| Contig-U13537-1 |
| Contig ID |
Contig-U13537-1 |
| Contig update |
2002.12.18 |
| Contig sequence |
 |
| Gap |
no gap |
| Contig length |
1077 |
| Chromosome number (1..6, M) |
3 |
| Chromosome length |
6358359 |
| Start point |
3040820 |
| End point |
3041805 |
| Strand (PLUS/MINUS) |
PLUS |
| Number of clones |
20 |
| Number of EST |
24 |
| Link to clone list |
U13537 |
| List of clone(s) |
|
| Translated Amino Acid sequence |
|
| Translated Amino Acid sequence (All Frames) |
|
| own update |
2004. 6.10 |
| Homology vs CSM-cDNA |
|
| dna update |
2008.12.11 |
| Homology vs DNA |
Query= Contig-U13537-1 (Contig-U13537-1Q) /CSM_Contig/Contig-U13537-1Q.Seq.d
(1077 letters)
Database: ddbj_A
92,845,959 sequences; 95,242,211,685 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value N
(BJ418724) Dictyostelium discoideum cDNA clone:ddv33d20, 5' ... 1322 0.0 1
(BJ436818) Dictyostelium discoideum cDNA clone:ddv32g10, 3' ... 1193 0.0 2
(BJ437244) Dictyostelium discoideum cDNA clone:ddv33k18, 3' ... 1191 0.0 2
(BJ416480) Dictyostelium discoideum cDNA clone:ddv26f16, 5' ... 1134 0.0 1
(BJ437285) Dictyostelium discoideum cDNA clone:ddv33d20, 3' ... 1126 0.0 2
(BJ418685) Dictyostelium discoideum cDNA clone:ddv33k18, 5' ... 1126 0.0 2
(AU263493) Dictyostelium discoideum vegetative cDNA clone:VS... 1039 0.0 2
(C93004) Dictyostelium discoideum slug cDNA, clone SSF438. 1025 0.0 2
(C24627) Dictyostelium discoideum slug cDNA, clone SL-X025. 1007 0.0 2
(BJ435254) Dictyostelium discoideum cDNA clone:ddv26f16, 3' ... 991 0.0 2
(AU262670) Dictyostelium discoideum vegetative cDNA clone:VS... 783 0.0 2
(AU262455) Dictyostelium discoideum vegetative cDNA clone:VS... 769 0.0 2
(AU265334) Dictyostelium discoideum vegetative cDNA clone:VS... 690 0.0 3
(AU263070) Dictyostelium discoideum vegetative cDNA clone:VS... 704 0.0 2
(AU262492) Dictyostelium discoideum vegetative cDNA clone:VS... 704 0.0 2
(AU262778) Dictyostelium discoideum vegetative cDNA clone:VS... 696 0.0 2
(AU262654) Dictyostelium discoideum vegetative cDNA clone:VS... 680 0.0 2
(AU268248) Dictyostelium discoideum vegetative cDNA clone:VS... 462 0.0 2
(AU037821) Dictyostelium discoideum slug cDNA, clone SSE335. 460 0.0 2
(AU265333) Dictyostelium discoideum vegetative cDNA clone:VS... 615 e-171 1
(AU268247) Dictyostelium discoideum vegetative cDNA clone:VS... 591 e-164 1
(BJ421273) Dictyostelium discoideum cDNA clone:ddv42e01, 5' ... 581 e-161 1
(AU072930) Dictyostelium discoideum slug cDNA, clone SSF438. 476 e-130 1
(AU263494) Dictyostelium discoideum vegetative cDNA clone:VS... 323 e-111 3
(AU271062) Dictyostelium discoideum vegetative cDNA clone:VS... 254 6e-63 1
(AU271061) Dictyostelium discoideum vegetative cDNA clone:VS... 254 6e-63 1
(AU038591) Dictyostelium discoideum slug cDNA, clone SSL215. 184 1e-42 2
(AU072157) Dictyostelium discoideum slug cDNA, clone SSD543. 161 7e-35 1
(CU433028) Clytia hemisphaerica 5-PRIME EST from clone SA0AA... 52 3e-07 3
(CU425771) Clytia hemisphaerica 5-PRIME EST from clone SA0AA... 46 5e-06 2
(CU432305) Clytia hemisphaerica 5-PRIME EST from clone SA0AA... 46 5e-06 2
(BJ429003) Dictyostelium discoideum cDNA clone:ddv2d06, 3' e... 52 8e-06 3
(AU263490) Dictyostelium discoideum vegetative cDNA clone:VS... 52 1e-05 3
(CU425390) Clytia hemisphaerica 5-PRIME EST from clone SA0AA... 44 5e-05 3
(DT602387) she01-7ms3-d01 She01 Saruma henryi cDNA clone she... 60 2e-04 1
(DT595928) she01-18ms2-b01 She01 Saruma henryi cDNA clone sh... 60 2e-04 1
(CU424926) Clytia hemisphaerica 5-PRIME EST from clone SA0AA... 46 2e-04 2
(CU434964) Clytia hemisphaerica 5-PRIME EST from clone SA0AA... 52 3e-04 2
(CU433698) Clytia hemisphaerica 5-PRIME EST from clone SA0AA... 52 3e-04 2
(CU426866) Clytia hemisphaerica 5-PRIME EST from clone SA0AA... 46 3e-04 2
(CU434753) Clytia hemisphaerica 5-PRIME EST from clone SA0AA... 44 0.001 2
(CU430132) Clytia hemisphaerica 5-PRIME EST from clone SA0AA... 44 0.001 2
(CU430392) Clytia hemisphaerica 5-PRIME EST from clone SA0AA... 44 0.001 2
(CU428999) Clytia hemisphaerica 5-PRIME EST from clone SA0AA... 44 0.001 2
(CU432138) Clytia hemisphaerica 5-PRIME EST from clone SA0AA... 44 0.001 2
(EV171844) 0153091 Brassica napus Etiolated seedlings (Uni-Z... 54 0.001 2
(A65338) Sequence 61 from Patent WO9735983. 54 0.001 2
(AR150476) Sequence 61 from patent US 6228643. 54 0.001 2
(A65340) Sequence 63 from Patent WO9735983. 54 0.002 2
(AR150478) Sequence 63 from patent US 6228643. 54 0.002 2
(AR150486) Sequence 82 from patent US 6228643. 54 0.002 2
(AU265540) Dictyostelium discoideum vegetative cDNA clone:VS... 52 0.002 2
(AU263489) Dictyostelium discoideum vegetative cDNA clone:VS... 52 0.002 2
(BJ410833) Dictyostelium discoideum cDNA clone:ddv2d06, 5' e... 52 0.003 2
(BJ389156) Dictyostelium discoideum cDNA clone:dds17p14, 5' ... 42 0.009 2
(A65314) Sequence 37 from Patent WO9735983. 54 0.011 1
(AR150462) Sequence 37 from patent US 6228643. 54 0.011 1
(EE447657) 74ETGS48_UP_017_E07_28APR2005_055 74ETGS48 Brassi... 54 0.011 1
(EC825708) SME00002751 esmbsro2 Sawyeria marylandensis cDNA,... 54 0.011 1
(EC824292) SME00002727 esmbsro2 Sawyeria marylandensis cDNA,... 54 0.011 1
(EC823957) SME00004813 esmbsro2 Sawyeria marylandensis cDNA,... 54 0.011 1
(EC823537) SME00006646 esmbsro2 Sawyeria marylandensis cDNA,... 54 0.011 1
(EC820847) SME00004541 esmbsro2 Sawyeria marylandensis cDNA,... 54 0.011 1
(DY025440) 53COT2_T3_016_A04_03SEP2004_032 Brassica napus 36... 54 0.011 1
(EV184245) 0158858 Brassica napus Etiolated seedlings (pSPOR... 54 0.011 1
(EV183884) 0158259 Brassica napus Etiolated seedlings (pSPOR... 54 0.011 1
(EV183805) 0158155 Brassica napus Etiolated seedlings (pSPOR... 54 0.011 1
(EV180341) 0151701 Brassica napus Etiolated seedlings (pSPOR... 54 0.011 1
(EV180313) 0151645 Brassica napus Etiolated seedlings (pSPOR... 54 0.011 1
(EV175382) 0160751 Brassica napus Etiolated seedlings (Uni-Z... 54 0.011 1
(EV171867) 0153139 Brassica napus Etiolated seedlings (Uni-Z... 54 0.011 1
(CU431267) Clytia hemisphaerica 5-PRIME EST from clone SA0AA... 52 0.013 2
(CU431962) Clytia hemisphaerica 5-PRIME EST from clone SA0AA... 52 0.013 2
(CU432191) Clytia hemisphaerica 5-PRIME EST from clone SA0AA... 52 0.013 2
(CU428981) Clytia hemisphaerica 5-PRIME EST from clone SA0AA... 52 0.014 2
(BJ412538) Dictyostelium discoideum cDNA clone:ddv8p19, 5' e... 52 0.044 1
(EY049965) CATC2337.fwd CATC Artemisia annua, Tanzanian, fro... 52 0.044 1
(EY049964) CATC2337.rev CATC Artemisia annua, Tanzanian, fro... 52 0.044 1
(AR150488) Sequence 86 from patent US 6228643. 48 0.064 2
(A65339) Sequence 62 from Patent WO9735983. 48 0.081 2
(AR150477) Sequence 62 from patent US 6228643. 48 0.081 2
(BJ326507) Dictyostelium discoideum cDNA clone:dda16a22, 5' ... 40 0.12 2
(BJ363318) Dictyostelium discoideum cDNA clone:ddc26e05, 5' ... 40 0.12 2
(FG560225) BN18DYSC_UP_083_F05_4MAR2008_037 BN18DYSC Brassic... 46 0.15 2
(BJ393889) Dictyostelium discoideum cDNA clone:dds33b06, 5' ... 50 0.18 1
(BJ326392) Dictyostelium discoideum cDNA clone:dda16g08, 5' ... 50 0.18 1
(FD565947) RS1ET55JQ RS1(AR) Raphanus sativus var. oleiformi... 50 0.18 1
(EY931680) RS1DO85TF RS1(AR) Raphanus sativus var. oleiformi... 50 0.18 1
(EY927570) RS1DO85JQ RS1(AR) Raphanus sativus var. oleiformi... 50 0.18 1
(EX891856) RS1BX88JQ RS1(AR) Raphanus sativus var. oleiformi... 50 0.18 1
(EW736830) RS3AA13JQ RS3(RT) Raphanus sativus cDNA 3', mRNA ... 50 0.18 1
(EW732303) RS3AA13TF RS3(RT) Raphanus sativus cDNA 5', mRNA ... 50 0.18 1
(EV543546) RR3A223JQ RR3(NY) Raphanus raphanistrum subsp. ra... 50 0.18 1
(EK549394) 1095516109959 Global-Ocean-Sampling_GS-32-01-01-1... 44 0.20 2
(BG224657) kp49c02.y1 TBN95TM-SSFH Strongyloides stercoralis... 46 0.48 2
(DJ387378) Diagnosis of Diseases Associated with Apoptosis. 40 0.49 3
(AX345209) Sequence 280 from Patent WO0200928. 40 0.49 3
(AX281286) Sequence 28 from Patent WO0177164. 40 0.49 3
(A65315) Sequence 38 from Patent WO9735983. 48 0.69 1
(A65313) Sequence 36 from Patent WO9735983. 48 0.69 1
>(BJ418724) Dictyostelium discoideum cDNA clone:ddv33d20, 5' end,
single read.
