| Contig-U13417-1 |
| Contig ID |
Contig-U13417-1 |
| Contig update |
2002.12.18 |
| Contig sequence |
 |
| Gap |
no gap |
| Contig length |
373 |
| Chromosome number (1..6, M) |
1 |
| Chromosome length |
4919822 |
| Start point |
1216957 |
| End point |
1217330 |
| Strand (PLUS/MINUS) |
PLUS |
| Number of clones |
2 |
| Number of EST |
2 |
| Link to clone list |
U13417 |
| List of clone(s) |
|
| Translated Amino Acid sequence |
|
| Translated Amino Acid sequence (All Frames) |
|
| own update |
2004. 6.10 |
| Homology vs CSM-cDNA |
|
| dna update |
2008.12. 9 |
| Homology vs DNA |
|
| protein update |
2009. 7. 7 |
| Homology vs Protein |
Query= Contig-U13417-1 (Contig-U13417-1Q) /CSM_Contig/Contig-U13417-1Q.Seq.d
(373 letters)
Database: nrp_B
3,236,559 sequences; 1,051,180,864 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
(Q22036) RecName: Full=Calpain-5; EC=3.4.22.-; AltName:... 44 0.002
BC044317_1(BC044317|pid:none) Xenopus laevis calpain 1, (mu/I) l... 43 0.004
FN357296_91(FN357296|pid:none) Schistosoma mansoni genome sequen... 42 0.007
(P27730) RecName: Full=Calpain; EC=3.4.22.-; AltName: F... 42 0.007
FN357491_7(FN357491|pid:none) Schistosoma mansoni genome sequenc... 42 0.007
AK301538_1(AK301538|pid:none) Homo sapiens cDNA FLJ53224 complet... 42 0.007
AK170034_1(AK170034|pid:none) Mus musculus NOD-derived CD11c +ve... 42 0.009
(P20807) RecName: Full=Calpain-3; EC=3.4.22.54; AltName... 42 0.009
AB117940_1(AB117940|pid:none) Homo sapiens CAPN3 mRNA for hUp84,... 42 0.009
AF148956_1(AF148956|pid:none) Oryctolagus cuniculus lens-specifi... 42 0.009
AK155179_1(AK155179|pid:none) Mus musculus NOD-derived CD11c +ve... 42 0.009
AF127764_1(AF127764|pid:none) Homo sapiens calpain 3 (CAPN3) mRN... 42 0.009
A91671_1(A91671|pid:none) Sequence 3 from Patent WO9824916. 41 0.011
(Q92177) RecName: Full=Calpain-3; EC=3.4.22.54; AltName... 40 0.019
(Q9TTH8) RecName: Full=Calpain-3; EC=3.4.22.54; AltName... 40 0.019
AF148714_1(AF148714|pid:none) Bos taurus lens-specific calpain L... 40 0.019
BX004801_3(BX004801|pid:none) Zebrafish DNA sequence from clone ... 40 0.019
AF115744_1(AF115744|pid:none) Bos taurus skeletal muscle-specifi... 40 0.019
(Q9GLG2) RecName: Full=Calpain-1 catalytic subunit; EC=... 40 0.019
AL935121_5(AL935121|pid:none) Mouse DNA sequence from clone RP23... 40 0.019
AF091998_1(AF091998|pid:none) Mus musculus calpain Lp82 mRNA, co... 40 0.019
AF184950_1(AF184950|pid:none) Rattus norvegicus calpain Rt90 mRN... 40 0.019
DQ192644_1(DQ192644|pid:none) Sus scrofa calcium-activated neutr... 40 0.019
AF115745_1(AF115745|pid:none) Ovis aries skeletal muscle-specifi... 40 0.019
AF052540_1(AF052540|pid:none) Rattus norvegicus calpain isoform ... 40 0.019
