| Contig-U13894-1 |
| Contig ID |
Contig-U13894-1 |
| Contig update |
2002.12.18 |
| Contig sequence |
 |
| Gap |
no gap |
| Contig length |
1550 |
| Chromosome number (1..6, M) |
2 |
| Chromosome length |
8467578 |
| Start point |
2081463 |
| End point |
2079913 |
| Strand (PLUS/MINUS) |
MINUS |
| Number of clones |
30 |
| Number of EST |
31 |
| Link to clone list |
U13894 |
| List of clone(s) |
est1=SLB487F,1,434
est2=AFK770F,55,625
est3=AFO821E,58,1449
est4=CFE524Z,652,1301
est5=AFC550Z,687,1311
est6=VFJ110Z,687,1307
est7=VFI592Z,688,1323
est8=VFB667Z,689,1328
est9=AFE432Z,691,1336
est10=SFF658Z,691,1341
est11=VFD747Z,709,1314
est12=AFD460Z,712,1349
est13=AFJ848Z,718,1313
est14=VFE456Z,744,1309
est15=AFO542Z,746,1336
est16=VFO561Z,746,1325
est17=VFB557Z,777,1351
est18=AFF584Z,781,1321
est19=AFN657Z,781,1304
est20=CHB559Z,783,1301
est21=VFB384Z,788,1333
est22=VFH430Z,805,1313
est23=VFF282Z,822,1168
est24=VFF368Z,823,1306
est25=VFJ579Z,877,1313
est26=VFG654Z,930,1313
est27=SSH831Z,977,1550
est28=VFD574Z,1065,1334
est29=VSI629Z,1070,1345
est30=SLB487Z,1145,1515
est31=VFL287Z,1226,1331
|
| Translated Amino Acid sequence |
|
| Translated Amino Acid sequence (All Frames) |
|
| own update |
2004. 6.10 |
| Homology vs CSM-cDNA |
|
| dna update |
2008.12.14 |
| Homology vs DNA |
Query= Contig-U13894-1 (Contig-U13894-1Q) /CSM_Contig/Contig-U13894-1Q.Seq.d
(1550 letters)
Database: ddbj_A
92,845,959 sequences; 95,242,211,685 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value N
(BJ346187) Dictyostelium discoideum cDNA clone:dda30j06, 3' ... 1306 0.0 3
(BJ342086) Dictyostelium discoideum cDNA clone:dda9p08, 3' e... 1265 0.0 1
(BJ341651) Dictyostelium discoideum cDNA clone:dda7h16, 3' e... 1257 0.0 1
(BJ432486) Dictyostelium discoideum cDNA clone:ddv18g23, 3' ... 1249 0.0 1
(BJ341399) Dictyostelium discoideum cDNA clone:dda6c13, 3' e... 1231 0.0 1
(AC117075) Dictyostelium discoideum chromosome 2 map 5201047... 1154 0.0 3
(BJ346221) Dictyostelium discoideum cDNA clone:dda30c11, 3' ... 1152 0.0 1
(BJ328029) Dictyostelium discoideum cDNA clone:dda22l17, 5' ... 1118 0.0 1
(BJ431051) Dictyostelium discoideum cDNA clone:ddv9p14, 3' e... 1112 0.0 1
(BJ328930) Dictyostelium discoideum cDNA clone:dda30j06, 5' ... 1027 0.0 2
(BJ429667) Dictyostelium discoideum cDNA clone:ddv4a15, 3' e... 991 0.0 2
(BJ398458) Dictyostelium discoideum cDNA clone:dds12c16, 3' ... 977 0.0 2
(BJ429530) Dictyostelium discoideum cDNA clone:ddv3h21, 3' e... 955 0.0 2
(BJ436263) Dictyostelium discoideum cDNA clone:ddv30i15, 3' ... 940 0.0 2
(BJ429688) Dictyostelium discoideum cDNA clone:ddv4e18, 3' e... 938 0.0 2
(BJ346992) Dictyostelium discoideum cDNA clone:dda25d22, 3' ... 928 0.0 2
(BJ430715) Dictyostelium discoideum cDNA clone:ddv8n11, 3' e... 916 0.0 2
(BJ344780) Dictyostelium discoideum cDNA clone:dda20p12, 3' ... 916 0.0 2
(BJ432547) Dictyostelium discoideum cDNA clone:ddv19c03, 3' ... 904 0.0 3
(BJ371895) Dictyostelium discoideum cDNA clone:ddc10o05, 3' ... 904 0.0 2
(BJ340375) Dictyostelium discoideum cDNA clone:dda12g21, 3' ... 827 0.0 2
(BJ345683) Dictyostelium discoideum cDNA clone:dda28a16, 3' ... 902 0.0 2
(BJ431752) Dictyostelium discoideum cDNA clone:ddv15l08, 3' ... 916 0.0 2
(BJ428344) Dictyostelium discoideum cDNA clone:ddv11h17, 3' ... 950 0.0 1
(AU038529) Dictyostelium discoideum slug cDNA, clone SSH831. 938 0.0 1
(BJ377715) Dictyostelium discoideum cDNA clone:ddc25e15, 3' ... 470 0.0 4
(BJ433144) Dictyostelium discoideum cDNA clone:ddv20m19, 3' ... 821 0.0 1
(AU060786) Dictyostelium discoideum slug cDNA, clone SLB487. 718 0.0 2
(BJ428392) Dictyostelium discoideum cDNA clone:ddv11c22, 3' ... 628 0.0 2
(BJ431565) Dictyostelium discoideum cDNA clone:ddv14k14, 3' ... 650 0.0 1
(AU033826) Dictyostelium discoideum slug cDNA, clone SLB487. 597 e-166 1
(BJ430788) Dictyostelium discoideum cDNA clone:ddv8c19, 3' e... 525 e-144 1
(AU268989) Dictyostelium discoideum vegetative cDNA clone:VS... 373 e-134 2
(BJ434113) Dictyostelium discoideum cDNA clone:ddv23m22, 3' ... 137 1e-27 1
(BD425043) The Nucleotide Sequence of the Haemophilus influe... 44 3e-21 6
(AX395103) Sequence 77 from Patent WO0218601. 44 3e-21 6
(AX084042) Sequence 77 from Patent WO0111033. 44 3e-21 6
(U20229) Haemophilus influenzae BOLA (bolA), glutathione red... 44 1e-18 6
(DY891830) CeleSEQ8528 Cunninghamella elegans pBluescript (E... 78 1e-14 4
(DY890001) CeleSEQ7015 Cunninghamella elegans pBluescript (E... 78 2e-14 4
(CS218846) Sequence 861 from Patent WO2005111066. 54 5e-14 4
(EA266063) Sequence 253 from patent US 7241867. 54 3e-13 4
(DD419215) GENES OF AN OTITIS MEDIA ISOLATE OF NONTYPEABLE H... 54 3e-13 4
(CQ872640) Sequence 253 from Patent WO2004078949. 54 3e-13 4
(AX417043) Sequence 4034 from Patent WO0228891. 64 4e-12 7
(AL596166) Listeria innocua Clip11262 complete genome, segme... 64 5e-12 6
(AX417039) Sequence 4030 from Patent WO0228891. 64 2e-11 6
(AY329357) Apis mellifera ligustica thioredoxin reductase (T... 64 3e-11 4
(AM263198) Listeria welshimeri serovar 6b str. SLCC5334 comp... 54 6e-10 3
(BD398806) Proteins. 46 1e-09 5
(BD263988) Nucleic acid and protein originating in group B S... 46 1e-09 5
(AX134457) Sequence 21 from Patent WO0132882. 46 1e-09 5
(AR933113) Sequence 134 from patent US 7098182. 46 1e-09 5
(AX416809) Sequence 3800 from Patent WO0228891. 50 7e-09 3
(CP000057) Haemophilus influenzae 86-028NP, complete genome. 54 2e-08 2
(EA266463) Sequence 684 from patent US 7241867. 54 2e-08 2
(DD419615) GENES OF AN OTITIS MEDIA ISOLATE OF NONTYPEABLE H... 54 2e-08 2
(CQ873071) Sequence 684 from Patent WO2004078949. 54 2e-08 2
(AM783042) Nicotiana tabacum EST, clone nt002023031. 42 2e-08 3
(CQ644916) Sequence 1873 from Patent WO0234771. 46 3e-08 4
(AX607669) Sequence 5598 from Patent WO02092818. 46 3e-08 4
(BJ834127) Misgurnus anguillicaudatus cDNA clone:dj21f14, 3'... 70 1e-07 2
(EH296187) UAHYP_02D_R_G06 UaHyphae_ARS Uromyces appendicula... 46 2e-07 3
(AF251477) Plasmodium berghei glutathione reductase gene, pa... 52 2e-07 3
(CP000114) Streptococcus agalactiae A909, complete genome. 46 3e-07 2
(CQ655071) Sequence 12028 from Patent WO0234771. 46 3e-07 2
(AX954531) Sequence 1377 from Patent WO03093306. 46 3e-07 2
(AL766850) Streptococcus agalactiae NEM316 complete genome, ... 46 3e-07 2
(AX602189) Sequence 118 from Patent WO02092818. 46 3e-07 2
(AE014255) Streptococcus agalactiae 2603V/R section 65 of 10... 46 3e-07 2
(DQ174691) Streptococcus agalactiae strain J48 serine-rich ... 46 3e-07 2
(AK114675) Ciona intestinalis cDNA, clone:cieg010l19, full i... 46 3e-07 3
(X90528) O.volvulus mRNA for glutathione reductase. 42 7e-07 4
(BC092026) Xenopus laevis hypothetical protein MGC84926, mRN... 46 1e-06 3
(BI505750) BB170031B10G06.5 Bee Brain Normalized/Subtracted ... 64 2e-06 2