Length = 671
Score = 1322 bits (667), Expect = 0.0
Identities = 670/671 (99%)
Strand = Plus / Plus
Query: 22 attatttttggaaaatgtcaaccaaatctattgttttatttgttttattagcagttgcaa 81
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1 attatttttggaaaatgtcaaccaaatctattgttttatttgttttattagcagttgcaa 60
Query: 82 ttgtctctggtgcacatcaatcatgtgttaagagagtaaatgcaccaacctcaattatta 141
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 61 ttgtctctggtgcacatcaatcatgtgttaagagagtaaatgcaccaacctcaattatta 120
Query: 142 aatcacaactcccaagtgaatatatcgatgaagatactttaccaactcaatatgattgga 201
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 121 aatcacaactcccaagtgaatatatcgatgaagatactttaccaactcaatatgattgga 180
Query: 202 gaaatatttcaggttcatcatacatcactattacccgtaatcaacatttaccacaatatt 261
|||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||
Sbjct: 181 gaaatatttcaggttcatcatacaccactattacccgtaatcaacatttaccacaatatt 240
Query: 262 gcggtagttgttgggctcatggtaccacatcagctttaggtgatcgtattaaaatcggtc 321
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 241 gcggtagttgttgggctcatggtaccacatcagctttaggtgatcgtattaaaatcggtc 300
Query: 322 gtaaaggtactttcccagaagttgttcttgccccacaagttttattaaactgtgctggtc 381
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 301 gtaaaggtactttcccagaagttgttcttgccccacaagttttattaaactgtgctggtc 360
Query: 382 cagataatacctgtgatggtggtgatccaactgaagcatacgcctatatggccgctaaag 441
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 361 cagataatacctgtgatggtggtgatccaactgaagcatacgcctatatggccgctaaag 420
Query: 442 gtatcactgatgaaacttgtgctccatatgaagcaattgataatgaatgtaatgctgaag 501
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 421 gtatcactgatgaaacttgtgctccatatgaagcaattgataatgaatgtaatgctgaag 480
Query: 502 gtatttgcaaaaactgtaactttgatttatcaaacccaactgctgattgtttcgctcaac 561
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 481 gtatttgcaaaaactgtaactttgatttatcaaacccaactgctgattgtttcgctcaac 540
Query: 562 caacttatactacttatttcgttgaagaacacggtcaagttaatggctcagttgctatga 621
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 541 caacttatactacttatttcgttgaagaacacggtcaagttaatggctcagttgctatga 600
Query: 622 tgcaagaaattttcgctcgtggtccaattgcctgtggtatggaagttactgatgcattcg 681
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 601 tgcaagaaattttcgctcgtggtccaattgcctgtggtatggaagttactgatgcattcg 660
Query: 682 aatcatacaca 692
|||||||||||
Sbjct: 661 aatcatacaca 671
Lambda K H
1.37 0.711 1.31
Matrix: blastn matrix:1 -3
Number of Sequences: 92845959
Number of Hits to DB: 959,132,175
Number of extensions: 54193937
Number of successful extensions: 4411255
Number of sequences better than 10.0: 178
Length of query: 1077
Length of database: 95,242,211,685
Length adjustment: 24
Effective length of query: 1053
Effective length of database: 97,308,875,965
Effective search space: 102466246391145
Effective search space used: 102466246391145
X1: 11 (21.8 bits)
S2: 22 (44.1 bits)
|
| protein update |
2009. 7. 7 |
| Homology vs Protein |
Query= Contig-U13537-1 (Contig-U13537-1Q) /CSM_Contig/Contig-U13537-1Q.Seq.d
(1077 letters)
Database: nrp_B
3,236,559 sequences; 1,051,180,864 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
CP001326_736(CP001326|pid:none) Micromonas sp. RCC299 chromosome... 195 4e-64
AY226449_1(AY226449|pid:none) Fundulus heteroclitus cathepsin Z ... 179 1e-51
U71150_1(U71150|pid:none) Onchocerca volvulus cysteine protease ... 167 2e-49
AY591516_1(AY591516|pid:none) Onchocerca volvulus cathepsin Z pr... 166 4e-49
AY533170_1(AY533170|pid:none) Brugia malayi cathepsin Z-like cys... 166 1e-48
AY890922_1(AY890922|pid:none) Synthetic construct Homo sapiens c... 172 2e-48
BT019915_1(BT019915|pid:none) Homo sapiens cathepsin Z mRNA, com... 172 2e-48
(Q9UBR2) RecName: Full=Cathepsin Z; EC=3.4.18.1; AltNam... 172 2e-48
AF032906_1(AF032906|pid:none) Homo sapiens cathepsin Z precursor... 172 2e-48
AF009923_1(AF009923|pid:none) Homo sapiens preprocathepsin P mRN... 172 2e-48
(P05689) RecName: Full=Cathepsin Z; EC=3.4.18.1; Flags:... 171 4e-48
AY593997_1(AY593997|pid:none) Oncorhynchus mykiss cathepsin Y (C... 172 4e-48
AY891244_1(AY891244|pid:none) Synthetic construct Homo sapiens c... 171 5e-48
T29872(T29872)hypothetical protein F32B5.8 - Caenorhabditis eleg... 164 6e-48
T23720(T23720) hypothetical protein M04G12.2 - Caenorhabditis el... 159 9e-47
BT072762_1(BT072762|pid:none) Salmo salar clone ssal-rgf-539-210... 167 1e-46
BT073433_1(BT073433|pid:none) Oncorhynchus mykiss clone omyk-evn... 165 4e-46
BC025419_1(BC025419|pid:none) Homo sapiens cathepsin Z, mRNA (cD... 172 7e-46
AY950579_1(AY950579|pid:none) Paralichthys olivaceus cathepsin Z... 162 4e-45
BT075594_1(BT075594|pid:none) Osmerus mordax clone omor-eva-517-... 177 4e-43
(Q9R1T3) RecName: Full=Cathepsin Z; EC=3.4.18.1; AltNam... 172 2e-41
BC072275_1(BC072275|pid:none) Xenopus laevis hypothetical protei... 170 7e-41
AF197479_1(AF197479|pid:none) Mus musculus strain C57BL/6 cathep... 170 7e-41
BC153697_1(BC153697|pid:none) Xenopus tropicalis hypothetical pr... 169 1e-40
BC090369_1(BC090369|pid:none) Xenopus tropicalis hypothetical LO... 169 1e-40
AF143817_1(AF143817|pid:none) Toxocara canis cathepsin Z1 prepro... 168 3e-40
BT082263_1(BT082263|pid:none) Anoplopoma fimbria clone afim-evh-... 167 4e-40
AY543005_1(AY543005|pid:none) Bigelowiella natans cathepsin Z mR... 138 7e-40
AY949988_1(AY949988|pid:none) Cyprinus carpio cathepsin Z (CTPZ)... 166 1e-39
U30877_1(U30877|pid:none) Urechis caupo cathepsin B-like proteas... 166 1e-39
BT072668_1(BT072668|pid:none) Salmo salar clone ssal-rgf-535-275... 166 1e-39
AY224078_1(AY224078|pid:none) Myxobolus cerebralis cathepsin Z-l... 128 2e-34
(O97578) RecName: Full=Dipeptidyl-peptidase 1; EC=3.4.1... 84 3e-25
AF525032_1(AF525032|pid:none) Homo sapiens cathepsin C mRNA, com... 75 3e-23
(Q5RB02) RecName: Full=Dipeptidyl-peptidase 1; EC=3.4.1... 75 4e-23
AY891248_1(AY891248|pid:none) Synthetic construct Homo sapiens c... 75 4e-23
(Q8WYA8) RecName: Full=Dipeptidyl-peptidase 1; EC=3.4.1... 75 4e-23
AK167882_1(AK167882|pid:none) Mus musculus CRL-1722 L5178Y-R cDN... 78 5e-23
AK151388_1(AK151388|pid:none) Mus musculus bone marrow macrophag... 78 5e-23
AK151861_1(AK151861|pid:none) Mus musculus bone marrow macrophag... 78 5e-23
(Q3ZCJ8) RecName: Full=Dipeptidyl-peptidase 1; EC=3.4.1... 74 7e-23
AK049406_1(AK049406|pid:none) Mus musculus 7 days embryo whole b... 78 7e-23
(P80067) RecName: Full=Dipeptidyl-peptidase 1; EC=3.4.1... 76 9e-23
