Contig-U13707-1 |
Contig ID |
Contig-U13707-1 |
Contig update |
2002.12.18 |
Contig sequence |
|
Gap |
no gap |
Contig length |
567 |
Chromosome number (1..6, M) |
2 |
Chromosome length |
8467578 |
Start point |
444645 |
End point |
444088 |
Strand (PLUS/MINUS) |
MINUS |
Number of clones |
1 |
Number of EST |
1 |
Link to clone list |
U13707 |
List of clone(s) |
|
Translated Amino Acid sequence |
|
Translated Amino Acid sequence (All Frames) |
|
own update |
2004. 6.10 |
Homology vs CSM-cDNA |
|
dna update |
2008.12.13 |
Homology vs DNA |
Query= Contig-U13707-1 (Contig-U13707-1Q) /CSM_Contig/Contig-U13707-1Q.Seq.d (567 letters)
Database: ddbj_A 92,845,959 sequences; 95,242,211,685 total letters
Searching..................................................done
Score E Sequences producing significant alignments: (bits) Value N
(BJ423823) Dictyostelium discoideum cDNA clone:ddv50d16, 5' ... 747 0.0 2 (AC116982) Dictyostelium discoideum chromosome 2 map 3622643... 650 0.0 3 (AC168218) Mus musculus BAC clone RP24-236K20 from chromosom... 50 0.087 1 (AZ349192) 1M0086P04F Mouse 10kb plasmid UUGC1M library Mus ... 50 0.087 1 (ER524131) 1093015615105 Global-Ocean-Sampling_GS-35-01-01-1... 50 0.087 1 (CU138564) Pig DNA sequence *** SEQUENCING IN PROGRESS *** f... 46 0.13 4 (AC114263) Dictyostelium discoideum chromosome 2 map 215673-... 48 0.20 8 (AM440526) Vitis vinifera contig VV78X101109.2, whole genome... 32 0.25 4 (AC181049) Strongylocentrotus purpuratus clone R3-3050K15, W... 48 0.34 1 (AG600107) Mus musculus molossinus DNA, clone:MSMg01-531M16.... 48 0.34 1 (CG687290) ZMMBBc0164B24f ZMMBBc (EcoRI) Zea mays subsp. may... 48 0.34 1 (FC816055) Sr_pAMT7_04p18_T7 S. ratti mixed stage pAMP Stron... 48 0.34 1 (FC810621) Sr_pASP6_04p18_SP6 S. ratti mixed stage pAMP Stro... 48 0.34 1 (FC809529) Sr_pASP6_01f02_SP6 S. ratti mixed stage pAMP Stro... 48 0.34 1 (FC809516) Sr_pASP6_01e11_SP6 S. ratti mixed stage pAMP Stro... 48 0.34 1 (FC809468) Sr_pASP6_01c04_SP6 S. ratti mixed stage pAMP Stro... 48 0.34 1 (AC116924) Dictyostelium discoideum chromosome 2 map 6357117... 40 0.35 5 (AC131485) Lytechinus variegatus clone Lv183H12, *** SEQUENC... 36 0.38 5 (CP000084) Candidatus Pelagibacter ubique HTCC1062, complete... 36 0.45 15 (AY352277) Apis mellifera complementary sex determiner (csd)... 38 0.48 3 (AC117072) Dictyostelium discoideum chromosome 2 map 3879572... 36 0.68 8 (EK381605) 1095469464050 Global-Ocean-Sampling_GS-31-01-01-1... 42 0.69 2 (EK402447) 1095469545663 Global-Ocean-Sampling_GS-31-01-01-1... 44 0.70 2 (ER597316) 1093016227054 Global-Ocean-Sampling_GS-36-01-01-2... 38 0.75 2 (EK256051) 1095462011186 Global-Ocean-Sampling_GS-31-01-01-1... 34 0.79 3 (AE017245) Mycoplasma synoviae 53, complete genome. 36 0.81 10 (EU233858) Chilobrachys jingzhao cystine knot toxin (JZTX-49... 32 0.97 2 (AC214212) Populus trichocarpa clone POP019-D08, complete se... 38 1.0 3 (AC116984) Dictyostelium discoideum chromosome 2 map 2567470... 