FJ232591_1(FJ232591|pid:none) Gallus gallus breed Black-bone CAP... 40 0.019
AB117943_1(AB117943|pid:none) Mus musculus Capn3 mRNA for mUp76,... 40 0.019
AL935121_6(AL935121|pid:none) Mouse DNA sequence from clone RP23... 40 0.019
FJ497056_1(FJ497056|pid:none) Gallus gallus breed Shandi Black-b... 40 0.019
(P51186) RecName: Full=Calpain-3; EC=3.4.22.54; AltName... 40 0.019
(P43368) RecName: Full=Calpain-3; EC=3.4.22.54; AltName... 40 0.019
AF248054_1(AF248054|pid:none) Bos taurus micromolar calcium acti... 40 0.025
BC095045_1(BC095045|pid:none) Danio rerio calpain 2, (m/II) larg... 40 0.033
AF148955_1(AF148955|pid:none) Sus scrofa lens-specific calpain L... 40 0.033
AB007775_1(AB007775|pid:none) Gallus gallus mRNA for mu-calpain ... 40 0.033
BX649315_1(BX649315|pid:none) Zebrafish DNA sequence from clone ... 40 0.033
A55054(A55054) calpain (EC 3.4.22.17) large chain - fruit fly (D... 40 0.033
X78555_1(X78555|pid:none) D.melanogaster mRNA for calpain. 40 0.033
AK128124_1(AK128124|pid:none) Homo sapiens cDNA FLJ46245 fis, cl... 40 0.033
A91674_1(A91674|pid:none) Sequence 6 from Patent WO9824916. 40 0.033
EU623071_1(EU623071|pid:none) Ovis aries calpain 1 80 kDa subuni... 40 0.033
Z46891_1(Z46891|pid:none) D.melanogaster mRNA for Calpain. 40 0.033
BX649315_2(BX649315|pid:none) Zebrafish DNA sequence from clone ... 40 0.033
AK094150_1(AK094150|pid:none) Homo sapiens cDNA FLJ36831 fis, cl... 40 0.033
Y10552_1(Y10552|pid:none) H.sapiens mRNA for calpain-like protea... 40 0.033
U05678_1(U05678|pid:none) Sus scrofa skeletal muscle-specific ca... 40 0.033
(O15484) RecName: Full=Calpain-5; EC=3.4.22.-; AltName:... 40 0.033
BC155147_1(BC155147|pid:none) Danio rerio calpain 2, (m/II) larg... 40 0.033
BC027993_1(BC027993|pid:none) Homo sapiens calpain 9, mRNA (cDNA... 39 0.043
BC054941_1(BC054941|pid:none) Danio rerio calpain 1, (mu/I) larg... 39 0.043
BC079702_1(BC079702|pid:none) Xenopus laevis MGC81785 protein, m... 39 0.043
AB038463_1(AB038463|pid:none) Homo sapiens GC36 mRNA, complete c... 39 0.043
(O14815) RecName: Full=Calpain-9; EC=3.4.22.-; AltName:... 39 0.043
AB016726_1(AB016726|pid:none) Schistosoma japonicum mRNA for cal... 39 0.056
BC149844_1(BC149844|pid:none) Bos taurus calpain 3, (p94), mRNA ... 39 0.056
AB209087_1(AB209087|pid:none) Homo sapiens mRNA for Hypothetical... 39 0.056
AY808568_1(AY808568|pid:none) Schistosoma japonicum SJCHGC05999 ... 39 0.056
(Q8R4C0) RecName: Full=Calpain-5; EC=3.4.22.-; &AF4849... 39 0.056
AK171405_1(AK171405|pid:none) Mus musculus B6-derived CD11 +ve d... 39 0.074
(P97571) RecName: Full=Calpain-1 catalytic subunit; EC=... 39 0.074
AK149090_1(AK149090|pid:none) Mus musculus 2 days neonate sympat... 39 0.074