EF472896_1(EF472896|pid:none) Oryctolagus cuniculus cathepsin Z ... 85 2e-22
AF234264_1(AF234264|pid:none) Homo sapiens clone CMM2 cathepsin ... 72 4e-22
CP000254_3036(CP000254|pid:none) Methanospirillum hungatei JF-1,... 77 1e-21
Z81531_11(Z81531|pid:none) Caenorhabditis elegans Cosmid F36D3, ... 69 2e-21
AB371612_1(AB371612|pid:none) Tuberaphis sumatrana catB mRNA for... 77 3e-21
AK340241_1(AK340241|pid:none) Acyrthosiphon pisum ACYPI000014 mR... 69 3e-21
EU877763_1(EU877763|pid:none) Trichobilharzia szidati cathepsin ... 73 6e-21
AB167466_1(AB167466|pid:none) Tuberaphis coreana catB mRNA for c... 73 2e-20
AB371614_1(AB371614|pid:none) Tuberaphis takenouchii catB mRNA f... 70 2e-20
U51892_1(U51892|pid:none) Ascaris suum cathepsin B-like cysteine... 64 3e-20
DQ164840_1(DQ164840|pid:none) Parelaphostrongylus tenuis catheps... 63 3e-20
Z69344_1(Z69344|pid:none) Haemonchus contortus mRNa for cysteine... 70 3e-20
EF682129_1(EF682129|pid:none) Trichobilharzia regenti cathepsin ... 70 4e-20
(P25807) RecName: Full=Gut-specific cysteine proteinase; ... 64 5e-20
EU128750_1(EU128750|pid:none) Ixodes ricinus cathepsin C precurs... 75 8e-20
AB117976_1(AB117976|pid:none) Tuberaphis styraci mRNA for cathep... 72 8e-20
AJ312106_1(AJ312106|pid:none) Schistosoma mansoni mRNA for cathe... 70 1e-19
AE013599_3562(AE013599|pid:none) Drosophila melanogaster chromos... 69 2e-19
AB371615_1(AB371615|pid:none) Astegopteryx styracophila catB mRN... 71 2e-19
AB371611_1(AB371611|pid:none) Tuberaphis taiwana catB mRNA for c... 70 2e-19
AB215097_1(AB215097|pid:none) Cyprinus carpio CTSB mRNA for cath... 64 2e-19
AB371616_1(AB371616|pid:none) Astegopteryx spinocephala catB mRN... 70 3e-19
EF428206_1(EF428206|pid:none) Ixodes ricinus cathepsin B-like cy... 66 4e-19
(P43510) RecName: Full=Cathepsin B-like cysteine proteinase 6; ... 61 9e-19
U41556_3(U41556|pid:none) Caenorhabditis elegans cosmid C25B8, c... 61 9e-19
U41556_2(U41556|pid:none) Caenorhabditis elegans cosmid C25B8, c... 61 9e-19
(P07688) RecName: Full=Cathepsin B; EC=3.4.22.1; AltNam... 64 9e-19
(Q24940) RecName: Full=Cathepsin L-like proteinase; EC=... 66 9e-19
(P07858) RecName: Full=Cathepsin B; EC=3.4.22.1; AltNam... 62 1e-18
AK092070_1(AK092070|pid:none) Homo sapiens cDNA FLJ34751 fis, cl... 62 1e-18
AY888604_1(AY888604|pid:none) Synthetic construct Homo sapiens c... 62 1e-18
(Q5R6D1) RecName: Full=Cathepsin B; EC=3.4.22.1; Contai... 62 1e-18
AC084046_2(AC084046|pid:none) Trypanosoma brucei chromosome 6 cl... 68 1e-18
BT070667_1(BT070667|pid:none) Picea sitchensis clone WS02742_P03... 59 2e-18
FN314592_1(FN314592|pid:none) Schistosoma japonicum isolate Anhu... 67 2e-18
EU532428_1(EU532428|pid:none) Sus scrofa cathepsin B (CTSB) gene... 62 2e-18
(A1E295) RecName: Full=Cathepsin B; EC=3.4.22.1; Contai... 62 2e-18
FN315359_1(FN315359|pid:none) Schistosoma japonicum isolate Anhu... 65 3e-18
AK290239_1(AK290239|pid:none) Homo sapiens cDNA FLJ78235 complet... 61 3e-18
AF016426_2(AF016426|pid:none) Caenorhabditis elegans cosmid W07B... 61 4e-18
AY204512_1(AY204512|pid:none) Sterkiella histriomuscorum catheps... 70 4e-18
(P43508) RecName: Full=Cathepsin B-like cysteine proteinase 4; ... 60 5e-18
AF483623_1(AF483623|pid:none) Apriona germari cathepsin B mRNA, ... 61 5e-18
EF472892_1(EF472892|pid:none) Oryctolagus cuniculus cathepsin H ... 61 5e-18
FN314591_1(FN314591|pid:none) Schistosoma japonicum isolate Anhu... 67 9e-18
AK340851_1(AK340851|pid:none) Acyrthosiphon pisum ACYPI005957 mR... 62 9e-18
(Q3T0I2) RecName: Full=Cathepsin H; EC=3.4.22.16; Conta... 65 9e-18
(O46427) RecName: Full=Cathepsin H; EC=3.4.22.16; Conta... 63 9e-18
AY398331_1(AY398331|pid:none) Danio rerio clone RK103A1C01 cathe... 58 9e-18
BC072490_1(BC072490|pid:none) Rattus norvegicus cathepsin B, mRN... 62 1e-17
(P00787) RecName: Full=Cathepsin B; EC=3.4.22.1; AltNam... 62 1e-17
(Q4R5M2) RecName: Full=Cathepsin B; EC=3.4.22.1; Contai... 59 1e-17
M11305_1(M11305|pid:none) Rat cathepsin B mRNA, 3' end. 62 1e-17
EU679003_1(EU679003|pid:none) Fenneropenaeus chinensis cathepsin... 66 2e-17
BC115254_1(BC115254|pid:none) Danio rerio capthepsin B, b, mRNA ... 64 2e-17
AB371622_1(AB371622|pid:none) Tuberaphis sumatrana catB mRNA for... 64 3e-17
AY277628_1(AY277628|pid:none) Fasciola hepatica cathepsin L mRNA... 67 3e-17
CQ840832_1(CQ840832|pid:none) Sequence 2 from Patent WO200405881... 67 3e-17
CQ840836_1(CQ840836|pid:none) Sequence 6 from Patent WO200405881... 67 3e-17
EF083997_1(EF083997|pid:none) Picea sitchensis clone WS0274_L19 ... 58 3e-17
BT070946_1(BT070946|pid:none) Picea sitchensis clone WS02761_D09... 58 3e-17
DQ363675_1(DQ363675|pid:none) Streblomastix strix cathepsin B ge... 59 3e-17
CQ840838_1(CQ840838|pid:none) Sequence 8 from Patent WO200405881... 67 3e-17
AB371624_1(AB371624|pid:none) Tuberaphis takenouchii catB mRNA f... 65 4e-17
AF277840_1(AF277840|pid:none) Blomia tropicalis cysteine proteas... 59 4e-17
AY519971_1(AY519971|pid:none) Fasciola hepatica clone Porto 1 ca... 66 6e-17
AY626233_1(AY626233|pid:none) Aedes aegypti lysosomal cathepsin ... 58 7e-17
AY519972_1(AY519972|pid:none) Fasciola hepatica clone INSA 2 cat... 65 8e-17
D48435(D48435) cysteine proteinase AC-3 - nematode (Haemonchus c... 59 1e-16
AB371623_1(AB371623|pid:none) Tuberaphis sumatrana catB mRNA for... 62 1e-16
AY553271_1(AY553271|pid:none) Triatoma sordida cathepsin B-like ... 61 1e-16
AY553272_1(AY553272|pid:none) Triatoma vitticeps cathepsin B-lik... 60 1e-16
EU835858_1(EU835858|pid:none) Fasciola hepatica clone 21e10 cath... 65 1e-16
AF239264_1(AF239264|pid:none) Fasciola gigantica cathepsin L (ca... 64 1e-16
EF536899_1(EF536899|pid:none) Fasciola gigantica cathepsin (cat-... 64 1e-16
EZ000085_1(EZ000085|pid:none) TSA: Schistosoma japonicum SJCHGC0... 64 2e-16
FN315273_1(FN315273|pid:none) Schistosoma japonicum isolate Anhu... 64 2e-16
BT070857_1(BT070857|pid:none) Picea sitchensis clone WS02756_O03... 59 2e-16
AY891889_1(AY891889|pid:none) Synthetic construct Homo sapiens c... 60 2e-16
CR456881_1(CR456881|pid:none) Homo sapiens full open reading fra... 60 2e-16
AY893780_1(AY893780|pid:none) Synthetic construct Homo sapiens c... 60 2e-16
(P09668) RecName: Full=Cathepsin H; EC=3.4.22.16; Conta... 60 2e-16
AF426247_1(AF426247|pid:none) Homo sapiens cathepsin H mRNA, com... 60 2e-16
AK149949_1(AK149949|pid:none) Mus musculus bone marrow macrophag... 58 2e-16