30 1.2 13 (AC153020) Mus musculus BAC clone RP23-88P1 from chromosome ... 46 1.4 1 (AC139381) Mus musculus BAC clone RP23-171D1 from 13, comple... 46 1.4 1 (AM487835) Vitis vinifera, whole genome shotgun sequence, co... 46 1.4 1 (AC181309) Strongylocentrotus purpuratus clone R3-4017H24, W... 46 1.4 1 (ER606190) 1093016277854 Global-Ocean-Sampling_GS-36-01-01-2... 46 1.4 1 (EK367424) 1095469403394 Global-Ocean-Sampling_GS-31-01-01-1... 46 1.4 1 (CD567238) tab50a03.x1 Hydra EST -III Hydra magnipapillata c... 46 1.4 1 (AE001437) Clostridium acetobutylicum ATCC 824, complete gen... 46 1.4 1 (AC219214) Solanum lycopersicum chromosome 6 clone C06HBa015... 38 1.4 3 (CP000576) Prochlorococcus marinus str. MIT 9301, complete g... 34 1.5 15 (AC116957) Dictyostelium discoideum chromosome 2 map 1685067... 32 1.5 11 (AM473345) Vitis vinifera, whole genome shotgun sequence, co... 44 1.5 4 (AC217577) Zea mays chromosome 9 clone CH201-289L13; ZMMBBc0... 42 1.8 2 (D31785) Pichia canadensis mitochondrial genomic DNA, comple... 36 1.8 4 (AX344552) Sequence 3 from Patent WO0200932. 36 1.8 8 (CP000551) Prochlorococcus marinus str. AS9601, complete gen... 34 1.9 13 (CS374669) Sequence 772 from Patent WO2006034879. 38 1.9 3 (CS374397) Sequence 500 from Patent WO2006034879. 38 1.9 3 (AC116305) Dictyostelium discoideum chromosome 2 map 1005175... 36 2.4 13 (EK176392) 1095458099443 Global-Ocean-Sampling_GS-31-01-01-1... 40 2.5 2 (FH538415) CHO_OF4770xc20r1.ab1 CHO_OF4 Nicotiana tabacum ge... 36 2.5 3 (FH384325) CHO_OF4747xf04r1.ab1 CHO_OF4 Nicotiana tabacum ge... 36 2.6 3 (AF067844) Homo sapiens chromosome 10 clone PTEN, complete s... 34 2.6 2 (AC219410) Bos taurus clone CH240-339I18, WORKING DRAFT SEQU... 32 2.6 2 (AC063965) Homo sapiens chromosome 10 clone RP11-380G5, comp... 34 2.6 2 (AC231049) Bos taurus clone CH240-492D20, WORKING DRAFT SEQU... 32 2.6 2 (AC207216) Pongo abelii BAC clone CH276-180A1 from chromosom... 32 2.6 2 (AE014841) Plasmodium falciparum 3D7 chromosome 11 section 6... 42 2.8 8 (AC096179) Rattus norvegicus clone CH230-50G12, WORKING DRAF... 42 3.0 5 (DQ366717) Uncultured Prochlorococcus marinus clone ASNC3046... 36 3.1 3 (EC820494) SME00005206 esmbsro2 Sawyeria marylandensis cDNA,... 30 3.3 3 (AC068308) Homo sapiens 3 BAC RP11-275H4 (Roswell Park Cance... 44 3.5 3 (EJ860051) 1093017970283 Global-Ocean-Sampling_GS-30-02-01-1... 32 3.5 2 (EJ479002) 1095403458519 Global-Ocean-Sampling_GS-28-01-01-1... 34 3.5 2 (ED169802) AUAC-aap83f02.b1 Ascaris suum whole genome shotgu... 34 3.5 2 (EJ983502) 1093022170350 Global-Ocean-Sampling_GS-30-02-01-1... 32 3.6 2 (EI794983) CHORI518023F15TR BAC library from the breast cell... 34 3.6 2 (AC126784) Medicago truncatula chromosome 8 clone mth2-36b12... 38 3.6 5 (EC821101) SME00007235 esmbsro2 Sawyeria marylandensis cDNA,... 30 3.9 3 (AC125473) Medicago truncatula clone mth2-8j13, complete seq... 38 4.2 4 (AC115607) Dictyostelium discoideum chromosome 2 map 4559693... 