(O35350) RecName: Full=Calpain-1 catalytic subunit; EC=... 39 0.074
AK088547_1(AK088547|pid:none) Mus musculus 2 days neonate thymus... 39 0.074
BC050276_1(BC050276|pid:none) Mus musculus calpain 1, mRNA (cDNA... 39 0.074
(Q9VT65) RecName: Full=Calpain-B; EC=3.4.22.-; AltName:... 38 0.096
AY809820_1(AY809820|pid:none) Schistosoma japonicum SJCHGC08992 ... 38 0.096
AF062404_1(AF062404|pid:none) Drosophila melanogaster calpain mR... 38 0.096
AF044407_1(AF044407|pid:none) Schistosoma japonicum calpain mRNA... 38 0.096
BX936318_8(BX936318|pid:none) Zebrafish DNA sequence from clone ... 38 0.096
BC058748_1(BC058748|pid:none) Mus musculus calpain 9, mRNA (cDNA... 38 0.096
AY573920_1(AY573920|pid:none) Oncorhynchus mykiss calpain 2 cata... 37 0.16
BC123364_1(BC123364|pid:none) Xenopus laevis hypothetical protei... 37 0.16
BT058958_1(BT058958|pid:none) Salmo salar clone ssal-rgf-516-040... 37 0.16
FJ232589_1(FJ232589|pid:none) Gallus gallus breed Black-bone CAP... 37 0.16
AB181371_1(AB181371|pid:none) Oncorhynchus mykiss mRNA for m-cal... 37 0.16
BC075496_1(BC075496|pid:none) Xenopus tropicalis calpain 5, mRNA... 37 0.16
EF688014_1(EF688014|pid:none) Anas platyrhynchos calpain mRNA, p... 37 0.16
AF084459_1(AF084459|pid:none) Mus musculus calpain I large subun... 37 0.21
AY573919_1(AY573919|pid:none) Oncorhynchus mykiss calpain 1 cata... 37 0.21
(P00789) RecName: Full=Calpain-1 catalytic subunit; EC=... 37 0.21
FN357349_35(FN357349|pid:none) Schistosoma mansoni genome sequen... 37 0.21
EF507731_1(EF507731|pid:none) Gallus gallus calpain mRNA, comple... 37 0.21
(P34308) RecName: Full=Calpain clp-1; EC=3.4.22.-; &L2... 37 0.21
BT059271_1(BT059271|pid:none) Salmo salar clone ssal-rgf-537-341... 37 0.21
(Q27971) RecName: Full=Calpain-2 catalytic subunit; EC=... 37 0.28
EU328307_1(EU328307|pid:none) Sus scrofa ussuricus calpain 10 is... 37 0.28
BC108604_1(BC108604|pid:none) Xenopus laevis hypothetical protei... 37 0.28
FN318021_1(FN318021|pid:none) Schistosoma japonicum isolate Anhu... 37 0.28
AY639153_1(AY639153|pid:none) Gecarcinus lateralis calpain B (Ca... 37 0.28
BC076509_1(BC076509|pid:none) Danio rerio calpain 9, mRNA (cDNA ... 37 0.28
AB061521_1(AB061521|pid:none) Xenopus laevis mRNA for mu/m-calpa... 36 0.37
BX649315_3(BX649315|pid:none) Zebrafish DNA sequence from clone ... 36 0.37
DQ647669_1(DQ647669|pid:none) Sus scrofa domestica calpain 10 tr... 36 0.37
BC125867_1(BC125867|pid:none) Danio rerio zgc:153446, mRNA (cDNA... 36 0.37
AB362999_1(AB362999|pid:none) Bubalus bubalis mRNA for calpain 2... 36 0.37
BX004801_1(BX004801|pid:none) Zebrafish DNA sequence from clone ... 36 0.37
EU161096_1(EU161096|pid:none) Ovis aries calpain II 80 kDa subun... 36 0.37