EU835857_1(EU835857|pid:none) Fasciola hepatica clone 22e06 cath... 64 2e-16
AF510856_1(AF510856|pid:none) Fasciola gigantica cathepsin L2 mR... 64 2e-16
AB010923_1(AB010923|pid:none) Fasciola gigantica FhCL gene for c... 64 2e-16
AF426248_1(AF426248|pid:none) Homo sapiens truncated cathepsin H... 60 2e-16
FN357327_25(FN357327|pid:none) Schistosoma mansoni genome sequen... 65 2e-16
(P25802) RecName: Full=Cathepsin B-like cysteine proteinase 1; ... 63 2e-16
AB167467_1(AB167467|pid:none) Tuberaphis coreana catB mRNA for c... 61 2e-16
AB255051_1(AB255051|pid:none) Haemaphysalis longicornis HlCath m... 55 2e-16
AB371620_1(AB371620|pid:none) Tuberaphis coreana catB mRNA for c... 61 2e-16
AB371627_1(AB371627|pid:none) Astegopteryx spinocephala catB mRN... 61 2e-16
AF239267_1(AF239267|pid:none) Fasciola gigantica cathepsin L (ca... 64 2e-16
U77932_1(U77932|pid:none) Schistosoma japonicum preprocathepsin ... 64 3e-16
AJ316141_1(AJ316141|pid:none) Nilaparvata lugens mRNA for cathep... 65 3e-16
AJ488928_1(AJ488928|pid:none) Fasciola hepatica partial mRNA for... 56 3e-16
BC044689_1(BC044689|pid:none) Xenopus laevis similar to cathepsi... 55 3e-16
AY838803_1(AY838803|pid:none) Periplaneta americana Parcxpwnx02 ... 58 4e-16
AB371618_1(AB371618|pid:none) Tuberaphis styraci catB mRNA for c... 62 4e-16
AB371626_1(AB371626|pid:none) Astegopteryx styracophila catB mRN... 60 4e-16
AF358667_1(AF358667|pid:none) Oncorhynchus mykiss procathepsin B... 57 4e-16
EU532429_1(EU532429|pid:none) Sus scrofa cathepsin H (CTSH) gene... 57 4e-16
DQ492287_1(DQ492287|pid:none) Nicotiana benthamiana cathepsin B ... 62 5e-16
AF329480_1(AF329480|pid:none) Glossina morsitans morsitans proba... 57 5e-16
AE013599_2638(AE013599|pid:none) Drosophila melanogaster chromos... 57 6e-16
AY363262_1(AY363262|pid:none) Triatoma infestans cathepsin B-lik... 59 6e-16
DQ993253_1(DQ993253|pid:none) Hippoglossus hippoglossus cathepsi... 56 6e-16
AY573569_1(AY573569|pid:none) Fasciola hepatica strain Firat cat... 63 6e-16
B48435(B48435) cysteine proteinase AC-5 - nematode (Haemonchus c... 54 1e-15
FN314850_1(FN314850|pid:none) Schistosoma japonicum isolate Anhu... 58 1e-15
AK170959_1(AK170959|pid:none) Mus musculus NOD-derived CD11c +ve... 56 1e-15
EF474109_1(EF474109|pid:none) Monocercomonoides sp. PA cathepsin... 60 1e-15
EF474111_1(EF474111|pid:none) Monocercomonoides sp. PA cathepsin... 60 1e-15
DQ079995_1(DQ079995|pid:none) Drosophila simulans male accessory... 55 2e-15
BC063365_1(BC063365|pid:none) Xenopus tropicalis hypothetical pr... 55 2e-15
AJ249847_1(AJ249847|pid:none) Lolium multiflorum mRNA for cystei... 57 2e-15
AY814659_1(AY814659|pid:none) Schistosoma japonicum clone SJCHGC... 57 2e-15
(P00786) RecName: Full=Cathepsin H; EC=3.4.22.16; AltNa... 57 2e-15
EU035711_1(EU035711|pid:none) Biomphalaria glabrata cathepsin B ... 56 2e-15
Y13924_1(Y13924|pid:none) Penaeus vannamei cathepsin L gene. 69 2e-15
M38135_1(M38135|pid:none) Rat cathepsin H (RCHII) mRNA,. 57 2e-15
FN315269_1(FN315269|pid:none) Schistosoma japonicum isolate Anhu... 63 3e-15
M14222_1(M14222|pid:none) Mouse cathepsin B proteinase mRNA, com... 55 3e-15
AB010924_1(AB010924|pid:none) Fasciola gigantica FhCL(B7-3) gene... 61 3e-15
AY217742_1(AY217742|pid:none) Fundulus heteroclitus cathepsin H ... 61 4e-15
FN314852_1(FN314852|pid:none) Schistosoma japonicum isolate Anhu... 57 4e-15
AY813193_1(AY813193|pid:none) Schistosoma japonicum clone SJCHGC... 57 4e-15
AY737533_1(AY737533|pid:none) Toxoptera citricida putative cathe... 56 4e-15
AJ583513_1(AJ583513|pid:none) Diabrotica virgifera virgifera mRN... 60 4e-15
EU877762_1(EU877762|pid:none) Trichobilharzia szidati cathepsin ... 53 5e-15
BC046667_1(BC046667|pid:none) Xenopus laevis hypothetical protei... 55 6e-15
FN314851_1(FN314851|pid:none) Schistosoma japonicum isolate Anhu... 57 6e-15
GQ223787_1(GQ223787|pid:none) Haemonchus contortus cysteine prot... 54 6e-15
(P43509) RecName: Full=Cathepsin B-like cysteine proteinase 5; ... 53 8e-15
(Q54QD9) RecName: Full=Cathepsin B; EC=3.4.22.1; AltNam... 64 8e-15
(Q26563) RecName: Full=Cathepsin C; EC=3.4.22.-; Flags:... 60 1e-14
AF120501_1(AF120501|pid:none) Ancylostoma ceylanicum cysteine pr... 52 1e-14
BC093339_1(BC093339|pid:none) Danio rerio cathepsin S, b.2, mRNA... 60 1e-14
AB009306_1(AB009306|pid:none) Fasciola hepatica mRNA for catheps... 64 1e-14
AY813273_1(AY813273|pid:none) Schistosoma japonicum SJCHGC02852 ... 62 1e-14
DQ363667_1(DQ363667|pid:none) Streblomastix strix cathepsin B (c... 63 1e-14
AY816160_1(AY816160|pid:none) Schistosoma japonicum clone SJCHGC... 55 1e-14
AJ420287_1(AJ420287|pid:none) Leishmania infantum cpc gene for c... 52 2e-14
AF216830_1(AF216830|pid:none) Leishmania donovani chagasi cathep... 52 2e-14
AB091671_1(AB091671|pid:none) Pandalus borealis PbCtB mRNA for c... 57 2e-14
BT047088_1(BT047088|pid:none) Salmo salar clone ssal-evd-579-155... 55 2e-14
AY366355_1(AY366355|pid:none) Litopenaeus vannamei cathepsin L g... 69 2e-14
AY648119_1(AY648119|pid:none) Trichobilharzia regenti cathepsin ... 54 2e-14
AY648122_1(AY648122|pid:none) Trichobilharzia regenti cathepsin ... 54 2e-14
GQ223790_1(GQ223790|pid:none) Haemonchus contortus cysteine prot... 53 2e-14
DQ533985_1(DQ533985|pid:none) Fasciola hepatica cathepsin L2 mRN... 57 2e-14
GQ223791_1(GQ223791|pid:none) Haemonchus contortus cysteine prot... 54 3e-14
DQ909020_1(DQ909020|pid:none) Clonorchis sinensis cathepsin B-li... 59 3e-14
FN314523_1(FN314523|pid:none) Schistosoma japonicum isolate Anhu... 52 3e-14
EF071861_1(EF071861|pid:none) Clonorchis sinensis cathepsin B3 m... 54 3e-14
BC154984_1(BC154984|pid:none) Xenopus laevis hypothetical protei... 67 3e-14
GQ223788_1(GQ223788|pid:none) Haemonchus contortus cysteine prot... 54 3e-14
GQ223792_1(GQ223792|pid:none) Haemonchus contortus cysteine prot... 53 4e-14
AY648121_1(AY648121|pid:none) Trichobilharzia regenti cathepsin ... 53 4e-14
FN314522_1(FN314522|pid:none) Schistosoma japonicum isolate Anhu... 52 4e-14
AY208820_1(AY208820|pid:none) Rhipicephalus appendiculatus midgu... 56 4e-14
AF239266_1(AF239266|pid:none) Fasciola gigantica cathepsin L (ca... 57 4e-14
EF530132_1(EF530132|pid:none) Actinidia arguta actinidin Act1b m... 52 5e-14
FN316420_1(FN316420|pid:none) Schistosoma japonicum isolate Anhu... 57 5e-14
AY126712_1(AY126712|pid:none) Metapenaeus ensis cathepsin L prec... 64 5e-14