(AJ504414) Kluyveromyces lactis glr1 gene for putative gluta... 48 6e-06 4
(AJ717665) Candida albicans glr1 gene for glutathione reduct... 42 9e-06 4
(BC161777) Xenopus tropicalis cDNA clone MGC:186646 IMAGE:89... 48 2e-05 3
(AX417042) Sequence 4033 from Patent WO0228891. 64 2e-05 1
(DB741215) Apis mellifera head cDNA, RIKEN full-length enric... 64 2e-05 1
(DB740367) Apis mellifera head cDNA, RIKEN full-length enric... 64 2e-05 1
(DB737524) Apis mellifera head cDNA, RIKEN full-length enric... 64 2e-05 1
(AK114640) Ciona intestinalis cDNA, clone:cieg009i05, full i... 40 3e-05 4
(DN795993) MVSG840 S.sclerotiorum lambda phage ESTs Library ... 62 7e-05 1
(EA377292) Sequence 26115 from patent US 7314974. 36 7e-05 4
(EA377291) Sequence 26114 from patent US 7314974. 36 7e-05 4
(FF787614) XABT84521.fwd Gateway compatible cien cDNA librar... 54 1e-04 2
(FK044958) XABT114407.b1 Gateway compatible cien cDNA librar... 54 1e-04 2
(AB019579) Streptococcus mutans gene for glutathione reducta... 50 3e-04 3
(AE006163) Pasteurella multocida subsp. multocida str. Pm70 ... 44 4e-04 4
(CX226158) MBM01481 Mus Musculus hematopoietic BM-HPC5 cDNA ... 40 4e-04 3
(BW642325) Dugesia ryukyuensis mRNA, clone: Dr_sW_023_P20, 5... 58 5e-04 2
(AL439273) T7 end of clone BD0AA003E10 of library BD0AA from... 50 7e-04 3
(AL591977) Listeria monocytogenes strain EGD, complete genom... 50 7e-04 7
(DW713798) JARO001056E09 001 Bothrops jararaca cDNA, mRNA se... 42 8e-04 3
(EU115932) Dictyostelium discoideum Ddi2613 RNA, complete se... 58 0.001 1
(DR408105) mhn22d07.b1 C.remanei EST SB146 Caenorhabditis re... 58 0.001 1
(CX357130) ssalrgb526189_rev_0 mixed_tissue Salmo salar cDNA... 56 0.001 2
(U63845) Schizosaccharomyces pombe glutathione reductase (pg... 36 0.001 4
(BF297142) 047PbG01 Pb cDNA #17, Tommaso Pace, Marta Ponzi, ... 52 0.001 2
>(BJ346187) Dictyostelium discoideum cDNA clone:dda30j06, 3' end,
single read.
Length = 761
Score = 1306 bits (659), Expect(3) = 0.0
Identities = 665/667 (99%)
Strand = Plus / Minus
Query: 735 cccttttgaaacaaatgactgacgatggtgtcaaatttgtaactgaagcatccattaaat 794
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 711 cccttttgaaacaaatgactgacgatggtgtcaaatttgtaactgaagcatccattaaat 652
Query: 795 cattggaaagagatgtcgatggaaagagaatcattgccaccacaaacgcagggtgtaaaa 854
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 651 cattggaaagagatgtcgatggaaagagaatcattgccaccacaaacgcagggtgtaaaa 592
Query: 855 ttaccaccagttgaatgtgtaatttgggcaattggtcgtgtaccaaatactgatgatttg 914
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 591 ttaccaccagttgaatgtgtaatttgggcaattggtcgtgtaccaaatactgatgatttg 532
Query: 915 ggtattgacaaggctggtattcaattgacagaacaaagtggtttcattaaagtagacgaa 974
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 531 ggtattgacaaggctggtattcaattgacagaacaaagtggtttcattaaagtagacgaa 472
Query: 975 ttccaaaatacaaatgtaccaggtgtccatgcagttggtgatatttgtggtaacttttta 1034
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 471 ttccaaaatacaaatgtaccaggtgtccatgcagttggtgatatttgtggtaacttttta 412
Query: 1035 ttaacaccagttgcaatcgctgctggtcgtcgtctttctgaacgtcttttcaatggaaaa 1094
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 411 ttaacaccagttgcaatcgctgctggtcgtcgtctttctgaacgtcttttcaatggaaaa 352
Query: 1095 tccgatttgaaattcgaatatgaaaatgttgcaactgttgtattctctcatccaccaatt 1154
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 351 tccgatttgaaattcgaatatgaaaatgttgcaactgttgtattctctcatccaccaatt 292
Query: 1155 ggtaccgttggtttaaccgaacaagaagcaatcaccaagtatggtactgaaaatatcaaa 1214
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 291 ggtaccgttggtttaaccgaacaagaagcaatcaccaagtatggtactgaaaatatcaaa 232
Query: 1215 tgttacaatacctcattcatcaatatgttttattcagttcaagttcataaagttagaacc 1274
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 231 tgttacaatacctcattcatcaatatgttttattcagttcaagttcataaagttagaacc 172
Query: 1275 tctatgaaattggtttgtttaggtaaagaggaaaaagttattggtttacacattattggt 1334
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 171 tctatgaaattggtttgtttaggtaaagaggaaaaagttattggtttacacattattggt 112
Query: 1335 gatggttgtgatgaaatgattcaaggttttgctgtcgctgttaaaatgggttgtacaaaa 1394
||||||||||||||||| ||||||||||||||||| ||||||||||||||||||||||||
Sbjct: 111 gatggttgtgatgaaattattcaaggttttgctgttgctgttaaaatgggttgtacaaaa 52
Query: 1395 tgggatt 1401
|||||||
Sbjct: 51 tgggatt 45
Score = 91.7 bits (46), Expect(3) = 0.0
Identities = 46/46 (100%)
Strand = Plus / Minus
Query: 1401 ttggataatacttgtgcaattcatccaacatctgcagaagaacttg 1446
||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 46 ttggataatacttgtgcaattcatccaacatctgcagaagaacttg 1
Score = 91.7 bits (46), Expect(3) = 0.0
Identities = 46/46 (100%)
Strand = Plus / Minus
Query: 687 tccgtcaaaaacaattccttcgtacttttgatgaaatgttacacac 732
||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 761 tccgtcaaaaacaattccttcgtacttttgatgaaatgttacacac 716
Lambda K H
1.37 0.711 1.31
Matrix: blastn matrix:1 -3
Number of Sequences: 92845959
Number of Hits to DB: 1,571,577,625
Number of extensions: 87547983
Number of successful extensions: 6539413
Number of sequences better than 10.0: 353
Length of query: 1550
Length of database: 95,242,211,685
Length adjustment: 24
Effective length of query: 1526
Effective length of database: 97,308,875,965
Effective search space: 148493344722590
Effective search space used: 148493344722590
X1: 11 (21.8 bits)
S2: 22 (44.1 bits)
|
| protein update |
2009. 7. 8 |
| Homology vs Protein |
Query= Contig-U13894-1 (Contig-U13894-1Q) /CSM_Contig/Contig-U13894-1Q.Seq.d
(1550 letters)
Database: nrp_B
3,236,559 sequences; 1,051,180,864 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
(Q8T137) RecName: Full=Glutathione reductase; Short=GRa... 417 0.0
AB022189_1(AB022189|pid:none) Physarum polycephalum mRNA for glu... 259 e-131
(P00390) RecName: Full=Glutathione reductase, mitochondrial; ... 276 e-124
AF228703_2(AF228703|pid:none) Homo sapiens mitochondrial glutath... 276 e-124
BC161777_1(BC161777|pid:none) Xenopus tropicalis hypothetical pr... 271 e-124
NRL(1GRH) glutathione reductase (EC 1.6.4.2) (Cys-58 modified by... 276 e-124
NRL(1GRA) glutathione reductase (EC 1.6.4.2) (oxidized) (with &... 276 e-124
AK159218_1(AK159218|pid:none) Mus musculus osteoclast-like cell ... 272 e-124
(P47791) RecName: Full=Glutathione reductase, mitochondrial; ... 270 e-123
AK084328_1(AK084328|pid:none) Mus musculus 12 days embryo eyebal... 270 e-123
X76341_1(X76341|pid:none) Mus musculus mRNA for glutathione redu... 270 e-123
AK159678_1(AK159678|pid:none) Mus musculus osteoclast-like cell ... 270 e-122
S39494(S39494;S39493)glutathione-disulfide reductase (EC 1.8.1.7... 270 e-122
BC056357_1(BC056357|pid:none) Mus musculus glutathione reductase... 267 e-122
(A2TIL1) RecName: Full=Glutathione reductase, mitochondrial; ... 261 e-119