38 4.3 4 (CT573691) Zebrafish DNA sequence *** SEQUENCING IN PROGRESS... 44 4.5 4 (EC821719) SME00004818 esmbsro2 Sawyeria marylandensis cDNA,... 30 4.5 3 (EC822020) SME00005467 esmbsro2 Sawyeria marylandensis cDNA,... 30 4.9 3 (AL669929) Mouse DNA sequence from clone RP23-197J15 on chro... 34 4.9 5 (AM474948) Vitis vinifera, whole genome shotgun sequence, co... 42 5.1 4 (AC126014) Medicago truncatula clone mth2-18j5, complete seq... 38 5.2 4 (AC011235) Homo sapiens BAC clone RP11-295A19 from 2, comple... 42 5.2 4 (BX890540) Zebrafish DNA sequence from clone DKEY-211C3 in l... 44 5.4 1 (BX005166) Zebrafish DNA sequence from clone CH211-137K18 in... 44 5.4 1 (AP007241) Anguilla interioris mitochondrial DNA, complete g... 44 5.4 1 (AP007237) Anguilla bicolor pacifica mitochondrial DNA, comp... 44 5.4 1 (AP007236) Anguilla bicolor bicolor mitochondrial DNA, compl... 44 5.4 1 (AC166142) Xenopus tropicalis clone CH216-61H19, complete se... 44 5.4 1 (AC145802) Xenopus tropicalis clone CH216-80C17, complete se... 44 5.4 1 (AC122807) Mus musculus BAC clone RP23-297H3 from 8, complet... 44 5.4 1 (X83987) B.madagascariensis chloroplast rbcL gene, promoter ... 44 5.4 1 (EF523514) Puccinia psidii clone 208_M13R-H11 microsatellite... 44 5.4 1 (EF523506) Puccinia psidii clone 080_M13R-H07 microsatellite... 44 5.4 1 (EF523502) Puccinia psidii clone ShaoR14 microsatellite sequ... 44 5.4 1 (AC223438) Oryza brachyantha, complete sequence. 44 5.4 1 (AC144538) Medicago truncatula clone mth2-31l21, complete se... 44 5.4 1 (AC005623) Arabidopsis thaliana chromosome 2 clone T20P8 map... 44 5.4 1 (AE014296) Drosophila melanogaster chromosome 3L, complete s... 44 5.4 1 (AC010565) Drosophila melanogaster 3L BAC RP98-19A3 (Roswell... 44 5.4 1 (AC093610) Homo sapiens BAC clone RP11-725F23 from 2, comple... 44 5.4 1 (AC162748) Loxodonta africana clone VMRC15-411B16, WORKING D... 44 5.4 1 (AC162196) Bos taurus clone CH240-117E15, WORKING DRAFT SEQU... 44 5.4 1 (AC161730) Loxodonta africana clone VMRC15-481O14, WORKING D... 44 5.4 1 (AC127821) Rattus norvegicus clone CH230-263L15, WORKING DRA... 44 5.4 1 (AC119668) Rattus norvegicus clone CH230-56J3, *** SEQUENCIN... 44 5.4 1
>(BJ423823) Dictyostelium discoideum cDNA clone:ddv50d16, 5' end, single read. Length = 558
Score = 747 bits (377), Expect(2) = 0.0 Identities = 377/377 (100%) Strand = Plus / Plus
Query: 181 cgttggtcagaatctaaaagaatttatttaaaatgtccaccatcagcaatggatgttaat 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 181 cgttggtcagaatctaaaagaatttatttaaaatgtccaccatcagcaatggatgttaat 240
Query: 241 cctgaaaagaaatttaaattttcaatttcaattttacataaagagaataaagatttattt 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 241 cctgaaaagaaatttaaattttcaatttcaattttacataaagagaataaagatttattt 300
Query: 301 gaatcattatcattacatatgttatcaaatttattattaagaggatcaaatacaccaatg 360 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 301 gaatcattatcattacatatgttatcaaatttattattaagaggatcaaatacaccaatg 360