AY126713_1(AY126713|pid:none) Metapenaeus ensis cathepsin L prec... 64 5e-14
EU126819_1(EU126819|pid:none) Samia cynthia ricini cathepsin B g... 56 5e-14
DQ902583_1(DQ902583|pid:none) Clonorchis sinensis clone cs002d09... 58 7e-14
AY814036_1(AY814036|pid:none) Schistosoma japonicum clone SJCHGC... 57 7e-14
FN316415_1(FN316415|pid:none) Schistosoma japonicum isolate Anhu... 57 7e-14
FN316424_1(FN316424|pid:none) Schistosoma japonicum isolate Anhu... 57 7e-14
T22853(T22853)probable cathepsin B (EC 3.4.22.1) F57F5.1 [simila... 52 9e-14
Z75953_2(Z75953|pid:none) Caenorhabditis elegans Cosmid F57F5, c... 52 9e-14
FN314524_1(FN314524|pid:none) Schistosoma japonicum isolate Anhu... 52 9e-14
FN316429_1(FN316429|pid:none) Schistosoma japonicum isolate Anhu... 57 9e-14
AY813528_1(AY813528|pid:none) Schistosoma japonicum clone SJCHGC... 57 1e-13
AY812909_1(AY812909|pid:none) Schistosoma japonicum clone SJCHGC... 57 1e-13
AY227674_1(AY227674|pid:none) Fasciola gigantica cathepsin B (ca... 53 1e-13
BC075887_1(BC075887|pid:none) Danio rerio cathepsin L.1, mRNA (c... 61 1e-13
(Q8HY82) RecName: Full=Cathepsin S; EC=3.4.22.27; Flags... 57 1e-13
AY812857_1(AY812857|pid:none) Schistosoma japonicum clone SJCHGC... 56 2e-13
AK152192_1(AK152192|pid:none) Mus musculus bone marrow macrophag... 54 2e-13
(Q9PYY5) RecName: Full=Viral cathepsin; Short=V-cath; ... 50 2e-13
AY813594_1(AY813594|pid:none) Schistosoma japonicum clone SJCHGC... 56 2e-13
BT082794_1(BT082794|pid:none) Anoplopoma fimbria clone afim-evh-... 60 2e-13
FN316423_1(FN316423|pid:none) Schistosoma japonicum isolate Anhu... 56 2e-13
FN316440_1(FN316440|pid:none) Schistosoma japonicum isolate Anhu... 56 2e-13
AY814917_1(AY814917|pid:none) Schistosoma japonicum clone SJCHGC... 56 2e-13
FN316427_1(FN316427|pid:none) Schistosoma japonicum isolate Anhu... 56 2e-13
AY813268_1(AY813268|pid:none) Schistosoma japonicum clone SJCHGC... 56 2e-13
FN357505_3(FN357505|pid:none) Schistosoma mansoni genome sequenc... 50 3e-13
AY504966_1(AY504966|pid:none) Iris hollandica putative cysteine ... 56 3e-13
AJ506158_1(AJ506158|pid:none) Schistosoma mansoni cb1.2 gene for... 50 3e-13
BT082380_1(BT082380|pid:none) Anoplopoma fimbria clone afim-evh-... 59 3e-13
FN316432_1(FN316432|pid:none) Schistosoma japonicum isolate Anhu... 55 3e-13
FN316416_1(FN316416|pid:none) Schistosoma japonicum isolate Anhu... 55 3e-13
AF083797_1(AF083797|pid:none) Arabidopsis thaliana clone sps897 ... 57 3e-13
AF104919_15(AF104919|pid:none) Arabidopsis thaliana BAC T15B16. ... 57 3e-13
FN316418_1(FN316418|pid:none) Schistosoma japonicum isolate Anhu... 57 3e-13
AJ583509_1(AJ583509|pid:none) Diabrotica virgifera virgifera mRN... 50 3e-13
AF194426_1(AF194426|pid:none) Myxine glutinosa clone hicl20 cyst... 56 3e-13
EU093092_1(EU093092|pid:none) Sus scrofa cathepsin H variant 2 (... 52 3e-13
U58000_1(U58000|pid:none) Fasciola hepatica cathepsin B protease... 53 3e-13
(Q9UJW2) RecName: Full=Tubulointerstitial nephritis antigen; ... 52 4e-13
AK312918_1(AK312918|pid:none) Homo sapiens cDNA, FLJ93367, highl... 52 4e-13
AC149038_3(AC149038|pid:none) Medicago truncatula chromosome 7 c... 50 4e-13
AF283476_1(AF283476|pid:none) Ipomoea batatas cathepsin B-like c... 55 4e-13
AB016870_9(AB016870|pid:none) Arabidopsis thaliana genomic DNA, ... 56 4e-13
AB377273_1(AB377273|pid:none) Raphanus sativus CatB mRNA for cat... 56 4e-13
AY336798_1(AY336798|pid:none) Rhipicephalus haemaphysaloides hae... 55 4e-13
BC070278_1(BC070278|pid:none) Homo sapiens tubulointerstitial ne... 52 5e-13
AF127592_1(AF127592|pid:none) Aedes aegypti vitellogenic catheps... 53 5e-13
AY815241_1(AY815241|pid:none) Schistosoma japonicum clone SJCHGC... 53 6e-13
BT074879_1(BT074879|pid:none) Osmerus mordax clone omor-eva-504-... 55 6e-13
L41940_1(L41940|pid:none) Aedes aegypti cathepsin B-like thiol p... 52 7e-13
AY648124_1(AY648124|pid:none) Trichobilharzia regenti cathepsin ... 51 7e-13
(P92131) RecName: Full=Cathepsin B-like CP1; EC=3.4.22.... 49 7e-13
AM494966_85(AM494966|pid:none) Leishmania braziliensis chromosom... 49 9e-13
DQ983317_1(DQ983317|pid:none) Tyrophagus putrescentiae mite alle... 51 9e-13
AY815868_1(AY815868|pid:none) Schistosoma japonicum SJCHGC00098 ... 54 9e-13
CR761110_1(CR761110|pid:none) Xenopus tropicalis finished cDNA, ... 77 1e-12
DQ474246_1(DQ474246|pid:none) Lygus lineolaris cathepsin-L mRNA,... 56 1e-12
CP000587_170(CP000587|pid:none) Ostreococcus lucimarinus CCE9901... 54 2e-12
AY950578_1(AY950578|pid:none) Paralichthys olivaceus cathepsin S... 49 2e-12
AY528231_1(AY528231|pid:none) Leptinotarsa decemlineata clone In... 53 2e-12
M13230_1(M13230|pid:none) Human lysosomal proteinase cathepsin B... 55 2e-12
AB045595_1(AB045595|pid:none) Bombyx mori mRNA for cathepsin B, ... 49 2e-12
AL033510_10(AL033510|pid:none) Caenorhabditis elegans YAC Y40H7A... 76 2e-12
DQ909019_1(DQ909019|pid:none) Clonorchis sinensis cathepsin B pr... 53 3e-12
AF157961_1(AF157961|pid:none) Hypera postica cysteine proteinase... 54 3e-12
DQ280314_1(DQ280314|pid:none) Hymeniacidon perlevis cathepsin L ... 54 3e-12
AK097384_1(AK097384|pid:none) Homo sapiens cDNA FLJ40065 fis, cl... 55 3e-12
BC010745_1(BC010745|pid:none) Mus musculus tubulointerstitial ne... 50 3e-12
AF153366_1(AF153366|pid:none) Mus musculus tubulo-interstitial n... 50 3e-12
FN315845_1(FN315845|pid:none) Schistosoma japonicum isolate Anhu... 53 3e-12
CR548627_7(CR548627|pid:none) Zebrafish DNA sequence from clone ... 51 3e-12
BC066625_1(BC066625|pid:none) Danio rerio cathepsin S, a, mRNA (... 51 3e-12
FN357489_8(FN357489|pid:none) Schistosoma mansoni genome sequenc... 51 4e-12
EU022371_1(EU022371|pid:none) Schistosoma mansoni cathepsin L3 p... 51 4e-12
FN315843_1(FN315843|pid:none) Schistosoma japonicum isolate Anhu... 53 4e-12
FN315835_1(FN315835|pid:none) Schistosoma japonicum isolate Anhu... 53 4e-12
AY815766_1(AY815766|pid:none) Schistosoma japonicum clone SJCHGC... 52 4e-12
EU551629_1(EU551629|pid:none) Dermacentor variabilis isolate DvM... 61 4e-12
CR954207_158(CR954207|pid:none) Ostreococcus tauri strain OTTH05... 53 6e-12
AY812942_1(AY812942|pid:none) Schistosoma japonicum clone SJCHGC... 53 6e-12
A57480(A57480) tubulointerstitial nephritis antigen precursor - ... 49 7e-12
AF046229_1(AF046229|pid:none) Haemonchus contortus cathepsin B-l... 47 8e-12
AY812884_1(AY812884|pid:none) Schistosoma japonicum clone SJCHGC... 53 8e-12