FP236842_3534(FP236842|pid:none) Erwinia pyrifoliae strain Ep1/9... 247 e-116
Z81449_7(Z81449|pid:none) Caenorhabditis elegans Cosmid C46F11, ... 249 e-115
BX571860_48(BX571860|pid:none) Photorhabdus luminescens subsp. l... 247 e-115
AY929277_1(AY929277|pid:none) Cercopithecus aethiops glutathione... 273 e-115
BX950851_59(BX950851|pid:none) Erwinia carotovora subsp. atrosep... 243 e-114
CP000713_1984(CP000713|pid:none) Psychrobacter sp. PRwf-1, compl... 247 e-113
CP000826_4697(CP000826|pid:none) Serratia proteamaculans 568, co... 247 e-113
CP000672_543(CP000672|pid:none) Haemophilus influenzae PittGG, c... 256 e-113
CP000243_3938(CP000243|pid:none) Escherichia coli UTI89, complet... 244 e-113
CP000468_3483(CP000468|pid:none) Escherichia coli APEC O1, compl... 244 e-113
CP000057_219(CP000057|pid:none) Haemophilus influenzae 86-028NP,... 254 e-113
AE014075_4204(AE014075|pid:none) Escherichia coli CFT073, comple... 244 e-113
CP001103_3469(CP001103|pid:none) Alteromonas macleodii 'Deep eco... 239 e-113
CP000388_4172(CP000388|pid:none) Pseudoalteromonas atlantica T6c... 232 e-113
(P06715) RecName: Full=Glutathione reductase; Short=GRa... 244 e-113
BA000007_4372(BA000007|pid:none) Escherichia coli O157:H7 str. S... 244 e-113
AP009240_3765(AP009240|pid:none) Escherichia coli SE11 DNA, comp... 244 e-113
FM211053_50(FM211053|pid:none) Photorhabdus asymbiotica subsp. a... 240 e-112
CP001063_3294(CP001063|pid:none) Shigella boydii CDC 3083-94, co... 244 e-112
AE005674_3533(AE005674|pid:none) Shigella flexneri 2a str. 301, ... 244 e-112
CP000034_3301(CP000034|pid:none) Shigella dysenteriae Sd197, com... 244 e-112
U73174_1(U73174|pid:none) Rattus norvegicus glutathione reductas... 269 e-112
CU928158_3377(CU928158|pid:none) Escherichia fergusonii ATCC 354... 243 e-112
CP000783_4093(CP000783|pid:none) Enterobacter sakazakii ATCC BAA... 244 e-112
CU928162_4060(CU928162|pid:none) Escherichia coli ED1a chromosom... 242 e-112
AE017220_3526(AE017220|pid:none) Salmonella enterica subsp. ente... 245 e-112
CP000036_3251(CP000036|pid:none) Shigella boydii Sb227, complete... 243 e-112
CP000884_2347(CP000884|pid:none) Delftia acidovorans SPH-1, comp... 249 e-112
AM933172_3406(AM933172|pid:none) Salmonella enterica subsp. ente... 245 e-112
CP001127_3525(CP001127|pid:none) Salmonella enterica subsp. ente... 245 e-112
CP001138_3545(CP001138|pid:none) Salmonella enterica subsp. ente... 245 e-112
AE006468_3493(AE006468|pid:none) Salmonella enterica subsp. ente... 244 e-112
CP000644_18(CP000644|pid:none) Aeromonas salmonicida subsp. salm... 237 e-112
CP000453_2515(CP000453|pid:none) Alkalilimnicola ehrlichii MLHE-... 218 e-111
CP000687_1205(CP000687|pid:none) Actinobacillus pleuropneumoniae... 243 e-111
AE014613_3646(AE014613|pid:none) Salmonella enterica subsp. ente... 244 e-111
CP000947_1048(CP000947|pid:none) Haemophilus somnus 2336, comple... 246 e-111
CP000964_238(CP000964|pid:none) Klebsiella pneumoniae 342, compl... 244 e-111
CP000569_1221(CP000569|pid:none) Actinobacillus pleuropneumoniae... 243 e-111
AP006725_4719(AP006725|pid:none) Klebsiella pneumoniae NTUH-K204... 243 e-111
AM942759_2811(AM942759|pid:none) Proteus mirabilis strain HI4320... 241 e-110
Y11830_1(Y11830|pid:none) O.volvulus gene encoding glutathione r... 253 e-110
CP000950_113(CP000950|pid:none) Yersinia pseudotuberculosis YPII... 238 e-110
AE009952_3801(AE009952|pid:none) Yersinia pestis KIM, complete g... 238 e-110
CP000305_3620(CP000305|pid:none) Yersinia pestis Nepal516, compl... 238 e-110
CP001027_620(CP001027|pid:none) Burkholderia ambifaria MC40-6 ch... 247 e-110
CP000720_3989(CP000720|pid:none) Yersinia pseudotuberculosis IP ... 239 e-110
CP000436_1114(CP000436|pid:none) Haemophilus somnus 129PT, compl... 246 e-110
CP000822_4821(CP000822|pid:none) Citrobacter koseri ATCC BAA-895... 240 e-110
BX936398_3816(BX936398|pid:none) Yersinia pseudotuberculosis IP3... 238 e-110
AB1188(AB1188) glutathione-disulfide reductase (EC 1.8.1.7) [sim... 250 e-110
CP000821_142(CP000821|pid:none) Shewanella sediminis HAW-EB3, co... 224 e-110
CP001175_1690(CP001175|pid:none) Listeria monocytogenes HCC23, c... 252 e-110
X90528_1(X90528|pid:none) O.volvulus mRNA for glutathione reduct... 251 e-109
CP000020_2504(CP000020|pid:none) Vibrio fischeri ES114 chromosom... 235 e-109
AE017262_917(AE017262|pid:none) Listeria monocytogenes str. 4b F... 251 e-109
CP000442_862(CP000442|pid:none) Burkholderia ambifaria AMMD chro... 246 e-109
NRL(1GESB) glutathione reductase (NADPH) (EC 1.6.4.2) mutant (A1... 244 e-109
CP001139_2504(CP001139|pid:none) Vibrio fischeri MJ11 chromosome... 235 e-109
CP000606_3653(CP000606|pid:none) Shewanella loihica PV-4, comple... 225 e-109
CP000419_337(CP000419|pid:none) Streptococcus thermophilus LMD-9... 246 e-107
(Q60151) RecName: Full=Glutathione reductase; Short=GRa... 246 e-107
A82353(A82353) glutathione-disulfide reductase (EC 1.8.1.7) [sim... 231 e-107
CP001485_396(CP001485|pid:none) Vibrio cholerae MJ-1236 chromoso... 231 e-107
T51908(T51908)glutathione-disulfide reductase (EC 1.8.1.7) [simi... 230 e-107
(Q873E8) RecName: Full=Glutathione reductase; Short=GRa... 230 e-107
CP001233_171(CP001233|pid:none) Vibrio cholerae M66-2 chromosome... 231 e-107
CR954246_344(CR954246|pid:none) Pseudoalteromonas haloplanktis s... 227 e-107
CP000891_4371(CP000891|pid:none) Shewanella baltica OS195, compl... 226 e-107
CP000503_3932(CP000503|pid:none) Shewanella sp. W3-18-1, complet... 223 e-106
CP000469_4026(CP000469|pid:none) Shewanella sp. ANA-3, complete ... 224 e-106
AP008232_68(AP008232|pid:none) Sodalis glossinidius str. 'morsit... 239 e-106
CP001252_4144(CP001252|pid:none) Shewanella baltica OS223, compl... 224 e-106
CP001132_528(CP001132|pid:none) Acidithiobacillus ferrooxidans A... 226 e-105
AM270053_33(AM270053|pid:none) Aspergillus niger contig An03c012... 221 e-105
AE014299_4574(AE014299|pid:none) Shewanella oneidensis MR-1, com... 220 e-105
BC006966_1(BC006966|pid:none) Mus musculus glutathione reductase... 270 e-105
FM954972_60(FM954972|pid:none) Vibrio splendidus LGP32 chromosom... 225 e-105
CP000447_3840(CP000447|pid:none) Shewanella frigidimarina NCIMB ... 217 e-105
CU638743_462(CU638743|pid:none) Podospora anserina genomic DNA c... 226 e-104
CP000544_2364(CP000544|pid:none) Halorhodospira halophila SL1, c... 228 e-104
AE009948_1337(AE009948|pid:none) Streptococcus agalactiae 2603V/... 231 e-103
DQ174691_16(DQ174691|pid:none) Streptococcus agalactiae strain J... 228 e-102
CP000259_682(CP000259|pid:none) Streptococcus pyogenes MGAS9429,... 238 e-102
CP000056_606(CP000056|pid:none) Streptococcus pyogenes MGAS6180,... 239 e-102
AE014133_761(AE014133|pid:none) Streptococcus mutans UA159, comp... 225 e-102
CP000387_1456(CP000387|pid:none) Streptococcus sanguinis SK36, c... 241 e-102
