Contig-U13406-1
Contig ID Contig-U13406-1
Contig update 2002.12.18
Contig sequence
>Contig-U13406-1 (Contig-U13406-1Q) /CSM_Contig/Contig-U13406-1Q.Seq.d
AAAAAGAAACATAATGAAGTTAAATTATTATTACTTGGTGCTGGTGAATC
TGGTAAATCAACAATTTCAAAACAAATGAAAATTATTCATCAAAGTGGTT
ACAGTAATGAAGAAAGAAAAGAATTTAAACCAATTATTACAAGAAATATT
CTTGATAATATGAGAGTATTATTGGATGGAATGGGAAGACTTGGAATGAC
AATTGACCCAAGTAATTCAGACGCAGCAGTTATGATTAAAGAATTAACAT
CATTACAAGCATCAATTGTTACAGATTGTTGGGGAGAATTAAATGAAGAT
CAAGGTAAAAAGATAAAAGCCTTATGGACAGACCCAGGTGTCAAACAGGC
AATGAGAAGAGCAAATGAATTTAGTACATTACCAGATTCAGCTCCATATT
TCTTTGATAGTATAGATCGTATGACATCACCAGTTTATATTCCAACTGAT
CAAGATATTTTACATACTCGTGTTATGACAAGAGGTGTTCATGAAACAAA
CTTTGAAATTGGTAAAATCAAATTTAGATTAGTAGATGTTGGTGGTCAAC
GTTCTGAAAGAAAGAAATGGTTATCATGTTTCGATGATGTTACAGCAGTT
GTATTTTGTGTTGCCTTGTCCGAATATGATTTATTATTGTATGAAGATAA
TTCAACCAATCGTATGTTGGAAAGTTTACGTGTATTCAGTGATGTTTGCA
ATAGTTGGTTTGTAAATACTCCAATCATTTTATTCTTAAACAAATCTGAT
TTATTCAGAGAGAAAATCAAACATGTTGATCTCTCTGAAACTTTCCCAGA
ATATAAAGGTGGTAGAGATTACGAAAGAGCCTCAAACTATATCAAAGAAC
GTTTCTGGCAAATCAATAAAACCGAACAAAAAGCAATCTATTCTCATATC
ACTTGTGCCACCGATACAAATAATATTCGTGTCGTTTTTGAAGCTGTAAA
AGATATTATTTTCACTCAATGTGTTATGAAAGCTGGTTTATATTCTTAAA
ATAATTATAATAATAAAAAAAAAACAATTTTCAAAAAGAAAAAAAAAAAA
AAAAAAAAAAAAAA

Gap no gap
Contig length 1064
Chromosome number (1..6, M) 2
Chromosome length 8467578
Start point 6598161
End point 6597095
Strand (PLUS/MINUS) MINUS
Number of clones 4
Number of EST 4
Link to clone list U13406
List of clone(s)

est1=SSF589F,1,748
est2=SSA217F,312,698
est3=SSD594Z,462,1022
est4=SLB672E,783,1065
Translated Amino Acid sequence
KKKHNEVKLLLLGAGESGKSTISKQMKIIHQSGYSNEERKEFKPIITRNILDNMRVLLDG
MGRLGMTIDPSNSDAAVMIKELTSLQASIVTDCWGELNEDQGKKIKALWTDPGVKQAMRR
ANEFSTLPDSAPYFFDSIDRMTSPVYIPTDQDILHTRVMTRGVHETNFEIGKIKFRLVDV
GGQRSERKKWLSCFDDVTAVVFCVALSEYDLLLYEDNSTNRMLESLRVFSDVCNSWFVNT
PIILFLNKSDLFREKIKHVDLSETFPEYKGGRDYERASNYIKERFWQINKTEQKAIYSHI
TCATDTNNIRVVFEAVKDIIFTQCVMKAGLYS*nnynnkkktifkkkkkkkkkk