AF497625_1(AF497625|pid:none) Mus musculus m-calpain 80 kDa larg... 35 0.62
AF261089_1(AF261089|pid:none) Homo sapiens calpain large polypep... 35 0.62
BC007686_1(BC007686|pid:none) Homo sapiens calpain 2, (m/II) lar... 35 0.62
AK316211_1(AK316211|pid:none) Homo sapiens cDNA, FLJ79110 comple... 35 0.62
U01181_1(U01181|pid:none) Sus scrofa m-calpain mRNA, partial cds. 35 0.62
AK124751_1(AK124751|pid:none) Homo sapiens cDNA FLJ42761 fis, cl... 35 0.62
D38117_1(D38117|pid:none) Mus musculus mRNA for m-calpain large ... 35 0.62
AK315179_1(AK315179|pid:none) Homo sapiens cDNA, FLJ96158, highl... 35 0.62
AK097247_1(AK097247|pid:none) Homo sapiens cDNA FLJ39928 fis, cl... 35 0.62
EF635248_1(EF635248|pid:none) Sus scrofa calpain 2 (Capn2) mRNA,... 35 0.62
(Q6J756) RecName: Full=Calpain-11; EC=3.4.22.-; AltName... 35 0.62
AB209855_1(AB209855|pid:none) Homo sapiens mRNA for Calpain 2, l... 35 0.62
AK154855_1(AK154855|pid:none) Mus musculus NOD-derived CD11c +ve... 35 0.62
Y10139_1(Y10139|pid:none) M.musculus mRNA for m-calpain. 35 0.62
(P17655) RecName: Full=Calpain-2 catalytic subunit; EC=... 35 0.62
AK150695_1(AK150695|pid:none) Mus musculus bone marrow macrophag... 35 0.62
BC157893_1(BC157893|pid:none) Homo sapiens calpain 8, mRNA (cDNA... 35 0.81
AY639152_1(AY639152|pid:none) Gecarcinus lateralis muscle-specif... 35 1.1
AY124009_1(AY124009|pid:none) Homarus americanus muscle-specific... 34 1.4
AK300107_1(AK300107|pid:none) Homo sapiens cDNA FLJ60880 complet... 34 1.4
AJ242832_1(AJ242832|pid:none) Homo sapiens mRNA for calpain. &A... 34 1.4
AY890553_1(AY890553|pid:none) Synthetic construct Homo sapiens c... 34 1.4
(Q9UMQ6) RecName: Full=Calpain-11; EC=3.4.22.-; AltName... 34 1.4
BC076557_1(BC076557|pid:none) Danio rerio zgc:92480, mRNA (cDNA ... 34 1.4
AL954831_9(AL954831|pid:none) Zebrafish DNA sequence from clone ... 34 1.8
(Q78EJ9) RecName: Full=Calpain-8; EC=3.4.22.53; AltName... 34 1.8
AK314054_1(AK314054|pid:none) Homo sapiens cDNA, FLJ94719, highl... 34 1.8
BC074555_1(BC074555|pid:none) Xenopus tropicalis calpain 2, (m/I... 33 2.4
AY518342_1(AY518342|pid:none) Oncorhynchus mykiss gill-specific ... 33 2.4
BC063733_1(BC063733|pid:none) Xenopus laevis hypothetical protei... 33 3.1
AF089096_1(AF089096|pid:none) Homo sapiens calpain-like protease... 33 3.1
AX236098_1(AX236098|pid:none) Sequence 1 from Patent WO0164919. 33 3.1
(Q9HC91) RecName: Full=Calpain-10; EC=3.4.22.-; AltName... 33 3.1
L25598_4(L25598|pid:none) Caenorhabditis elegans cosmid C06G4, c... 33 3.1
AK074807_1(AK074807|pid:none) Homo sapiens cDNA FLJ90326 fis, cl... 33 3.1
AF089091_1(AF089091|pid:none) Homo sapiens calpain-like protease... 33 3.1