Query: 361 tatcaagcattattagagagtggattagttttagattattcaccaaatacaggtttcgat 420 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 361 tatcaagcattattagagagtggattagttttagattattcaccaaatacaggtttcgat 420
Query: 421 gatggtttattagaatcaagttttagtgttggtggtattggtattaaaaaagaggattta 480 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 421 gatggtttattagaatcaagttttagtgttggtggtattggtattaaaaaagaggattta 480
Query: 481 gaaaaagttgaaaaagtaatcatagagacattggagaaatcatcacgtgatgggttcgct 540 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 481 gaaaaagttgaaaaagtaatcatagagacattggagaaatcatcacgtgatgggttcgct 540
Query: 541 tcagatgtgattgaatc 557 ||||||||||||||||| Sbjct: 541 tcagatgtgattgaatc 557
Score = 157 bits (79), Expect(2) = 0.0 Identities = 79/79 (100%) Strand = Plus / Plus
Query: 1 tcattaacttaccaacaattaaaagattttcattcaaatcattatcatccttcaaattct 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 1 tcattaacttaccaacaattaaaagattttcattcaaatcattatcatccttcaaattct 60
Query: 61 tatttcttttcctatggtg 79 ||||||||||||||||||| Sbjct: 61 tatttcttttcctatggtg 79
Lambda K H 1.37 0.711 1.31
Matrix: blastn matrix:1 -3 Number of Sequences: 92845959 Number of Hits to DB: 671,386,063 Number of extensions: 44475535 Number of successful extensions: 4133519 Number of sequences better than 10.0: 202 Length of query: 567 Length of database: 95,242,211,685 Length adjustment: 23 Effective length of query: 544 Effective length of database: 93,106,754,628 Effective search space: 50650074517632 Effective search space used: 50650074517632 X1: 11 (21.8 bits) S2: 22 (44.1 bits)
|
protein update |
2009. 7. 8 |
Homology vs Protein |
Query= Contig-U13707-1 (Contig-U13707-1Q) /CSM_Contig/Contig-U13707-1Q.Seq.d (567 letters)
Database: nrp_B 3,236,559 sequences; 1,051,180,864 total letters
Searching..................................................done
Score E Sequences producing significant alignments: (bits) Value
AC116982_5(AC116982|pid:none) Dictyostelium discoideum chromosom... 288 5e-77 (Q28BR5) RecName: Full=Presequence protease, mitochondrial; ... 113 4e-24 BC154673_1(BC154673|pid:none) Xenopus tropicalis pitrilysin meta... 113 4e-24 AL451164_9(AL451164|pid:none) Human DNA sequence from clone RP11... 110 2e-23 (Q9BVJ5) RecName: Full=Presequence protease, mitochondrial; ... 110 3e-23 AK294865_1(AK294865|pid:none) Homo sapiens cDNA FLJ53321 complet... 110 3e-23 (Q5RDG3) RecName: Full=Presequence protease, mitochondrial; ... 110 3e-23 BC005025_1(BC005025|pid:none) Homo sapiens pitrilysin metallopep... 110 3e-23 AK141277_1(AK141277|pid:none) Mus musculus 7 days embryo whole b... 109 6e-23 AK164235_1(AK164235|pid:none) Mus musculus 9 days embryo whole b... 108 8e-23 AK129292_1(AK129292|pid:none) Mus musculus mRNA for mKIAA1104 pr... 108 8e-23 AY779273_1(AY779273|pid:none) Mus musculus strain LG/J pitrilysi... 108 8e-23 AY779274_1(AY779274|pid:none) Mus musculus strain SM/J pitrilysi... 