232621_1(... 174 4e-42
EU952347_1(EU952347|pid:none) Zea mays clone 1278162 ras-related... 174 4e-42
BC108532_1(BC108532|pid:none) Xenopus laevis hypothetical protei... 174 4e-42
AM433288_1(AM433288|pid:none) Vitis vinifera contig VV78X079268.... 174 4e-42
(P20337) RecName: Full=Ras-related protein Rab-3B; &AF498932_1(... 174 5e-42
AK060095_1(AK060095|pid:none) Oryza sativa Japonica Group cDNA c... 174 5e-42
BC071068_1(BC071068|pid:none) Xenopus laevis MGC78967 protein, m... 174 5e-42
BT045406_1(BT045406|pid:none) Salmo salar clone ssal-rgf-520-160... 174 5e-42
BC074609_1(BC074609|pid:none) Xenopus tropicalis RAB30, member R... 174 5e-42
BT077989_1(BT077989|pid:none) Lepeophtheirus salmonis Pacific fo... 174 5e-42
(P36409) RecName: Full=Ras-related protein Rab-2A; 173 6e-42
BT039216_1(BT039216|pid:none) Zea mays full-length cDNA clone ZM... 173 6e-42
AY815772_1(AY815772|pid:none) Schistosoma japonicum SJCHGC09130 ... 173 6e-42
PDBN(3RAB)A MOL_ID: 1;MOL_ID: 1; MOLECULE: RAB3A; MOLECULE: RAB3... 173 6e-42
GN080127_1(GN080127|pid:none) Sequence 730 from Patent WO2009027... 173 6e-42
AF532626_1(AF532626|pid:none) Glycine max small GTP-binding prot... 173 6e-42

>(P34139) RecName: Full=Ras-related protein Rab-1A;
Length = 202

Score = 404 bits (1038), Expect = e-111
Identities = 202/202 (100%), Positives = 202/202 (100%)
Frame = +1

Query: 43 MNPDYHYLFKLLLIGDSGVGKSCLLLRFADDTYSESFISTIGVDFKIRTIELNGKTIKLQ 222
MNPDYHYLFKLLLIGDSGVGKSCLLLRFADDTYSESFISTIGVDFKIRTIELNGKTIKLQ
Sbjct: 1 MNPDYHYLFKLLLIGDSGVGKSCLLLRFADDTYSESFISTIGVDFKIRTIELNGKTIKLQ 60

Query: 223 IWDTAGQERFRTITSSYYRGAHGIIVVYDVTDKLTFENVRQWLQEIDRFACENVNKLLVG 402
IWDTAGQERFRTITSSYYRGAHGIIVVYDVTDKLTFENVRQWLQEIDRFACENVNKLLVG
Sbjct: 61 IWDTAGQERFRTITSSYYRGAHGIIVVYDVTDKLTFENVRQWLQEIDRFACENVNKLLVG 120

Query: 403 NKSDLVAKKVVDFNTAKAFADSLQIPFLETSAKQSTNVEQAFMTMATEIKNRLTASQPTQ 582
NKSDLVAKKVVDFNTAKAFADSLQIPFLETSAKQSTNVEQAFMTMATEIKNRLTASQPTQ
Sbjct: 121 NKSDLVAKKVVDFNTAKAFADSLQIPFLETSAKQSTNVEQAFMTMATEIKNRLTASQPTQ 180

Query: 583 TVDKNKVVPGSSAPISPKSGCC 648
TVDKNKVVPGSSAPISPKSGCC
Sbjct: 181 TVDKNKVVPGSSAPISPKSGCC 202

Lambda K H
0.318 0.134 0.401

Gapped
Lambda K H
0.267 0.0410 0.140

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3236559
Number of Hits to DB: 1,429,118,957
Number of extensions: 28340761
Number of successful extensions: 89018
Number of sequences better than 10.0: 4025
Number of HSP's gapped: 86274
Number of HSP's successfully gapped: 4059
Length of query: 298
Length of database: 1,051,180,864
Length adjustment: 128
Effective length of query: 170
Effective length of database: 636,901,312
Effective search space: 108273223040
Effective search space used: 108273223040
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 32 (16.9 bits)

PSORT

psg: 0.75 gvh: 0.60 alm: 0.42 top: 0.53 tms: 0.00 mit: 0.15 mip: 0.00
nuc: 0.00 erl: 0.00 erm: 0.20 pox: 0.00 px2: 0.00 vac: 0.00 rnp: 0.00
act: 0.00 caa: 0.00 yqr: 0.00 tyr: 0.00 leu: 0.00 gpi: 0.00 myr: 0.00
dna: 0.00 rib: 0.00 bac: 1.00 m1a: 0.00 m1b: 0.00 m2 : 0.00 mNt: 0.00
m3a: 0.00 m3b: 0.00 m_ : 1.00

56.0 %: cytoplasmic
20.0 %: nuclear
12.0 %: mitochondrial
8.0 %: vesicles of secretory system
4.0 %: peroxisomal

>> prediction for Contig-U14029-1 is cyt

VS (DIR, S) 1
VH (FL, L) 0
VF (FL, S) 0
AH (FL, L) 1
AF (FL, S) 0
SL (DIR, L) 2
SS (DIR, S) 0
SH (FL, L) 0
SF (FL, S) 0
CH (FL, L) 0
CF (FL, S) 0
FCL (DIR, L) 0
FC (DIR, S) 0
FC-IC (SUB) 0