Translated Amino Acid sequence (All Frames)
Frame A:
KKKHNEVKLLLLGAGESGKSTISKQMKIIHQSGYSNEERKEFKPIITRNILDNMRVLLDG
MGRLGMTIDPSNSDAAVMIKELTSLQASIVTDCWGELNEDQGKKIKALWTDPGVKQAMRR
ANEFSTLPDSAPYFFDSIDRMTSPVYIPTDQDILHTRVMTRGVHETNFEIGKIKFRLVDV
GGQRSERKKWLSCFDDVTAVVFCVALSEYDLLLYEDNSTNRMLESLRVFSDVCNSWFVNT
PIILFLNKSDLFREKIKHVDLSETFPEYKGGRDYERASNYIKERFWQINKTEQKAIYSHI
TCATDTNNIRVVFEAVKDIIFTQCVMKAGLYS*nnynnkkktifkkkkkkkkkk


Frame B:
krnimklnyyylvlvnlvnqqfqnk*klfikvvtvmkkeknlnqllqeiflii*eyywme
wedle*qltqviqtqql*lkn*hhykhqllqivgen*mkikvkr*kpygqtqvsnrq*ee
qmnlvhyqiqlhisliv*iv*hhqfifqlikifyilvl*qevfmkqtlklvksnld**ml
vvnvlkerngyhvsmmlqqlyfvlpcpnmiyycmkiiqpivcwkvyvysvmfaivgl*il
qsfys*tnliyserksnmlislklsqnikvveitkepqtisknvsgksikpnkkqsilis
lvppiqiifvsflkl*kilfslnvl*klvyilkiiiiikkkqfskrkkkkkkkk


Frame C:
ket**s*iiitwcw*iw*innfktnenysskwlq**rkkri*tnyykkys**yesiigwn
gktwndn*pk*frrssyd*riniitsincyrllgrik*rsr*kdkslmdrprcqtgneks
k*i*yitrfssifl**yrsyditslysn*sryftyscydkrcs*nkl*nw*nqi*isrcw
wstf*kkemvimfr*cysscilcclvri*fiiv*r*fnqsyvgkftciq*clq*lvckys
nhfilkqi*fiqrenqtc*sl*nfpri*rw*rlrkslklyqrtflanq*nrtksnlfsyh
lchryk*yscrf*sckryyfhsmcyeswfiflk*l***kknnfqkekkkkkkkk


own update 2004. 6.10
Homology vs CSM-cDNA
Query= Contig-U13406-1 (Contig-U13406-1Q)
/CSM_Contig/Contig-U13406-1Q.Seq.d
(1064 letters)

Database: CSM
6905 sequences; 5,674,871 total letters


Score E
Sequences producing significant alignments: (bits) Value

Contig-U13406-1 (Contig-U13406-1Q) /CSM_Contig/Conti... 2010 0.0
Contig-U11678-1 (Contig-U11678-1Q) /CSM_Contig/Conti... 40 0.005
Contig-U11405-1 (Contig-U11405-1Q) /CSM_Contig/Conti... 38 0.019
Contig-U09760-1 (Contig-U09760-1Q) /CSM_Contig/Conti... 38 0.019
Contig-U12679-1 (Contig-U12679-1Q) /CSM_Contig/Conti... 36 0.075
Contig-U09791-1 (Contig-U09791-1Q) /CSM_Contig/Conti... 36 0.075
Contig-U06996-1 (Contig-U06996-1Q) /CSM_Contig/Conti... 36 0.075
Contig-U05244-1 (Contig-U05244-1Q) /CSM_Contig/Conti... 36 0.075
Contig-U01760-1 (Contig-U01760-1Q) /CSM_Contig/Conti... 36 0.075
Contig-U01607-1 (Contig-U01607-1Q) /CSM_Contig/Conti... 36 0.075

>Contig-U13406-1 (Contig-U13406-1Q) /CSM_Contig/Contig-U13406-1Q.Seq.d
Length = 1064