108 8e-23 AK167426_1(AK167426|pid:none) Mus musculus 14 days pregnant adul... 108 8e-23 AF061243_1(AF061243|pid:none) Homo sapiens metalloprotease 1 (MP... 103 4e-21 (Q7S7C0) RecName: Full=Mitochondrial presequence protease; ... 99 6e-20 CP000859_2864(CP000859|pid:none) Desulfococcus oleovorans Hxd3, ... 99 1e-19 (Q6C0U8) RecName: Full=Mitochondrial presequence protease; ... 97 4e-19 AJ006754_1(AJ006754|pid:none) Yarrowia lipolytica URA5-SEC65 gen... 97 4e-19 GN099664_1(GN099664|pid:none) Sequence 4445 from Patent WO200903... 84 3e-15 CP000142_747(CP000142|pid:none) Pelobacter carbinolicus DSM 2380... 82 1e-14 CU329671_282(CU329671|pid:none) Schizosaccharomyces pombe chromo... 82 1e-14 AP000419_7(AP000419|pid:none) Arabidopsis thaliana genomic DNA, ... 81 2e-14 A96533(A96533)probable zinc metalloproteinase [imported] - Arabi... 79 9e-14 AC011807_14(AC011807|pid:none) Arabidopsis thaliana chromosome I... 79 1e-13 (Q8VY06) RecName: Full=Presequence protease 2, chloroplastic/mit... 79 1e-13 (Q2UGN1) RecName: Full=Mitochondrial presequence protease; ... 79 1e-13 (Q4WP38) RecName: Full=Mitochondrial presequence protease; ... 79 1e-13 CP001575_196(CP001575|pid:none) Micromonas sp. RCC299 chromosome... 75 9e-13 CP001322_3100(CP001322|pid:none) Desulfatibacillum alkenivorans ... 74 3e-12 GN099656_1(GN099656|pid:none) Sequence 4437 from Patent WO200903... 72 1e-11 CP000934_1605(CP000934|pid:none) Cellvibrio japonicus Ueda107, c... 72 1e-11 AM920428_745(AM920428|pid:none) Penicillium chrysogenum Wisconsi... 71 2e-11 AM270071_53(AM270071|pid:none) Aspergillus niger contig An04c010... 71 2e-11 FN357401_3(FN357401|pid:none) Schistosoma mansoni genome sequenc... 71 2e-11 (Q9V9E3) RecName: Full=Presequence protease, mitochondrial; ... 68 2e-10 AM457663_2(AM457663|pid:none) Vitis vinifera contig VV78X067479.... 67 3e-10 (Q6BTC0) RecName: Full=Mitochondrial presequence protease; ... 65 2e-09 CP000939_3308(CP000939|pid:none) Clostridium botulinum B1 str. O... 65 2e-09 CP000728_3287(CP000728|pid:none) Clostridium botulinum F str. La... 65 2e-09 CP001581_3514(CP001581|pid:none) Clostridium botulinum A2 str. K... 64 2e-09 CP000962_3292(CP000962|pid:none) Clostridium botulinum A3 str. L... 64 3e-09 CT005246_11(CT005246|pid:none) Leishmania major strain Friedlin,... 64 3e-09 CP000593_30(CP000593|pid:none) Ostreococcus lucimarinus CCE9901 ... 63 5e-09 AL110506_1(AL110506|pid:none) S.pombe chromosome II cosmid c577. 63 5e-09 CP000496_802(CP000496|pid:none) Pichia stipitis CBS 6054 chromos... 63 5e-09 CP001326_29(CP001326|pid:none) Micromonas sp. RCC299 chromosome ... 63 6e-09 AE017285_937(AE017285|pid:none) Desulfovibrio vulgaris subsp. vu... 60 3e-08 AE015927_693(AE015927|pid:none) Clostridium tetani E88, complete... 60 3e-08 CU928176_550(CU928176|pid:none) Zygosaccharomyces rouxii strain ... 