EU233645_1(EU233645|pid:none) Trypanosoma congolense cathepsin B... 54 8e-12
FN315842_1(FN315842|pid:none) Schistosoma japonicum isolate Anhu... 52 1e-11
EF137263_1(EF137263|pid:none) Necator americanus cysteine protei... 51 1e-11
Z69346_1(Z69346|pid:none) Haemonchus contortus mRNA for cysteine... 62 1e-11
AY814631_1(AY814631|pid:none) Schistosoma japonicum clone SJCHGC... 50 1e-11
AJ132421_1(AJ132421|pid:none) Necator americanus mRNA for necpai... 50 1e-11
EU195859_1(EU195859|pid:none) Fasciola hepatica dev-stage metace... 47 1e-11
BC075275_1(BC075275|pid:none) Xenopus tropicalis cathepsin K (py... 55 2e-11
AY814893_1(AY814893|pid:none) Schistosoma japonicum clone SJCHGC... 50 2e-11
AY815840_1(AY815840|pid:none) Schistosoma japonicum clone SJCHGC... 50 2e-11
AY812873_1(AY812873|pid:none) Schistosoma japonicum clone SJCHGC... 50 2e-11
EU659123_1(EU659123|pid:none) Bursaphelenchus xylophilus catheps... 54 2e-11
FN315841_1(FN315841|pid:none) Schistosoma japonicum isolate Anhu... 50 3e-11
U38476_1(U38476|pid:none) Schistosoma japonicum preprocathepsin ... 48 3e-11
BX950864_2(BX950864|pid:none) Zebrafish DNA sequence from clone ... 48 4e-11
AP006170_17(AP006170|pid:none) Oryza sativa Japonica Group genom... 52 4e-11
AY604196_1(AY604196|pid:none) Gossypium hirsutum putative cystei... 52 4e-11
AY915831_1(AY915831|pid:none) Schistosoma japonicum SJCHGC09761 ... 50 4e-11
AY814678_1(AY814678|pid:none) Schistosoma japonicum clone SJCHGC... 50 4e-11
U42758_1(U42758|pid:none) Naegleria fowleri cysteine proteinase ... 52 5e-11
BX119902_1(BX119902|pid:none) Zebrafish DNA sequence from clone ... 64 5e-11
BC083200_1(BC083200|pid:none) Danio rerio cathepsin L, like, mRN... 64 5e-11
AC006232_10(AC006232|pid:none) Arabidopsis thaliana chromosome 2... 49 8e-11
EU026137_1(EU026137|pid:none) Penaeus monodon cathepsin C mRNA, ... 70 1e-10
AP003759_6(AP003759|pid:none) Oryza sativa Japonica Group genomi... 55 1e-10
AF089848_1(AF089848|pid:none) Brassica napus senescence-specific... 52 1e-10
AY814503_1(AY814503|pid:none) Schistosoma japonicum clone SJCHGC... 50 1e-10
AY648123_1(AY648123|pid:none) Trichobilharzia regenti cathepsin ... 49 1e-10
AF493233_1(AF493233|pid:none) Lycopersicon pennellii cysteine pr... 51 1e-10
AY814745_1(AY814745|pid:none) Schistosoma japonicum clone SJCHGC... 47 1e-10
AP006170_13(AP006170|pid:none) Oryza sativa Japonica Group genom... 51 1e-10
AJ719318_1(AJ719318|pid:none) Gallus gallus mRNA for hypothetica... 50 1e-10
AC138015_4(AC138015|pid:none) Medicago truncatula clone mth2-34m... 45 2e-10
FJ573158_1(FJ573158|pid:none) Rimicaris exoculata cathepsin c mR... 69 2e-10
(P43156) RecName: Full=Thiol protease SEN102; EC=3.4.22... 45 2e-10
EU233655_1(EU233655|pid:none) Trypanosoma congolense cathepsin B... 48 2e-10
DQ459306_1(DQ459306|pid:none) Aedes aegypti cathepsin L (CAT-L4)... 51 2e-10
EU143709_1(EU143709|pid:none) Stichopus japonicus cathepsin L mR... 52 3e-10
AF293408_1(AF293408|pid:none) Giardia intestinalis encystation-s... 68 5e-10
EU148599_1(EU148599|pid:none) Dermatophagoides pteronyssinus Der... 44 5e-10
EU287916_1(EU287916|pid:none) Fasciola hepatica cathepsin L4 (CL... 68 6e-10
BC095788_1(BC095788|pid:none) Danio rerio cathepsin S, b.1, mRNA... 68 6e-10
AY822073_1(AY822073|pid:none) Penaeus monodon cathepsin L (CTSL)... 67 8e-10
AY333299_1(AY333299|pid:none) Petromyzon marinus isolate Pema-ca... 50 8e-10
AY813609_1(AY813609|pid:none) Schistosoma japonicum clone SJCHGC... 50 8e-10
EF633494_1(EF633494|pid:none) Sitobion avenae cathepsin B-348 mR... 56 8e-10
AJ296151_1(AJ296151|pid:none) Ostertagia ostertagi partial mRNA ... 61 8e-10
EF633480_1(EF633480|pid:none) Acyrthosiphon pisum isolate ApL ca... 53 1e-09
AY815428_1(AY815428|pid:none) Schistosoma japonicum clone SJCHGC... 48 1e-09
AF456460_1(AF456460|pid:none) Rattus norvegicus cathepsin Q2 (Ct... 57 1e-09
FN315833_1(FN315833|pid:none) Schistosoma japonicum isolate Anhu... 45 1e-09
BC066490_1(BC066490|pid:none) Danio rerio cathepsin L, a, mRNA (... 59 1e-09
CT025745_2(CT025745|pid:none) Zebrafish DNA sequence from clone ... 59 1e-09
AF498292_1(AF498292|pid:none) Danio rerio cathepsin mRNA, partia... 59 1e-09
AC174315_23(AC174315|pid:none) Medicago truncatula clone mth2-16... 49 1e-09
Z69343_1(Z69343|pid:none) Haemonchus contortus mRNA for cysteine... 51 2e-09
AF479265_1(AF479265|pid:none) Meriones unguiculatus cathepsin P ... 52 2e-09
AK341295_1(AK341295|pid:none) Acyrthosiphon pisum ACYPI001175 mR... 52 2e-09
EU287917_1(EU287917|pid:none) Fasciola hepatica cathepsin L4 (CL... 66 2e-09
(Q9GKL8) RecName: Full=Cathepsin L1; EC=3.4.22.15; AltN... 59 2e-09
FN315830_1(FN315830|pid:none) Schistosoma japonicum isolate Anhu... 53 2e-09
Z69342_1(Z69342|pid:none) Haemonchus contortus mRNA for cysteine... 52 2e-09
AB436161_1(AB436161|pid:none) Bombyx mori catL-like mRNA for cat... 66 2e-09
BC121682_1(BC121682|pid:none) Xenopus tropicalis hypothetical pr... 66 2e-09
EF633477_1(EF633477|pid:none) Acyrthosiphon pisum isolate ApL ca... 66 2e-09
EU233644_1(EU233644|pid:none) Trypanosoma congolense cathepsin B... 49 3e-09
EF633497_1(EF633497|pid:none) Myzus persicae cathepsin B-348 mRN... 54 3e-09
AX459764_1(AX459764|pid:none) Sequence 27 from Patent WO0240676. 44 3e-09
DQ356053_1(DQ356053|pid:none) Tenebrio molitor clone AM3-32 puta... 65 3e-09
BT050087_1(BT050087|pid:none) Salmo salar clone ssal-evd-563-114... 61 4e-09
EU233654_1(EU233654|pid:none) Trypanosoma congolense cathepsin B... 47 4e-09
AP006170_12(AP006170|pid:none) Oryza sativa Japonica Group genom... 44 5e-09
AX459766_1(AX459766|pid:none) Sequence 29 from Patent WO0240676. 44 7e-09
FB844660_1(FB844660|pid:none) Sequence 63933 from Patent WO20080... 46 9e-09
FN313727_1(FN313727|pid:none) Schistosoma japonicum isolate Anhu... 47 9e-09
AY893779_1(AY893779|pid:none) Synthetic construct Homo sapiens c... 58 9e-09
AY333297_1(AY333297|pid:none) Branchiostoma lanceolatum isolate ... 55 9e-09
AY890446_1(AY890446|pid:none) Synthetic construct Homo sapiens c... 58 9e-09
AK075100_1(AK075100|pid:none) Homo sapiens cDNA FLJ90619 fis, cl... 58 9e-09
(P07711) RecName: Full=Cathepsin L1; EC=3.4.22.15; AltN... 58 9e-09
FN313809_1(FN313809|pid:none) Schistosoma japonicum isolate Anhu... 49 1e-08
L33772_1(L33772|pid:none) Fasciola hepatica cathepsin L-like pro... 64 1e-08
EF633491_1(EF633491|pid:none) Pterocomma populeum cathepsin B-84... 64 1e-08
EF633489_1(EF633489|pid:none) Aulacorthum solani cathepsin B-84 ... 64 1e-08