AE014074_546(AE014074|pid:none) Streptococcus pyogenes MGAS315, ... 239 e-102
CP000003_644(CP000003|pid:none) Streptococcus pyogenes MGAS10394... 233 e-102
(Q6FRV2) RecName: Full=Glutathione reductase; Short=GRa... 211 e-102
(P78965) RecName: Full=Glutathione reductase; Short=GRa... 223 e-102
FM204883_946(FM204883|pid:none) Streptococcus equi subsp. equi 4... 228 e-101
AB019579_1(AB019579|pid:none) Streptococcus mutans gene for glut... 224 e-101
(P41921) RecName: Full=Glutathione reductase; Short=GRa... 211 e-100
CU928178_625(CU928178|pid:none) Zygosaccharomyces rouxii strain ... 207 1e-99
D37871_1(D37871|pid:none) Saccharomyces cerevisiae mRNA for glut... 206 3e-99
CP000488_267(CP000488|pid:none) Candidatus Ruthia magnifica str.... 218 2e-97
CP001015_708(CP001015|pid:none) Streptococcus pneumoniae G54, co... 229 2e-97
(Q6HA23) RecName: Full=Glutathione reductase; Short=GRa... 202 6e-97
AE007317_692(AE007317|pid:none) Streptococcus pneumoniae R6, com... 229 8e-97
CP001160_639(CP001160|pid:none) Thalassiosira pseudonana CCMP133... 221 1e-96
AE005672_741(AE005672|pid:none) Streptococcus pneumoniae TIGR4, ... 229 1e-96
(Q6C5H4) RecName: Full=Glutathione reductase; Short=GRa... 207 2e-96
U63845_1(U63845|pid:none) Schizosaccharomyces pombe glutathione ... 207 2e-96
CP000919_685(CP000919|pid:none) Streptococcus pneumoniae JJA, co... 228 2e-96
CP000920_723(CP000920|pid:none) Streptococcus pneumoniae P1031, ... 229 3e-96
AP009247_266(AP009247|pid:none) Candidatus Vesicomyosocius okuta... 214 1e-95
CP000439_811(CP000439|pid:none) Francisella tularensis subsp. no... 217 7e-95
AY871933_1(AY871933|pid:none) Synthetic construct hypothetical p... 216 8e-94
AJ749949_955(AJ749949|pid:none) Francisella tularensis subsp. tu... 216 8e-94
CP000937_1784(CP000937|pid:none) Francisella philomiragia subsp.... 215 2e-93
BC095128_1(BC095128|pid:none) Danio rerio zgc:110010, mRNA (cDNA... 170 2e-93
FM992692_83(FM992692|pid:none) Candida dubliniensis CD36 chromos... 204 5e-93
CP001033_733(CP001033|pid:none) Streptococcus pneumoniae CGSP14,... 220 7e-92
CP001111_2878(CP001111|pid:none) Stenotrophomonas maltophilia R5... 199 7e-88
CR382137_565(CR382137|pid:none) Debaryomyces hansenii strain CBS... 191 2e-87
AM743169_3262(AM743169|pid:none) Stenotrophomonas maltophilia K2... 198 1e-86
AJ717665_1(AJ717665|pid:none) Candida albicans glr1 gene for glu... 201 3e-86
AM039952_2903(AM039952|pid:none) Xanthomonas campestris pv. vesi... 204 5e-82
CP000082_1693(CP000082|pid:none) Psychrobacter arcticus 273-4, c... 251 1e-81
CP000323_1959(CP000323|pid:none) Psychrobacter cryohalolentis K5... 251 2e-81
AE008923_2703(AE008923|pid:none) Xanthomonas axonopodis pv. citr... 206 3e-81
CP000050_1511(CP000050|pid:none) Xanthomonas campestris pv. camp... 208 3e-81
AE008922_2532(AE008922|pid:none) Xanthomonas campestris pv. camp... 206 1e-80
CP000075_2978(CP000075|pid:none) Pseudomonas syringae pv. syring... 156 3e-79
CP000058_2158(CP000058|pid:none) Pseudomonas syringae pv. phaseo... 157 2e-78
EU833989_2(EU833989|pid:none) Pseudomonas syringae pv. syringae ... 154 7e-78
CP001287_394(CP001287|pid:none) Cyanothece sp. PCC 8801, complet... 164 1e-77
CP001157_2417(CP001157|pid:none) Azotobacter vinelandii DJ, comp... 158 2e-77
DQ118625_1(DQ118625|pid:none) Pavlova lutheri isolate 1689 chlor... 145 2e-77
AE014187_189(AE014187|pid:none) Plasmodium falciparum 3D7 chromo... 177 5e-77
(O15770) RecName: Full=Glutathione reductase; Short=GRa... 176 1e-76
CP000407_503(CP000407|pid:none) Streptococcus suis 05ZYH33, comp... 220 1e-76
AM181176_2916(AM181176|pid:none) Pseudomonas fluorescens SBW25 c... 147 3e-76
AE016830_3052(AE016830|pid:none) Enterococcus faecalis V583, com... 238 8e-76
CP000680_2334(CP000680|pid:none) Pseudomonas mendocina ymp, comp... 147 2e-74
AF019907_1(AF019907|pid:none) Vitis vinifera glutathione reducta... 168 6e-74
CP001291_4225(CP001291|pid:none) Cyanothece sp. PCC 7424, comple... 160 6e-74
CP000158_701(CP000158|pid:none) Hyphomonas neptunium ATCC 15444,... 176 2e-73
AM472214_1(AM472214|pid:none) Vitis vinifera contig VV78X042719.... 168 4e-73
CP001330_27(CP001330|pid:none) Micromonas sp. RCC299 chromosome ... 159 2e-72
CP000927_3533(CP000927|pid:none) Caulobacter sp. K31, complete g... 147 5e-72
(P48638) RecName: Full=Glutathione reductase; Short=GRa... 165 5e-72
CR628337_617(CR628337|pid:none) Legionella pneumophila str. Lens... 228 8e-72
AP009552_4623(AP009552|pid:none) Microcystis aeruginosa NIES-843... 147 1e-71
CR628336_630(CR628336|pid:none) Legionella pneumophila str. Pari... 228 1e-71
AE008917_971(AE008917|pid:none) Brucella melitensis 16M chromoso... 154 3e-71
AE014291_981(AE014291|pid:none) Brucella suis 1330 chromosome I,... 154 3e-71
CP001488_971(CP001488|pid:none) Brucella melitensis ATCC 23457 c... 154 3e-71
AL591688_1860(AL591688|pid:none) Sinorhizobium meliloti 1021 com... 152 3e-71
CP000304_2070(CP000304|pid:none) Pseudomonas stutzeri A1501, com... 143 3e-71
AE017354_559(AE017354|pid:none) Legionella pneumophila subsp. pn... 226 3e-71
CP000675_668(CP000675|pid:none) Legionella pneumophila str. Corb... 226 3e-71
AE017223_944(AE017223|pid:none) Brucella abortus biovar 1 str. 9... 154 3e-71
CP000282_1847(CP000282|pid:none) Saccharophagus degradans 2-40, ... 147 3e-71
CP001037_835(CP001037|pid:none) Nostoc punctiforme PCC 73102, co... 159 7e-71
CP000708_903(CP000708|pid:none) Brucella ovis ATCC 25840 chromos... 152 1e-70
AM778957_281(AM778957|pid:none) Microcystis aeruginosa PCC 7806 ... 145 1e-70
AF349449_1(AF349449|pid:none) Brassica juncea glutathione reduct... 159 1e-69
(P48640) RecName: Full=Glutathione reductase, chloroplastic; ... 149 2e-69
EU285581_1(EU285581|pid:none) Solanum lycopersicum chloroplast g... 166 3e-69
AF105199_1(AF105199|pid:none) Glycine max glutathione reductase ... 154 4e-69
AB183476_1(AB183476|pid:none) Streptococcus suis gene for hypoth... 220 4e-69
DQ286546_1(DQ286546|pid:none) Ulva fasciata glutathione reductas... 169 9e-69
AP007255_1666(AP007255|pid:none) Magnetospirillum magneticum AMB... 154 1e-68
CP000316_635(CP000316|pid:none) Polaromonas sp. JS666, complete ... 147 2e-68
CP000377_1956(CP000377|pid:none) Silicibacter sp. TM1040, comple... 150 2e-68
CP000155_3726(CP000155|pid:none) Hahella chejuensis KCTC 2396, c... 150 3e-68
CP000582_274(CP000582|pid:none) Ostreococcus lucimarinus CCE9901... 150 4e-68
CP000613_1547(CP000613|pid:none) Rhodospirillum centenum SW, com... 150 7e-68
CP000248_1801(CP000248|pid:none) Novosphingobium aromaticivorans... 143 9e-68
AJ224977_4(AJ224977|pid:none) Sphingomonas sp. strain RW5 gtdA g... 152 2e-67
CP000230_681(CP000230|pid:none) Rhodospirillum rubrum ATCC 11170... 149 3e-67
CP000086_270(CP000086|pid:none) Burkholderia thailandensis E264 ... 147 3e-67