60 3e-08 CP001114_585(CP001114|pid:none) Deinococcus deserti VCD115, comp... 60 5e-08 (Q6CWW6) RecName: Full=Mitochondrial presequence protease; ... 60 5e-08 AM180252_649(AM180252|pid:none) Lawsonia intracellularis PHE/MN1... 59 7e-08 CP000724_1634(CP000724|pid:none) Alkaliphilus metalliredigens QY... 58 2e-07 CP001358_339(CP001358|pid:none) Desulfovibrio desulfuricans subs... 58 2e-07 CP001614_1606(CP001614|pid:none) Teredinibacter turnerae T7901, ... 57 3e-07 CP000853_1909(CP000853|pid:none) Alkaliphilus oremlandii OhILAs,... 55 1e-06 (Q5A301) RecName: Full=Mitochondrial presequence protease; ... 55 2e-06 AP010904_4310(AP010904|pid:none) Desulfovibrio magneticus RS-1 D... 54 3e-06 CP000282_1853(CP000282|pid:none) Saccharophagus degradans 2-40, ... 54 4e-06 CP000127_1982(CP000127|pid:none) Nitrosococcus oceani ATCC 19707... 54 4e-06 CP000382_1808(CP000382|pid:none) Clostridium novyi NT, complete ... 53 7e-06 (Q6FUI7) RecName: Full=Mitochondrial presequence protease; ... 53 7e-06 CP000382_770(CP000382|pid:none) Clostridium novyi NT, complete g... 53 7e-06 AE000520_24(AE000520|pid:none) Treponema pallidum subsp. pallidu... 52 1e-05 AL451164_14(AL451164|pid:none) Human DNA sequence from clone RP1... 51 2e-05 CP000155_2027(CP000155|pid:none) Hahella chejuensis KCTC 2396, c... 51 2e-05 CP000246_1622(CP000246|pid:none) Clostridium perfringens ATCC 13... 50 3e-05 AE001437_2960(AE001437|pid:none) Clostridium acetobutylicum ATCC... 50 3e-05 (Q46205) RecName: Full=Protein hypA; &BA000016_1402(BA000016|pi... 50 3e-05 AM502225_39(AM502225|pid:none) Leishmania infantum chromosome 7. 50 4e-05 CP001107_1805(CP001107|pid:none) Eubacterium rectale ATCC 33656,... 49 7e-05 CP000724_1028(CP000724|pid:none) Alkaliphilus metalliredigens QY... 49 1e-04 (Q759T9) RecName: Full=Mitochondrial presequence protease; ... 48 2e-04 AM910993_100(AM910993|pid:none) Plasmodium knowlesi strain H chr... 47 5e-04 AP009049_394(AP009049|pid:none) Clostridium kluyveri NBRC 12016 ... 45 0.001 AP006861_233(AP006861|pid:none) Chlamydophila felis Fe/C-56 DNA,... 44 0.002 A97104(A97104) Zn-dependent metalloprotease, insulinase family [... 44 0.003 BX908798_1271(BX908798|pid:none) Parachlamydia-related symbiont ... 44 0.004 AP009049_631(AP009049|pid:none) Clostridium kluyveri NBRC 12016 ... 44 0.004 CU466930_33(CU466930|pid:none) Candidatus Cloacamonas acidaminov... 43 0.005 A72012(A72012;F81528) metalloproteinase, insulinase family CP087... 42 0.009 CR543861_1233(CR543861|pid:none) Acinetobacter sp. ADP1 complete... 42 0.012 CP000514_1859(CP000514|pid:none) Marinobacter aquaeolei VT8, com... 42 0.015 CP000323_2122(CP000323|pid:none) Psychrobacter cryohalolentis K5... 41 0.020 B86613(B86613) zinc metalloproteinase [imported] - Chlamydophila... 41 0.020 CP000521_2116(CP000521|pid:none) Acinetobacter baumannii ATCC 17... 40 0.044 CP000395_229(CP000395|pid:none) Borrelia afzelii PKo, complete g... 40 0.044 CU468230_1972(CU468230|pid:none) Acinetobacter baumannii str. SD... 40 0.044 CP001104_1307(CP001104|pid:none) Eubacterium eligens ATCC 27750,... 