BC142983_1(BC142983|pid:none) Homo sapiens cathepsin L1, mRNA (c... 57 1e-08
FJ807676_1(FJ807676|pid:none) Dicentrarchus labrax cathepsin L m... 56 1e-08
AX459756_1(AX459756|pid:none) Sequence 19 from Patent WO0240676. 44 1e-08
AY389976_1(AY389976|pid:none) Scyliorhinus canicula cathepsin B ... 63 2e-08
EF015467_1(EF015467|pid:none) Hippoglossus hippoglossus cathepsi... 54 2e-08
AY814095_1(AY814095|pid:none) Schistosoma japonicum SJCHGC06356 ... 45 2e-08
Y18463_1(Y18463|pid:none) Mus musculus mRNA for cathepsin B, par... 52 2e-08
EF633500_1(EF633500|pid:none) Myzus persicae cathepsin B-16 mRNA... 63 2e-08
BT071384_1(BT071384|pid:none) Picea sitchensis clone WS0285_P02 ... 63 2e-08
EF538805_1(EF538805|pid:none) Trypanoplasma borreli cathepsin L ... 49 2e-08
EF535003_1(EF535003|pid:none) Misgurnus mizolepis cathepsin L mR... 54 2e-08
AY333292_1(AY333292|pid:none) Branchiostoma lanceolatum isolate ... 54 2e-08
FN357654_7(FN357654|pid:none) Schistosoma mansoni genome sequenc... 44 2e-08
M88503_1(M88503|pid:none) Ostertagia ostertagi cathepsin B-like ... 62 3e-08
BT074607_1(BT074607|pid:none) Osmerus mordax clone omor-rgc-519-... 54 3e-08
AY333294_1(AY333294|pid:none) Branchiostoma lanceolatum isolate ... 54 3e-08
AY333293_1(AY333293|pid:none) Branchiostoma lanceolatum isolate ... 54 3e-08
FJ772427_1(FJ772427|pid:none) Lutjanus argentimaculatus cathepsi... 54 3e-08
EF633498_1(EF633498|pid:none) Myzus persicae cathepsin B-2744 mR... 49 3e-08
AX459754_1(AX459754|pid:none) Sequence 17 from Patent WO0240676. 44 3e-08
AX459752_1(AX459752|pid:none) Sequence 15 from Patent WO0240676. 44 3e-08
AY714860_9(AY714860|pid:none) Uncultured archaeon GZfos34G5 clon... 62 3e-08
BT074465_1(BT074465|pid:none) Osmerus mordax clone omor-rgc-503-... 62 3e-08
EF538806_1(EF538806|pid:none) Trypanoplasma borreli cathepsin L ... 47 4e-08
AK011589_1(AK011589|pid:none) Mus musculus 10 days embryo whole ... 47 4e-08
AX710310_1(AX710310|pid:none) Sequence 14 from Patent WO03016340... 44 4e-08
AX114268_1(AX114268|pid:none) Sequence 76 from Patent WO0129078.... 44 4e-08
AX114273_1(AX114273|pid:none) Sequence 81 from Patent WO0129078. 44 4e-08
EF070511_1(EF070511|pid:none) Maconellicoccus hirsutus clone WHM... 62 5e-08
S15844(S15844;S23680;S16972;S23957)cathepsin S (EC 3.4.22.27) - ... 62 5e-08
EF474114_1(EF474114|pid:none) Monocercomonoides sp. PA cathepsin... 62 5e-08
(P25326) RecName: Full=Cathepsin S; EC=3.4.22.27; Flags... 62 5e-08
(P06797) RecName: Full=Cathepsin L1; EC=3.4.22.15; AltN... 47 5e-08
AF121837_1(AF121837|pid:none) Mus musculus cell-line L929 cathep... 47 5e-08
AK165397_1(AK165397|pid:none) Mus musculus adult male kidney cDN... 47 5e-08
AK147142_1(AK147142|pid:none) Mus musculus cDNA, RIKEN full-leng... 47 5e-08
AK145382_1(AK145382|pid:none) Mus musculus 4 days embryo whole b... 51 5e-08
(P08176) RecName: Full=Peptidase 1; EC=3.4.22.65; AltNa... 44 5e-08
AX114205_1(AX114205|pid:none) Sequence 13 from Patent WO0129078. 44 5e-08
AX114256_1(AX114256|pid:none) Sequence 64 from Patent WO0129078. 44 5e-08
AX114208_1(AX114208|pid:none) Sequence 16 from Patent WO0129078. 44 5e-08
AX459758_1(AX459758|pid:none) Sequence 21 from Patent WO0240676. 44 5e-08
AX459824_1(AX459824|pid:none) Sequence 87 from Patent WO0240676.... 44 5e-08
AY810687_1(AY810687|pid:none) Schistosoma japonicum clone SJCHGC... 61 6e-08
KHBH(A25492;B25492)aleurain (EC 3.4.22.-) precursor - barley 61 6e-08
AY363263_1(AY363263|pid:none) Triatoma infestans cathepsin L-lik... 61 6e-08
FN313884_1(FN313884|pid:none) Schistosoma japonicum isolate Anhu... 47 7e-08
AK161538_1(AK161538|pid:none) Mus musculus 11 days pregnant adul... 46 7e-08
AY220615_1(AY220615|pid:none) Hydra vulgaris cathepsin L precurs... 61 8e-08
AE013599_1857(AE013599|pid:none) Drosophila melanogaster chromos... 61 8e-08
AB081845_1(AB081845|pid:none) Engraulis japonicus aCatL mRNA for... 53 9e-08
AX114278_1(AX114278|pid:none) Sequence 86 from Patent WO0129078. 44 9e-08
U13154_1(U13154|pid:none) Tritrichomonas foetus D1 putative cyst... 44 9e-08
AX459770_1(AX459770|pid:none) Sequence 33 from Patent WO0240676. 40 9e-08
AK070448_1(AK070448|pid:none) Oryza sativa Japonica Group cDNA c... 60 1e-07
EF472888_1(EF472888|pid:none) Oryctolagus cuniculus cathepsin B ... 60 1e-07
FJ772425_1(FJ772425|pid:none) Lutjanus argentimaculatus cathepsi... 60 1e-07
X91642_1(X91642|pid:none) E.histolytica DNA encoding for cystein... 60 1e-07
EF067847_1(EF067847|pid:none) Channa argus cathepsin S mRNA, com... 60 1e-07
Z81327_1(Z81327|pid:none) H.contortus mRNA for cysteine proteina... 60 1e-07
EF633482_1(EF633482|pid:none) Acyrthosiphon pisum isolate ApL ca... 60 1e-07
EU156179_1(EU156179|pid:none) Fasciola gigantica cathepsin L (ca... 60 1e-07
AF239268_1(AF239268|pid:none) Fasciola gigantica cathepsin L (ca... 60 1e-07
EF066525_1(EF066525|pid:none) Radix peregra cathepsin-L-like cys... 60 1e-07
L30111_1(L30111|pid:none) Cyprinus carpio cysteine proteinase ge... 60 1e-07
AB004648_1(AB004648|pid:none) Oryza sativa Japonica Group RepA g... 60 1e-07
EU915298_1(EU915298|pid:none) Ictalurus punctatus cathspsin H mR... 60 1e-07
AK153417_1(AK153417|pid:none) Mus musculus bone marrow macrophag... 45 2e-07
AF400046_1(AF400046|pid:none) Trypanosoma rangeli cathepsin B-li... 51 2e-07
DQ356054_1(DQ356054|pid:none) Tenebrio molitor clone AM4-22 puta... 60 2e-07
AJ296150_1(AJ296150|pid:none) Ostertagia ostertagi partial mRNA ... 60 2e-07
AB331915_1(AB331915|pid:none) Brassica oleracea var. italica BoC... 60 2e-07
(P10056) RecName: Full=Caricain; EC=3.4.22.30; AltName:... 60 2e-07
BC074718_1(BC074718|pid:none) Xenopus tropicalis MGC69486 protei... 50 2e-07
AY947536_1(AY947536|pid:none) Dermatophagoides pteronyssinus fro... 44 2e-07
BC109853_1(BC109853|pid:none) Bos taurus cathepsin K preproprote... 59 2e-07
AB236968_1(AB236968|pid:none) Carassius auratus mRNA for catheps... 59 2e-07
(Q9GLE3) RecName: Full=Cathepsin K; EC=3.4.22.38; Flags... 59 2e-07
AB248269_1(AB248269|pid:none) Echinococcus multilocularis EmCLP1... 59 2e-07
(Q90686) RecName: Full=Cathepsin K; EC=3.4.22.38; AltNa... 59 2e-07
AF358668_1(AF358668|pid:none) Oncorhynchus mykiss procathepsin L... 51 3e-07
BT058408_1(BT058408|pid:none) Salmo salar clone Contig454 Cathep... 51 3e-07
BT057383_1(BT057383|pid:none) Salmo salar clone ssal-evf-519-083... 51 3e-07
(O35186) RecName: Full=Cathepsin K; EC=3.4.22.38; Flags... 59 3e-07