CP000283_2052(CP000283|pid:none) Rhodopseudomonas palustris BisB... 163 6e-67
EF555119_1(EF555119|pid:none) Dasypyrum villosum chloroplast glu... 155 8e-67
CP000115_1217(CP000115|pid:none) Nitrobacter winogradskyi Nb-255... 160 1e-66
CP000157_976(CP000157|pid:none) Erythrobacter litoralis HTCC2594... 163 1e-66
CR954202_20(CR954202|pid:none) Ostreococcus tauri strain OTTH059... 149 1e-66
CP000264_3174(CP000264|pid:none) Jannaschia sp. CCS1, complete g... 145 1e-66
(P27456) RecName: Full=Glutathione reductase, chloroplastic/mito... 150 2e-66
BX548175_564(BX548175|pid:none) Prochlorococcus marinus MIT9313 ... 143 2e-66
CP000269_966(CP000269|pid:none) Janthinobacterium sp. Marseille,... 145 2e-66
AE007869_1575(AE007869|pid:none) Agrobacterium tumefaciens str. ... 148 3e-66
AC104428_18(AC104428|pid:none) Oryza sativa (japonica cultivar-g... 154 4e-66
DQ267474_1(DQ267474|pid:none) Vigna unguiculata glutathione redu... 156 5e-66
CP000301_2053(CP000301|pid:none) Rhodopseudomonas palustris BisB... 158 5e-66
EU819142_20(EU819142|pid:none) Uncultured Roseobacter sp. clone ... 145 5e-66
CP000250_3368(CP000250|pid:none) Rhodopseudomonas palustris HaA2... 158 6e-66
CP000143_1964(CP000143|pid:none) Rhodobacter sphaeroides 2.4.1 c... 139 8e-66
CP000661_875(CP000661|pid:none) Rhodobacter sphaeroides ATCC 170... 137 8e-66
CP001150_1687(CP001150|pid:none) Rhodobacter sphaeroides KD131 c... 139 1e-65
CP000031_1298(CP000031|pid:none) Ruegeria pomeroyi DSS-3, comple... 147 2e-65
CP000577_1986(CP000577|pid:none) Rhodobacter sphaeroides ATCC 17... 140 2e-65
AM902716_3736(AM902716|pid:none) Bordetella petrii strain DSM 12... 147 2e-65
CP000554_1795(CP000554|pid:none) Prochlorococcus marinus str. MI... 141 2e-65
CP000378_2375(CP000378|pid:none) Burkholderia cenocepacia AU 105... 151 3e-65
AM889285_2216(AM889285|pid:none) Gluconacetobacter diazotrophicu... 150 7e-65
X76533_1(X76533|pid:none) N.tabacum mRNA for glutathione reducta... 165 9e-65
CP001096_2154(CP001096|pid:none) Rhodopseudomonas palustris TIE-... 155 1e-64
BX572599_120(BX572599|pid:none) Rhodopseudomonas palustris CGA00... 155 2e-64
CP000151_3163(CP000151|pid:none) Burkholderia sp. 383 chromosome... 154 2e-64
AP009384_2334(AP009384|pid:none) Azorhizobium caulinodans ORS 57... 145 3e-64
EU870516_1(EU870516|pid:none) Picrorhiza kurrooa glutathione red... 131 4e-64
(P30635) RecName: Full=Probable glutathione reductase 2; ... 153 6e-64
CP000009_1704(CP000009|pid:none) Gluconobacter oxydans 621H, com... 136 6e-64
CP000958_3002(CP000958|pid:none) Burkholderia cenocepacia MC0-3 ... 150 7e-64
BA000039_1607(BA000039|pid:none) Thermosynechococcus elongatus B... 162 9e-64
CP000494_3273(CP000494|pid:none) Bradyrhizobium sp. BTAi1, compl... 160 2e-63
BA000040_3757(BA000040|pid:none) Bradyrhizobium japonicum USDA 1... 154 2e-63
CP000830_2721(CP000830|pid:none) Dinoroseobacter shibae DFL 12, ... 144 4e-63
CP001344_3021(CP001344|pid:none) Cyanothece sp. PCC 7425, comple... 149 4e-63
CP000390_1452(CP000390|pid:none) Mesorhizobium sp. BNC1, complet... 135 5e-63
CP000943_4522(CP000943|pid:none) Methylobacterium sp. 4-46, comp... 139 6e-63
CP001191_1990(CP001191|pid:none) Rhizobium leguminosarum bv. tri... 145 6e-63
CT971583_706(CT971583|pid:none) Synechococcus WH7803 complete ge... 136 6e-63
CP000880_3878(CP000880|pid:none) Salmonella enterica subsp. ariz... 243 1e-62
CP000781_3194(CP000781|pid:none) Xanthobacter autotrophicus Py2,... 149 2e-62
CP001025_2888(CP001025|pid:none) Burkholderia ambifaria MC40-6 c... 150 2e-62
CP000908_2267(CP000908|pid:none) Methylobacterium extorquens PA1... 140 2e-62
CP001510_2113(CP001510|pid:none) Methylobacterium extorquens AM1... 140 3e-62
AE014298_1203(AE014298|pid:none) Drosophila melanogaster chromos... 127 4e-62
AF301145_1(AF301145|pid:none) Drosophila melanogaster thioredoxi... 127 4e-62
AE014298_1201(AE014298|pid:none) Drosophila melanogaster chromos... 127 4e-62
CP000463_1972(CP000463|pid:none) Rhodopseudomonas palustris BisA... 152 4e-62
CP000614_3055(CP000614|pid:none) Burkholderia vietnamiensis G4 c... 154 5e-62
AF106697_1(AF106697|pid:none) Homo sapiens thioredoxin reductase... 148 6e-62
(Q9UQU8) RecName: Full=Thioredoxin reductase 2, mitochondrial; ... 148 6e-62
AE017126_568(AE017126|pid:none) Prochlorococcus marinus subsp. m... 129 6e-62
AF201385_1(AF201385|pid:none) Homo sapiens mitochondrial thiored... 147 1e-61
CP000133_2339(CP000133|pid:none) Rhizobium etli CFN 42, complete... 140 1e-61
AB209724_1(AB209724|pid:none) Homo sapiens mRNA for thioredoxin ... 147 1e-61
AB019695_1(AB019695|pid:none) Homo sapiens mRNA for thioredoxin ... 147 1e-61
BC117354_1(BC117354|pid:none) Homo sapiens thioredoxin reductase... 147 1e-61
CP000878_572(CP000878|pid:none) Prochlorococcus marinus str. MIT... 150 2e-61
BX569693_112(BX569693|pid:none) Synechococcus sp. WH8102 complet... 132 2e-61
(P39051) RecName: Full=Trypanothione reductase; Short=T... 147 2e-61
AY331258_7(AY331258|pid:none) Sphingomonas paucimobilis ORFA (or... 134 4e-61
CP001029_2223(CP001029|pid:none) Methylobacterium populi BJ001, ... 135 2e-60
CR954201_415(CR954201|pid:none) Ostreococcus tauri strain OTTH05... 127 3e-60
(Q9N2I8) RecName: Full=Thioredoxin reductase 2, mitochondrial; ... 143 4e-60
AB022283_1(AB022283|pid:none) Bos taurus mRNA for thioredoxin re... 143 4e-60
CP000490_820(CP000490|pid:none) Paracoccus denitrificans PD1222 ... 129 2e-59
CP001037_854(CP001037|pid:none) Nostoc punctiforme PCC 73102, co... 134 4e-59
CT978603_1202(CT978603|pid:none) Synechococcus sp. RCC307 genomi... 130 1e-58
BX897700_661(BX897700|pid:none) Bartonella quintana str. Toulous... 138 2e-58
AF414359_1(AF414359|pid:none) Mus musculus thioredoxin reductase... 140 2e-58
AF136399_1(AF136399|pid:none) Mus musculus thioredoxin reductase... 140 2e-58
AF171053_1(AF171053|pid:none) Mus musculus thioredoxin reductase... 140 2e-58
AB027566_1(AB027566|pid:none) Mus musculus TXNRD2 mRNA for thior... 140 2e-58
FM178379_120(FM178379|pid:none) Aliivibrio salmonicida LFI1238 c... 228 4e-58
AK108799_1(AK108799|pid:none) Oryza sativa Japonica Group cDNA c... 154 9e-58
AM902716_1525(AM902716|pid:none) Bordetella petrii strain DSM 12... 131 4e-57
AF118392_1(AF118392|pid:none) Candida albicans glutathione reduc... 113 6e-56
AM502223_35(AM502223|pid:none) Leishmania infantum chromosome 5. 139 8e-56
(P28593) RecName: Full=Trypanothione reductase; Short=T... 137 1e-55
NRL(1NDAA) Trypanothione oxidoreductase (EC 1.6.4.8) (oxidized),... 137 1e-55
CP000510_487(CP000510|pid:none) Psychromonas ingrahamii 37, comp... 219 2e-55
AM910995_294(AM910995|pid:none) Plasmodium knowlesi strain H chr... 184 6e-54
AF251477_1(AF251477|pid:none) Plasmodium berghei glutathione red... 184 8e-54
EF583873_1(EF583873|pid:none) Leishmania amazonensis trypanothio... 132 1e-53