40 0.044 CP000863_2031(CP000863|pid:none) Acinetobacter baumannii ACICU, ... 40 0.044 CP001172_1492(CP001172|pid:none) Acinetobacter baumannii AB307-0... 40 0.044 AE002160_204(AE002160|pid:none) Chlamydia muridarum Nigg, comple... 40 0.057 CP000013_226(CP000013|pid:none) Borrelia garinii PBi, complete g... 40 0.057 AF404306_3(AF404306|pid:none) Rhizophydium sp. 136 mitochondrion... 39 0.13 CP000713_1823(CP000713|pid:none) Psychrobacter sp. PRwf-1, compl... 39 0.13 A71466(A71466) probable zinc metalloproteinase (insulinase famil... 38 0.17 AY811471_1(AY811471|pid:none) Schistosoma japonicum SJCHGC04038 ... 37 0.37 EF017300_1(EF017300|pid:none) Moraxella catarrhalis strain O35E ... 36 0.83 CP001205_217(CP001205|pid:none) Borrelia burgdorferi ZS7, comple... 35 1.4 FJ464558_1(FJ464558|pid:none) Solanum lycopersicum cultivar Crai... 32 9.0 AL035475_30(AL035475|pid:none) Plasmodium falciparum MAL4P2. &A... 32 9.0 FJ464560_1(FJ464560|pid:none) Solanum lycopersicum cultivar Mone... 32 9.0 FJ809919_1(FJ809919|pid:none) Solanum lycopersicum cultivar Peto... 32 9.0
>AC116982_5(AC116982|pid:none) Dictyostelium discoideum chromosome 2 map 3622643-3879522 strain AX4, complete sequence. Length = 1066
Score = 288 bits (738), Expect = 5e-77 Identities = 148/186 (79%), Positives = 148/186 (79%) Frame = +1
Query: 1 SLTYQQLKDFHSNHYHPSNSYFFSYGDLNPINHLKFIXXXXXXXXXXXXXXXXXXXXXXX 180 SLTYQQLKDFHSNHYHPSNSYFFSYGDLNPINHLKFI Sbjct: 296 SLTYQQLKDFHSNHYHPSNSYFFSYGDLNPINHLKFINDNSLSKFKNNSNNINTTVNKVK 355
Query: 181 RWSESKRIYLKCPPSAMDVNPEKKFKFSISILHKENKDLFEXXXXXXXXXXXXXXXNTPM 360 RWSESKRIYLKCPPSAMDVNPEKKFKFSISILHKENKDLFE NTPM Sbjct: 356 RWSESKRIYLKCPPSAMDVNPEKKFKFSISILHKENKDLFESLSLHMLSNLLLRGSNTPM 415
Query: 361 YQALLESGLVLDYSPNTGFDDGLLESSFSVGGIGIKKEDLEKVEKVIIETLEKSSRDGFA 540 YQALLESGLVLDYSPNTGFDDGLLESSFSVGGIGIKKEDLEKVEKVIIETLEKSSRDGFA Sbjct: 416 YQALLESGLVLDYSPNTGFDDGLLESSFSVGGIGIKKEDLEKVEKVIIETLEKSSRDGFA 475
Query: 541 SDVIES 558 SDVIES Sbjct: 476 SDVIES 481
Lambda K H 0.315 0.135 0.391
Gapped Lambda K H 0.267 0.0410 0.140
Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 3236559 Number of Hits to DB: 621,152,526 Number of extensions: 10013164 Number of successful extensions: 26768 Number of sequences better than 10.0: 104 Number of HSP's gapped: 26685 Number of HSP's successfully gapped: 124 Length of query: 189 Length of database: 1,051,180,864 Length adjustment: 121 Effective length of query: 68 Effective length of database: 659,557,225 Effective search space: 44849891300 Effective search space used: 44849891300 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.5 bits) S2: 30 (16.2 bits)
|
PSORT |
|
VS (DIR, S) |
0 |
VH (FL, L) |
1 |
VF (FL, S) |
0 |
AH (FL, L) |
0 |
AF (FL, S) |
0 |
SL (DIR, L) |
0 |
SS (DIR, S) |
0 |
SH (FL, L) |
0 |
SF (FL, S) |
0 |
CH (FL, L) |
0 |
CF (FL, S) |
0 |
FCL (DIR, L) |
0 |
FC (DIR, S) |
0 |
FC-IC (SUB) |
0 |