AF194427_1(AF194427|pid:none) Myxine glutinosa clone hicl22 cyst... 59 3e-07
AY289109_1(AY289109|pid:none) Plasmodium chabaudi chabaudi chaba... 42 3e-07
BT081306_1(BT081306|pid:none) Caligus clemensi clone ccle-evs-50... 50 3e-07
EF137262_1(EF137262|pid:none) Necator americanus cysteine protei... 59 4e-07
FN357367_30(FN357367|pid:none) Schistosoma mansoni genome sequen... 59 4e-07
AB363729_1(AB363729|pid:none) Platycodon grandiflorus PgCP2 mRNA... 59 4e-07
FN357367_31(FN357367|pid:none) Schistosoma mansoni genome sequen... 59 4e-07
S74227(S74227) cathepsin K (EC 3.4.22.-) precursor - mouse &X94... 59 4e-07
M95211_1(M95211|pid:none) Bovine cathepsin S (catS) mRNA, partia... 59 4e-07
(Q26534) RecName: Full=Cathepsin L; EC=3.4.22.15; AltNa... 59 4e-07
(P55097) RecName: Full=Cathepsin K; EC=3.4.22.38; Flags... 59 4e-07
FN357367_32(FN357367|pid:none) Schistosoma mansoni genome sequen... 59 4e-07
AJ401373_1(AJ401373|pid:none) Ostertagia ostertagi partial mRNA ... 48 4e-07
AY390282_1(AY390282|pid:none) Periserrula leucophryna cysteine p... 58 5e-07
AY428949_1(AY428949|pid:none) Fasciola gigantica cathepsin L (ca... 58 5e-07
BT082286_1(BT082286|pid:none) Anoplopoma fimbria clone afim-evh-... 58 5e-07
(P05167) RecName: Full=Thiol protease aleurain; EC=3.4.... 58 5e-07
U62289_1(U62289|pid:none) Fasciola hepatica secreted cathepsin L... 58 5e-07
S47432(S47432;A48398) cathepsin L (EC 3.4.22.15) - Norway lobste... 58 5e-07
(P43236) RecName: Full=Cathepsin K; EC=3.4.22.38; AltNa... 58 5e-07
(P42666) RecName: Full=Cysteine proteinase; EC=3.4.22.-... 43 5e-07
CR855072_10(CR855072|pid:none) Oryza sativa genomic DNA, chromos... 58 7e-07
AY815993_1(AY815993|pid:none) Schistosoma japonicum clone SJCHGC... 58 7e-07
U20280_1(U20280|pid:none) Human cathepsin X mRNA, complete cds. 58 7e-07
(P61276) RecName: Full=Cathepsin K; EC=3.4.22.38; Flags... 58 7e-07
AJ002386_1(AJ002386|pid:none) Mus musculus mRNA for cathepsin S. 58 7e-07
AF038546_1(AF038546|pid:none) Mus musculus cathepsin S precursor... 58 7e-07
BC002125_1(BC002125|pid:none) Mus musculus cathepsin S, mRNA (cD... 58 7e-07
CR541719_1(CR541719|pid:none) Homo sapiens full open reading fra... 58 7e-07
AY212286_1(AY212286|pid:none) Fundulus heteroclitus cathepsin L ... 52 7e-07
AX710306_1(AX710306|pid:none) Sequence 10 from Patent WO03016340... 44 7e-07
EF633479_1(EF633479|pid:none) Acyrthosiphon pisum isolate ApL ca... 46 7e-07
AJ583512_1(AJ583512|pid:none) Diabrotica virgifera virgifera mRN... 57 9e-07
AY815730_1(AY815730|pid:none) Schistosoma japonicum clone SJCHGC... 57 9e-07
CR940352_253(CR940352|pid:none) Theileria annulata strain Ankara... 57 9e-07
CR954202_449(CR954202|pid:none) Ostreococcus tauri strain OTTH05... 57 9e-07
DQ147988_1(DQ147988|pid:none) Macaca mulatta clone dl2_j19_t7_12... 57 9e-07
AJ009830_1(AJ009830|pid:none) Ananas comosus mRNA for stem cyste... 57 9e-07
(P80884) RecName: Full=Ananain; EC=3.4.22.31; Flags: Pr... 57 9e-07
>CP001326_736(CP001326|pid:none) Micromonas sp. RCC299 chromosome 5,
complete sequence.
Length = 670
Score = 195 bits (496), Expect(2) = 4e-64
Identities = 100/215 (46%), Positives = 137/215 (63%), Gaps = 6/215 (2%)
Frame = +3
Query: 135 IIKSQLPSEYIDEDT--LPTQYDWRNISGSSYITITRNQHLPQYCGSCWAHGTTSALGDR 308
++++ P E D D +P+ +D R++ G + TI RNQH+PQYCGSCWAHGTTS++ DR
Sbjct: 403 LVRTVRPHEAPDYDKTKIPSSWDIRDVDGVNLATINRNQHIPQYCGSCWAHGTTSSMADR 462
Query: 309 IKIGRKGTFPEVVLAPQVLLNC--AGPDNTCDGGDPTEAYAYMAAKGITDETCAPYEAID 482
I + R G FPE+ LAPQVL++C G + C+GGDPT A+ ++AA G+ +ETC Y+A
Sbjct: 463 INLMRGGKFPEIDLAPQVLVDCVSGGGTDGCNGGDPTSAHVWIAANGVPEETCQNYQAKK 522
Query: 483 NECNAEGICKNCNFDLSNPTADCFAQ--PTYTTYFVEEHGQVNGSVAMMQEIFARGPIAC 656
NEC+ C++C +P CFA+ P Y ++EHGQV G AMM EIFARGPIAC
Sbjct: 523 NECDDFHFCQDC-----DPVKGCFAKTPPANRVYRIQEHGQVTGEEAMMAEIFARGPIAC 577
Query: 657 GMEVTDAFEXXXXXXXXXXXXXXXEINHEISIIGW 761
G+ VT+ FE + +HEISI G+
Sbjct: 578 GLCVTEEFEAYKGGIFTDATGCKDQ-DHEISIAGF 611
Score = 74.3 bits (181), Expect(2) = 4e-64
Identities = 31/50 (62%), Positives = 40/50 (80%), Gaps = 1/50 (2%)
Frame = +2
Query: 758 LGGWGT-ENGVDYWIGRNSWGTYFGELGFFRIQRGIDLLSIESACDWAVP 904
+ G+G E G YW+GRNSWGT++GE G+FR+QRG++ L IE ACDWAVP
Sbjct: 608 IAGFGEDEEGNKYWVGRNSWGTFWGEDGWFRLQRGVNALGIEDACDWAVP 657
Score = 185 bits (470), Expect = 2e-45
Identities = 101/248 (40%), Positives = 135/248 (54%), Gaps = 21/248 (8%)
Frame = +3
Query: 87 SGAHQSC--VKRVNAPTSIIKSQLPSEYID-EDTLPTQYDWRNISGSSYITITRNQHLPQ 257
+G H+ C K + S P E +D + LPT W ++ G +Y+T TRNQH+PQ
Sbjct: 53 AGTHKHCRTTKATFLAGERVISPRPHEQLDVRNDLPTHVFWGDVDGVNYLTETRNQHIPQ 112
Query: 258 YCGSCWAHGTTSALGDRIKIGRKGTFPEVVLAPQVLLNCAGPDNTCDGGDPTEAYAYMAA 437
YCGSCWA GTT++L DRIKI R TFPEV+LAPQVL+NC +C+GGDP + Y Y+AA
Sbjct: 113 YCGSCWAMGTTASLSDRIKIARNATFPEVILAPQVLINCRA-GGSCEGGDPAQVYEYIAA 171
Query: 438 KGITDETCAPYEAIDNECNAEGICKNCNFDLSNP-----TADCFAQPTYTTYFVEEHGQV 602
GI DETC YEA D +C GIC++C P C Y + + E+G V
Sbjct: 172 HGIPDETCQAYEARDGKCKPMGICEDC--APGQPPQPFLPGTCKPVKRYKRWTLSEYGHV 229
Query: 603 NGSV-------------AMMQEIFARGPIACGMEVTDAFEXXXXXXXXXXXXXXXEINHE 743
+G + M E+ RGPIACG+ VTD F +NHE
Sbjct: 230 HGGLDVDAVGWPVSNADKMKAELATRGPIACGIHVTDKFYSDYKGGIYAESHLLNFMNHE 289
Query: 744 ISIIGWVV 767
++++G+ V
Sbjct: 290 LAVVGYGV 297
Score = 62.4 bits (150), Expect = 3e-08
Identities = 31/57 (54%), Positives = 39/57 (68%), Gaps = 4/57 (7%)
Frame = +2
Query: 746 LNHWLG--GWGTE--NGVDYWIGRNSWGTYFGELGFFRIQRGIDLLSIESACDWAVP 904
+NH L G+G + +G +YWIGRNSWGTY+GE GFFRI+ L IES C + VP
Sbjct: 286 MNHELAVVGYGVDEASGEEYWIGRNSWGTYWGESGFFRIKMHHQNLGIESDCTFGVP 342
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3236559
Number of Hits to DB: 1,680,531,512
Number of extensions: 34885902
Number of successful extensions: 119856
Number of sequences better than 10.0: 1556
Number of HSP's gapped: 118846
Number of HSP's successfully gapped: 2661
Length of query: 359
Length of database: 1,051,180,864
Length adjustment: 130
Effective length of query: 229
Effective length of database: 630,428,194
Effective search space: 144368056426
Effective search space used: 144368056426
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 32 (16.9 bits)
|
| PSORT |
|
| VS (DIR, S) |
10 |
| VH (FL, L) |
4 |
| VF (FL, S) |
1 |
| AH (FL, L) |
0 |
| AF (FL, S) |
0 |
| SL (DIR, L) |
0 |
| SS (DIR, S) |
5 |
| SH (FL, L) |
0 |
| SF (FL, S) |
0 |
| CH (FL, L) |
0 |
| CF (FL, S) |
0 |
| FCL (DIR, L) |
0 |
| FC (DIR, S) |
0 |
| FC-IC (SUB) |
0 |