AF494052_1(AF494052|pid:none) Chlamydomonas reinhardtii thioredo... 115 2e-53
(Q74ZK4) RecName: Full=Glutathione reductase; Short=GRa... 213 2e-53
AE015451_3779(AE015451|pid:none) Pseudomonas putida KT2440 compl... 163 3e-53
NRL(1TYTB) Trypanothione reductase (EC 1.6.4.8) (oxidized form (... 135 3e-53
NRL(1TYPA) Trypanothione reductase (EC 1.6.4.8) complex with 135 4e-53
CT573326_2111(CT573326|pid:none) Pseudomonas entomophila str. L4... 164 5e-53
M73325_1(M73325|pid:none) Crithidia fasciculata trypanothione re... 134 7e-53
NRL(2TPRA) trypanothione reductase (EC 1.6.4.8), chain A - Crith... 134 7e-53
M97953_1(M97953|pid:none) Trypanosoma cruzi trypanothione reduct... 122 1e-52
AF166127_1(AF166127|pid:none) Homo sapiens selenoprotein Zf2 mRN... 147 2e-52
CP000926_3510(CP000926|pid:none) Pseudomonas putida GB-1, comple... 160 1e-51
CP000744_3227(CP000744|pid:none) Pseudomonas aeruginosa PA7, com... 160 6e-51
AY785715_1(AY785715|pid:none) Trypanosoma cruzi strain Colombian... 116 8e-51
CP000438_3059(CP000438|pid:none) Pseudomonas aeruginosa UCBPP-PA... 159 1e-50
AF358981_1(AF358981|pid:none) Trypanosoma cruzi strain CUICA cl1... 115 1e-50
AY145120_1(AY145120|pid:none) Cryptosporidium parvum strain IOWA... 120 2e-50
AY785713_1(AY785713|pid:none) Trypanosoma cruzi strain YuYu clon... 116 3e-50
AY785724_1(AY785724|pid:none) Trypanosoma cruzi strain NR cl3 cl... 116 3e-50
AY785723_1(AY785723|pid:none) Trypanosoma cruzi strain NR cl3 cl... 116 4e-50
AF358986_1(AF358986|pid:none) Trypanosoma cruzi strain CANIII cl... 115 4e-50
(P23189) RecName: Full=Glutathione reductase; Short=GRa... 157 5e-50
AY785717_1(AY785717|pid:none) Trypanosoma cruzi strain Dm 28 c c... 114 5e-50
AF359008_1(AF359008|pid:none) Trypanosoma vespertilionis strain ... 115 9e-50
CR940352_96(CR940352|pid:none) Theileria annulata strain Ankara ... 119 1e-49
AF358990_1(AF358990|pid:none) Trypanosoma cruzi strain CM 17 try... 116 1e-49
AY785708_1(AY785708|pid:none) Trypanosoma cruzi strain Basileu c... 115 3e-49
CP000319_1402(CP000319|pid:none) Nitrobacter hamburgensis X14, c... 161 9e-49
BX640427_67(BX640427|pid:none) Bordetella parapertussis strain 1... 154 2e-48
BX640444_120(BX640444|pid:none) Bordetella bronchiseptica strain... 154 2e-48
BX640417_143(BX640417|pid:none) Bordetella pertussis strain Toha... 154 3e-48
CP000090_3411(CP000090|pid:none) Ralstonia eutropha JMP134 chrom... 130 5e-48
CP001196_2487(CP001196|pid:none) Oligotropha carboxidovorans OM5... 159 5e-48
AF412308_1(AF412308|pid:none) Mus musculus mitochondrial thiored... 103 2e-47
AM260479_3628(AM260479|pid:none) Ralstonia eutropha H16 chromoso... 124 4e-47
CP000758_2078(CP000758|pid:none) Ochrobactrum anthropi ATCC 4918... 135 4e-46
CP001068_3693(CP001068|pid:none) Ralstonia pickettii 12J chromos... 122 2e-45
(O62768) RecName: Full=Thioredoxin reductase 1, cytoplasmic; ... 150 6e-45
CP000514_1339(CP000514|pid:none) Marinobacter aquaeolei VT8, com... 142 6e-45
(O04955) RecName: Full=Glutathione reductase, cytosolic; ... 149 1e-44
CU861906_43(CU861906|pid:none) Ralstonia solanacearum strain Mol... 124 3e-44
(P48641) RecName: Full=Glutathione reductase, cytosolic; ... 149 4e-44
AF360228_1(AF360228|pid:none) Arabidopsis thaliana putative glut... 149 4e-44
CR926483_1(CR926483|pid:none) Pongo abelii mRNA; cDNA DKFZp459H0... 147 6e-44
CP000111_593(CP000111|pid:none) Prochlorococcus marinus str. MIT... 129 8e-44
(P48639) RecName: Full=Glutathione reductase; Short=GRa... 152 8e-44
AF537300_1(AF537300|pid:none) Sus scrofa thioredoxin reductase (... 146 2e-43
BC167349_1(BC167349|pid:none) Xenopus tropicalis hypothetical pr... 146 2e-43
AK296495_1(AK296495|pid:none) Homo sapiens cDNA FLJ59560 complet... 144 2e-43
AM709787_1(AM709787|pid:none) Fasciola hepatica mRNA for thiored... 145 5e-43
CR860816_1(CR860816|pid:none) Pongo abelii mRNA; cDNA DKFZp469H1... 145 5e-43
CP000576_594(CP000576|pid:none) Prochlorococcus marinus str. MIT... 125 5e-43
CP000110_952(CP000110|pid:none) Synechococcus sp. CC9605, comple... 137 3e-42
AM260525_827(AM260525|pid:none) Bartonella tribocorum CIP 105476... 134 4e-42
FJ440149_1(FJ440149|pid:none) Moneuplotes crassus thioredoxin re... 132 7e-42
AM420293_5508(AM420293|pid:none) Saccharopolyspora erythraea NRR... 98 9e-42
AY329357_1(AY329357|pid:none) Apis mellifera ligustica thioredox... 124 1e-41
DQ219850_1(DQ219850|pid:none) Alicyclobacillus vulcanalis mercur... 82 2e-41
CP000552_632(CP000552|pid:none) Prochlorococcus marinus str. MIT... 127 2e-41
BC154784_1(BC154784|pid:none) Danio rerio thioredoxin reductase ... 143 3e-41
BC054599_1(BC054599|pid:none) Danio rerio thioredoxin reductase ... 143 3e-41
CP001283_4442(CP001283|pid:none) Bacillus cereus AH820, complete... 79 4e-41
CP000020_2205(CP000020|pid:none) Vibrio fischeri ES114 chromosom... 87 5e-41
(Q9Z0J5) RecName: Full=Thioredoxin reductase 2, mitochondrial; ... 138 6e-41
AF072865_1(AF072865|pid:none) Rattus norvegicus thioredoxin redu... 138 6e-41
AB125639_1(AB125639|pid:none) Brassica oleracea BO-GR mRNA for g... 137 8e-41
BA000043_3096(BA000043|pid:none) Geobacillus kaustophilus HTA426... 82 9e-41
AF148217_1(AF148217|pid:none) Caenorhabditis elegans thioredoxin... 136 1e-40
(Q17745) RecName: Full=Thioredoxin reductase 1; Short=T... 136 1e-40
AF162693_1(AF162693|pid:none) Caenorhabditis elegans thioredoxin... 136 1e-40
T30091(T30091)hypothetical protein C06G3.7 - Caenorhabditis eleg... 136 1e-40
AY625511_1(AY625511|pid:none) Glossina morsitans morsitans clone... 128 5e-40
CR931997_1153(CR931997|pid:none) Corynebacterium jeikeium K411 c... 96 6e-40
AB024961_5(AB024961|pid:none) Clostridium butyricum merR1, merE-... 79 7e-40
Y09907_5(Y09907|pid:none) Bacillus megaterium ORF2, ORF3, ORF4, ... 79 7e-40
AY051643_1(AY051643|pid:none) Drosophila melanogaster GM14215 fu... 94 7e-40
(Q9VNT5) RecName: Full=Thioredoxin reductase 2, mitochondrial; ... 127 9e-40
DQ884951_1(DQ884951|pid:none) Rheum australe glutathione reducta... 140 1e-39
AJ582645_1(AJ582645|pid:none) Streptococcus oralis partial merA ... 78 1e-39
CP001581_1739(CP001581|pid:none) Clostridium botulinum A2 str. K... 84 3e-39
AE009948_1220(AE009948|pid:none) Streptococcus agalactiae 2603V/... 79 4e-39
AJ582646_1(AJ582646|pid:none) Streptococcus mitis transposon par... 76 4e-39
CP001083_1655(CP001083|pid:none) Clostridium botulinum Ba4 str. ... 84 4e-39
AM412317_1615(AM412317|pid:none) Clostridium botulinum A str. AT... 84 4e-39
CP000728_1602(CP000728|pid:none) Clostridium botulinum F str. La... 84 4e-39
AE009948_1973(AE009948|pid:none) Streptococcus agalactiae 2603V/... 79 5e-39
AE017308_582(AE017308|pid:none) Mycoplasma mobile 163K complete ... 83 6e-39
CP000725_365(CP000725|pid:none) Streptococcus gordonii str. Chal... 78 8e-39