AK296910_1(AK296910|pid:none) Homo sapiens cDNA FLJ54788 complet... 33 4.0
(A8MX76) RecName: Full=Calpain-14; EC=3.4.22.-; 33 4.0
BC052167_1(BC052167|pid:none) Mus musculus calpain 6, mRNA (cDNA... 33 4.0
AK092257_1(AK092257|pid:none) Homo sapiens cDNA FLJ34938 fis, cl... 33 4.0
(O35646) RecName: Full=Calpain-6; &A98728_1(A98728|pid:none) &Y... 33 4.0
AF282675_1(AF282675|pid:none) Danio rerio calpain 1 mRNA, comple... 33 4.0
FJ232590_1(FJ232590|pid:none) Gallus gallus breed Black-bone CAP... 32 5.3
AL132848_2(AL132848|pid:none) Caenorhabditis elegans YAC Y47H10A... 32 5.3
(Q95LP4) RecName: Full=Calpain-10; EC=3.4.22.-; AltName... 32 6.9
(Q4V8Q1) RecName: Full=Calpain 11; EC=3.4.22.-; AltName... 32 6.9
AC116305_65(AC116305|pid:none) Dictyostelium discoideum chromoso... 32 6.9
AY961084_10(AY961084|pid:none) Orbinia latreillii mitochondrion,... 32 9.0
(Q7RZP7) RecName: Full=Calpain-like protease palB/rim-13; ... 32 9.0
AY559315_1(AY559315|pid:none) Lycopersicon esculentum ethylene r... 32 9.0
CP000725_1813(CP000725|pid:none) Streptococcus gordonii str. Cha... 32 9.0
AP009380_1495(AP009380|pid:none) Porphyromonas gingivalis ATCC 3... 32 9.0
>(Q22036) RecName: Full=Calpain-5; EC=3.4.22.-; AltName:
Full=Sex-determining transformer protein 3;
&S71885(S71885;T23631) &U12921_1(U12921|pid:none)
&Z82277_1(Z82277|pid:none)
Length = 648
Score = 43.9 bits (102), Expect = 0.002
Identities = 25/106 (23%), Positives = 52/106 (49%), Gaps = 8/106 (7%)
Frame = +2
Query: 2 DNPKFFFETTQTSNTTIVLGKLSDIPKE--------TYIGFYIFKADKNCPFISLTANNL 157
+NP++ F+ + N +++ + + P E IG ++ K + N + TA +
Sbjct: 399 NNPQYIFDIP-SPNCSVMFALIQNDPSEGLKKREPFVTIGMHVMKVENNRQYRVHTAMHP 457
Query: 158 YSKTSFVNGIEVVHTQQQMPPGCYIIVPCTYDSRQEGSFTLTCYSD 295
+ + + +G V Q +P G Y+++P T+ +++ F L YSD
Sbjct: 458 IAISDYASGRSVYLHLQSLPRGRYLLIPTTFAPKEQTLFMLRVYSD 503
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3236559
Number of Hits to DB: 713,848,201
Number of extensions: 15121277
Number of successful extensions: 28485
Number of sequences better than 10.0: 149
Number of HSP's gapped: 28480
Number of HSP's successfully gapped: 150
Length of query: 124
Length of database: 1,051,180,864
Length adjustment: 90
Effective length of query: 34
Effective length of database: 759,890,554
Effective search space: 25836278836
Effective search space used: 25836278836
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 29 (15.8 bits)
|
| PSORT |
|
| VS (DIR, S) |
0 |
| VH (FL, L) |
0 |
| VF (FL, S) |
0 |
| AH (FL, L) |
0 |
| AF (FL, S) |
0 |
| SL (DIR, L) |
0 |
| SS (DIR, S) |
2 |
| SH (FL, L) |
0 |
| SF (FL, S) |
0 |
| CH (FL, L) |
0 |
| CF (FL, S) |
0 |
| FCL (DIR, L) |
0 |
| FC (DIR, S) |
0 |
| FC-IC (SUB) |
0 |