AM749392_1(AM749392|pid:none) Thermus scotoductus lpd gene for d... 91 8e-39
CP000113_4108(CP000113|pid:none) Myxococcus xanthus DK 1622, com... 91 8e-39
CP000903_2508(CP000903|pid:none) Bacillus weihenstephanensis KBA... 83 8e-39
CP000922_1408(CP000922|pid:none) Anoxybacillus flavithermus WK1,... 80 1e-38
FM864216_64(FM864216|pid:none) Mycoplasma conjunctivae HRC/581T ... 77 1e-38
CP000627_1938(CP000627|pid:none) Vibrio cholerae O395 chromosome... 90 1e-38
AE016879_2550(AE016879|pid:none) Bacillus anthracis str. Ames, c... 89 2e-38
(P18925) RecName: Full=Dihydrolipoyl dehydrogenase; EC=... 98 3e-38
Y09024_6(Y09024|pid:none) Bacillus cereus merR, merA genes and T... 75 4e-38
CP000356_2493(CP000356|pid:none) Sphingopyxis alaskensis RB2256,... 91 4e-38
CP001186_2654(CP001186|pid:none) Bacillus cereus G9842, complete... 85 4e-38
CP001283_2686(CP001283|pid:none) Bacillus cereus AH820, complete... 82 4e-38
CP000407_1830(CP000407|pid:none) Streptococcus suis 05ZYH33, com... 100 5e-38
(O50286) RecName: Full=Dihydrolipoyl dehydrogenase; EC=... 85 5e-38
I40794(I40794) dihydrolipoamide dehydrogenase (EC 1.8.1.4) [vali... 87 6e-38
CP000001_2472(CP000001|pid:none) Bacillus cereus E33L, complete ... 85 6e-38
(P16171) RecName: Full=Mercuric reductase; EC=1.16.1.1;... 72 8e-38
AY351675_12(AY351675|pid:none) Enterococcus faecium isolate 664.... 78 8e-38
CP000155_4520(CP000155|pid:none) Hahella chejuensis KCTC 2396, c... 98 8e-38
AE013598_709(AE013598|pid:none) Xanthomonas oryzae pv. oryzae KA... 91 1e-37
AP008229_658(AP008229|pid:none) Xanthomonas oryzae pv. oryzae MA... 91 1e-37
CP000896_751(CP000896|pid:none) Acholeplasma laidlawii PG-8A, co... 75 1e-37
CP000353_1386(CP000353|pid:none) Ralstonia metallidurans CH34 me... 89 1e-37
CP001176_2635(CP001176|pid:none) Bacillus cereus B4264, complete... 84 1e-37
AE008922_541(AE008922|pid:none) Xanthomonas campestris pv. campe... 90 1e-37
S70187_1(S70187|pid:none) ferric leghemoglobin reductase [Glycin... 84 2e-37
AE008923_3610(AE008923|pid:none) Xanthomonas axonopodis pv. citr... 89 2e-37
AF295339_1(AF295339|pid:none) Solanum tuberosum dihydrolipoamide... 94 2e-37
AE017221_1747(AE017221|pid:none) Thermus thermophilus HB27, comp... 94 2e-37
CP000738_1552(CP000738|pid:none) Sinorhizobium medicae WSM419, c... 159 3e-37
(P11959) RecName: Full=Dihydrolipoyl dehydrogenase; EC=... 87 3e-37
CP000613_111(CP000613|pid:none) Rhodospirillum centenum SW, comp... 85 4e-37
AP006627_2409(AP006627|pid:none) Bacillus clausii KSM-K16 DNA, c... 84 4e-37
CP001177_2649(CP001177|pid:none) Bacillus cereus AH187, complete... 87 4e-37
(P0A0E4) RecName: Full=Mercuric reductase; EC=1.16.1.1;... 77 5e-37
(Q9I3D1) RecName: Full=Dihydrolipoamide dehydrogenase; ... 95 5e-37
(P14218) RecName: Full=Dihydrolipoyl dehydrogenase; EC=... 95 5e-37
CP000804_2050(CP000804|pid:none) Roseiflexus castenholzii DSM 13... 84 5e-37
CP000959_682(CP000959|pid:none) Burkholderia cenocepacia MC0-3 c... 88 5e-37
CP000896_1260(CP000896|pid:none) Acholeplasma laidlawii PG-8A, c... 77 5e-37
FM178379_2622(FM178379|pid:none) Aliivibrio salmonicida LFI1238 ... 91 7e-37
CP000557_916(CP000557|pid:none) Geobacillus thermodenitrificans ... 88 7e-37
CP000612_596(CP000612|pid:none) Desulfotomaculum reducens MI-1, ... 95 7e-37
CP000880_2732(CP000880|pid:none) Salmonella enterica subsp. ariz... 89 9e-37
AE017355_2502(AE017355|pid:none) Bacillus thuringiensis serovar ... 76 9e-37
AM039952_3777(AM039952|pid:none) Xanthomonas campestris pv. vesi... 89 1e-36
CP000697_2784(CP000697|pid:none) Acidiphilium cryptum JF-5, comp... 83 1e-36
AE017220_153(AE017220|pid:none) Salmonella enterica subsp. enter... 89 1e-36
CP000026_152(CP000026|pid:none) Salmonella enterica subsp. enter... 89 1e-36
CP000886_190(CP000886|pid:none) Salmonella enterica subsp. enter... 89 1e-36
CP000686_2924(CP000686|pid:none) Roseiflexus sp. RS-1, complete ... 81 1e-36
(Q9Z773) RecName: Full=Dihydrolipoyl dehydrogenase; EC=... 85 1e-36
AE009440_858(AE009440|pid:none) Chlamydophila pneumoniae TW-183,... 85 1e-36
CP001193_215(CP001193|pid:none) Rhizobium leguminosarum bv. trif... 97 2e-36
CP000449_970(CP000449|pid:none) Maricaulis maris MCS10, complete... 156 2e-36
CP000472_4531(CP000472|pid:none) Shewanella piezotolerans WP3, c... 87 2e-36
AP009484_715(AP009484|pid:none) Macrococcus caseolyticus JCSC540... 89 2e-36
CP000822_3161(CP000822|pid:none) Citrobacter koseri ATCC BAA-895... 89 3e-36
BA000043_1061(BA000043|pid:none) Geobacillus kaustophilus HTA426... 87 3e-36
AE015929_794(AE015929|pid:none) Staphylococcus epidermidis ATCC ... 83 3e-36
CP000360_840(CP000360|pid:none) Acidobacteria bacterium Ellin345... 84 3e-36
AE008691_1558(AE008691|pid:none) Thermoanaerobacter tengcongensi... 83 3e-36
AK151697_1(AK151697|pid:none) Mus musculus bone marrow macrophag... 155 3e-36
AP006725_842(AP006725|pid:none) Klebsiella pneumoniae NTUH-K2044... 89 3e-36
CP000647_119(CP000647|pid:none) Klebsiella pneumoniae subsp. pne... 89 3e-36
CP001601_254(CP001601|pid:none) Corynebacterium aurimucosum ATCC... 98 3e-36
BX908798_151(BX908798|pid:none) Parachlamydia-related symbiont U... 90 4e-36
AE017333_795(AE017333|pid:none) Bacillus licheniformis DSM 13, c... 83 4e-36
AE015451_4134(AE015451|pid:none) Pseudomonas putida KT2440 compl... 97 6e-36
CP000383_1069(CP000383|pid:none) Cytophaga hutchinsonii ATCC 334... 79 6e-36
CP000724_1217(CP000724|pid:none) Alkaliphilus metalliredigens QY... 72 6e-36
CP001503_3151(CP001503|pid:none) Burkholderia glumae BGR1 chromo... 154 6e-36
CP000680_2482(CP000680|pid:none) Pseudomonas mendocina ymp, comp... 93 7e-36
EU616551_1(EU616551|pid:none) Capsicum annuum putative branched-... 87 9e-36
CP001100_2159(CP001100|pid:none) Chloroherpeton thalassium ATCC ... 89 9e-36
CP000606_3422(CP000606|pid:none) Shewanella loihica PV-4, comple... 87 9e-36
CP000507_376(CP000507|pid:none) Shewanella amazonensis SB2B, com... 87 9e-36
AF542182_1(AF542182|pid:none) Lycopersicon esculentum dihydrolip... 89 1e-35
(P31023) RecName: Full=Dihydrolipoyl dehydrogenase, mitochondria... 84 1e-35
AE016795_1506(AE016795|pid:none) Vibrio vulnificus CMCP6 chromos... 85 1e-35
CU468135_816(CU468135|pid:none) Erwinia tasmaniensis strain ET1/... 88 1e-35
BX248583_144(BX248583|pid:none) Blochmannia floridanus complete ... 101 1e-35
CP001389_1660(CP001389|pid:none) Rhizobium sp. NGR234, complete ... 153 1e-35
AF074940_1(AF074940|pid:none) Glycine max ferric leghemoglobin r... 83 2e-35
CP000949_3487(CP000949|pid:none) Pseudomonas putida W619, comple... 96 2e-35
CP000034_141(CP000034|pid:none) Shigella dysenteriae Sd197, comp... 88 2e-35
CU234118_3862(CU234118|pid:none) Bradyrhizobium sp. ORS278,compl... 87 2e-35
FP236842_793(FP236842|pid:none) Erwinia pyrifoliae strain Ep1/96... 89 2e-35
CP000266_103(CP000266|pid:none) Shigella flexneri 5 str. 8401, c... 87 2e-35
(P0A9P0) RecName: Full=Dihydrolipoyl dehydrogenase; EC=... 87 2e-35
AP008955_3295(AP008955|pid:none) Brevibacillus brevis NBRC 10059... 90 2e-35
AF047034_1(AF047034|pid:none) Streptomyces seoulensis dihydrolip... 92 2e-35
CP001338_638(CP001338|pid:none) Candidatus Methanosphaerula palu... 82 2e-35
CP000946_3469(CP000946|pid:none) Escherichia coli ATCC 8739, com... 87 3e-35
AP009152_1502(AP009152|pid:none) Kocuria rhizophila DC2201 DNA, ... 78 3e-35
AE017262_1063(AE017262|pid:none) Listeria monocytogenes str. 4b ... 91 3e-35
CP001601_1537(CP001601|pid:none) Corynebacterium aurimucosum ATC... 89 3e-35
CP000076_1694(CP000076|pid:none) Pseudomonas fluorescens Pf-5, c... 96 5e-35
CP000926_3732(CP000926|pid:none) Pseudomonas putida GB-1, comple... 94 5e-35
CR378673_131(CR378673|pid:none) Photobacterium profundum SS9; se... 86 5e-35
CP000753_3881(CP000753|pid:none) Shewanella baltica OS185, compl... 91 5e-35
T14394(T14394)glutathione-disulfide reductase (EC 1.8.1.7) - tur... 151 5e-35
CP000909_2783(CP000909|pid:none) Chloroflexus aurantiacus J-10-f... 76 6e-35
AM295250_717(AM295250|pid:none) Staphylococcus carnosus subsp. c... 80 6e-35
(O84561) RecName: Full=Dihydrolipoyl dehydrogenase; EC=... 80 6e-35
CP001026_441(CP001026|pid:none) Burkholderia ambifaria MC40-6 ch... 83 6e-35
CP001472_1173(CP001472|pid:none) Acidobacterium capsulatum ATCC ... 84 6e-35
CP000094_1615(CP000094|pid:none) Pseudomonas fluorescens Pf0-1, ... 95 8e-35
CP000155_842(CP000155|pid:none) Hahella chejuensis KCTC 2396, co... 85 8e-35
GQ121130_1(GQ121130|pid:none) Vibrio tubiashii dihydrolipoamide ... 83 8e-35
CP000560_1360(CP000560|pid:none) Bacillus amyloliquefaciens FZB4... 95 8e-35
CP000449_1421(CP000449|pid:none) Maricaulis maris MCS10, complet... 90 8e-35
CP000853_2113(CP000853|pid:none) Alkaliphilus oremlandii OhILAs,... 84 8e-35
AM180355_743(AM180355|pid:none) Clostridium difficile 630 comple... 71 8e-35
CP000891_4030(CP000891|pid:none) Shewanella baltica OS195, compl... 91 1e-34
CP000463_2595(CP000463|pid:none) Rhodopseudomonas palustris BisA... 85 1e-34
AG1206(AG1206) dihydrolipoamide dehydrogenase, E3 chain of pyruv... 89 1e-34
AF166126_1(AF166126|pid:none) Homo sapiens selenoprotein Zf1 mRN... 147 1e-34
CP000644_383(CP000644|pid:none) Aeromonas salmonicida subsp. sal... 80 1e-34
CP001472_2720(CP001472|pid:none) Acidobacterium capsulatum ATCC ... 91 1e-34
CP001337_1085(CP001337|pid:none) Chloroflexus aggregans DSM 9485... 74 1e-34
Y09906_5(Y09906|pid:none) Bacillus macroides ORF2, ORF3, ORF4, m... 73 2e-34
CP000024_1006(CP000024|pid:none) Streptococcus thermophilus CNRZ... 89 2e-34
EF148436_1(EF148436|pid:none) Populus trichocarpa x Populus delt... 84 2e-34
AL939111_216(AL939111|pid:none) Streptomyces coelicolor A3(2) co... 88 2e-34
CP000250_2756(CP000250|pid:none) Rhodopseudomonas palustris HaA2... 83 2e-34
AK168356_1(AK168356|pid:none) Mus musculus CRL-1722 L5178Y-R cDN... 149 2e-34
AB027565_1(AB027565|pid:none) Mus musculus TXNRD1 mRNA for thior... 149 2e-34
AE009442_1736(AE009442|pid:none) Xylella fastidiosa Temecula1, c... 89 2e-34
CU695238_105(CU695238|pid:none) Ralstonia solanacearum strain Mo... 89 2e-34
CP000447_3740(CP000447|pid:none) Shewanella frigidimarina NCIMB ... 87 2e-34
AE014299_421(AE014299|pid:none) Shewanella oneidensis MR-1, comp... 86 2e-34
CP000319_1665(CP000319|pid:none) Nitrobacter hamburgensis X14, c... 84 2e-34
CP000462_3718(CP000462|pid:none) Aeromonas hydrophila subsp. hyd... 82 2e-34
CP000501_129(CP000501|pid:none) Pichia stipitis CBS 6054 chromos... 79 2e-34
(P0A0E6) RecName: Full=Dihydrolipoyl dehydrogenase; EC=... 82 2e-34
BA000035_1894(BA000035|pid:none) Corynebacterium efficiens YS-31... 81 2e-34
>(Q8T137) RecName: Full=Glutathione reductase; Short=GRase;
Short=GR; EC=1.8.1.7;
&AC117075_10(AC117075|pid:none)
Length = 465
Score = 417 bits (1071), Expect(3) = 0.0
Identities = 203/204 (99%), Positives = 204/204 (100%)
Frame = +3
Query: 846 GVKLPPVECVIWAIGRVPNTDDLGIDKAGIQLTEQSGFIKVDEFQNTNVPGVHAVGDICG 1025
GVKLPPVECVIWAIGRVPNTDDLGIDKAGIQLTEQSGFIKVDEFQNTNVPGVHAVGDICG
Sbjct: 262 GVKLPPVECVIWAIGRVPNTDDLGIDKAGIQLTEQSGFIKVDEFQNTNVPGVHAVGDICG 321
Query: 1026 NFLLTPVAIAAGRRLSERLFNGKSDLKFEYENVATVVFSHPPIGTVGLTEQEAITKYGTE 1205
NFLLTPVAIAAGRRLSERLFNGKSDLKFEYENVATVVFSHPPIGTVGLTEQEAITKYGTE
Sbjct: 322 NFLLTPVAIAAGRRLSERLFNGKSDLKFEYENVATVVFSHPPIGTVGLTEQEAITKYGTE 381
Query: 1206 NIKCYNTSFINMFYSVQVHKVRTSMKLVCLGKEEKVIGLHIIGDGCDEMIQGFAVAVKMG 1385
NIKCYNTSFINMFYSVQVHKVRTSMKLVCLGKEEKVIGLHIIGDGCDE+IQGFAVAVKMG
Sbjct: 382 NIKCYNTSFINMFYSVQVHKVRTSMKLVCLGKEEKVIGLHIIGDGCDEIIQGFAVAVKMG 441
Query: 1386 CTKWDLDNTCAIHPTSAEELVTMV 1457
CTKWDLDNTCAIHPTSAEELVTMV
Sbjct: 442 CTKWDLDNTCAIHPTSAEELVTMV 465
Score = 327 bits (839), Expect(3) = 0.0
Identities = 159/173 (91%), Positives = 159/173 (91%)
Frame = +1
Query: 61 MSSTNHFTYLVLXXXXXXXXXXXXXXKHLNAKGNGDRIGIVEVTRPGGTCVNVGCVPKKV 240
MSSTNHFTYLVL KHLNAKGNGDRIGIVEVTRPGGTCVNVGCVPKKV
Sbjct: 1 MSSTNHFTYLVLGAGSGGIASARRAAKHLNAKGNGDRIGIVEVTRPGGTCVNVGCVPKKV 60
Query: 241 MWNTSFIKEMINAAPSYGFDFGGQQVKFNWPTIKKARDEYIKRLNGIYDSNLAKDNIVRI 420
MWNTSFIKEMINAAPSYGFDFGGQQVKFNWPTIKKARDEYIKRLNGIYDSNLAKDNIVRI
Sbjct: 61 MWNTSFIKEMINAAPSYGFDFGGQQVKFNWPTIKKARDEYIKRLNGIYDSNLAKDNIVRI 120
Query: 421 NGYGRFSGPKEIQVNGANGEKYTADHILIAAGGRPTVPDVPGKELGITSDGFF 579
NGYGRFSGPKEIQVNGANGEKYTADHILIAAGGRPTVPDVPGKELGITSDGFF
Sbjct: 121 NGYGRFSGPKEIQVNGANGEKYTADHILIAAGGRPTVPDVPGKELGITSDGFF 173
Score = 177 bits (449), Expect(3) = 0.0
Identities = 91/93 (97%), Positives = 92/93 (98%)
Frame = +2
Query: 578 FELEDLPKSTLVVGAGYIAVELAGVLHSLGSETTMVIRQKQFLRTFDEMLHTTLLKQMTD 757
FELEDLPKSTLVVGAGYIAVELAGVLHSLGSETTMVIRQKQFLRTFDEMLHTTLLKQMTD
Sbjct: 173 FELEDLPKSTLVVGAGYIAVELAGVLHSLGSETTMVIRQKQFLRTFDEMLHTTLLKQMTD 232
Query: 758 DGVKFVTEASIKSLERDVDGKRIIATTNAGCKI 856
DGVKFVTEASIKSLERDVDGKRIIATTNAG K+
Sbjct: 233 DGVKFVTEASIKSLERDVDGKRIIATTNAGVKL 265
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3236559
Number of Hits to DB: 2,547,387,660
Number of extensions: 54977370
Number of successful extensions: 166021
Number of sequences better than 10.0: 2606
Number of HSP's gapped: 161470
Number of HSP's successfully gapped: 6338
Length of query: 516
Length of database: 1,051,180,864
Length adjustment: 133
Effective length of query: 383
Effective length of database: 620,718,517
Effective search space: 237735192011
Effective search space used: 237735192011
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 32 (16.9 bits)
|
| PSORT |
|
| VS (DIR, S) |
1 |
| VH (FL, L) |
0 |
| VF (FL, S) |
15 |
| AH (FL, L) |
0 |
| AF (FL, S) |
9 |
| SL (DIR, L) |
1 |
| SS (DIR, S) |
1 |
| SH (FL, L) |
0 |
| SF (FL, S) |
1 |
| CH (FL, L) |
1 |
| CF (FL, S) |
1 |
| FCL (DIR, L) |
0 |
| FC (DIR, S) |
0 |
| FC-IC (SUB) |
0 |