Score = 2010 bits (1014), Expect = 0.0
Identities = 1014/1014 (100%)
Strand = Plus / Plus


Query: 1 aaaaagaaacataatgaagttaaattattattacttggtgctggtgaatctggtaaatca 60
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1 aaaaagaaacataatgaagttaaattattattacttggtgctggtgaatctggtaaatca 60


Query: 61 acaatttcaaaacaaatgaaaattattcatcaaagtggttacagtaatgaagaaagaaaa 120
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 61 acaatttcaaaacaaatgaaaattattcatcaaagtggttacagtaatgaagaaagaaaa 120


Query: 121 gaatttaaaccaattattacaagaaatattcttgataatatgagagtattattggatgga 180
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 121 gaatttaaaccaattattacaagaaatattcttgataatatgagagtattattggatgga 180


Query: 181 atgggaagacttggaatgacaattgacccaagtaattcagacgcagcagttatgattaaa 240
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 181 atgggaagacttggaatgacaattgacccaagtaattcagacgcagcagttatgattaaa 240


Query: 241 gaattaacatcattacaagcatcaattgttacagattgttggggagaattaaatgaagat 300
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 241 gaattaacatcattacaagcatcaattgttacagattgttggggagaattaaatgaagat 300


Query: 301 caaggtaaaaagataaaagccttatggacagacccaggtgtcaaacaggcaatgagaaga 360
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 301 caaggtaaaaagataaaagccttatggacagacccaggtgtcaaacaggcaatgagaaga 360


Query: 361 gcaaatgaatttagtacattaccagattcagctccatatttctttgatagtatagatcgt 420
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 361 gcaaatgaatttagtacattaccagattcagctccatatttctttgatagtatagatcgt 420


Query: 421 atgacatcaccagtttatattccaactgatcaagatattttacatactcgtgttatgaca 480
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 421 atgacatcaccagtttatattccaactgatcaagatattttacatactcgtgttatgaca 480


Query: 481 agaggtgttcatgaaacaaactttgaaattggtaaaatcaaatttagattagtagatgtt 540
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 481 agaggtgttcatgaaacaaactttgaaattggtaaaatcaaatttagattagtagatgtt 540


Query: 541 ggtggtcaacgttctgaaagaaagaaatggttatcatgtttcgatgatgttacagcagtt 600
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 541 ggtggtcaacgttctgaaagaaagaaatggttatcatgtttcgatgatgttacagcagtt 600


Query: 601 gtattttgtgttgccttgtccgaatatgatttattattgtatgaagataattcaaccaat 660
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 601 gtattttgtgttgccttgtccgaatatgatttattattgtatgaagataattcaaccaat 660


Query: 661 cgtatgttggaaagtttacgtgtattcagtgatgtttgcaatagttggtttgtaaatact 720
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 661 cgtatgttggaaagtttacgtgtattcagtgatgtttgcaatagttggtttgtaaatact 720


Query: 721 ccaatcattttattcttaaacaaatctgatttattcagagagaaaatcaaacatgttgat 780
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 721 ccaatcattttattcttaaacaaatctgatttattcagagagaaaatcaaacatgttgat 780


Query: 781 ctctctgaaactttcccagaatataaaggtggtagagattacgaaagagcctcaaactat 840
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 781 ctctctgaaactttcccagaatataaaggtggtagagattacgaaagagcctcaaactat 840


Query: 841 atcaaagaacgtttctggcaaatcaataaaaccgaacaaaaagcaatctattctcatatc 900
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 841 atcaaagaacgtttctggcaaatcaataaaaccgaacaaaaagcaatctattctcatatc 900


Query: 901 acttgtgccaccgatacaaataatattcgtgtcgtttttgaagctgtaaaagatattatt 960
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 901 acttgtgccaccgatacaaataatattcgtgtcgtttttgaagctgtaaaagatattatt 960


Query: 961 ttcactcaatgtgttatgaaagctggtttatattcttaaaataattataataat 1014
||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 961 ttcactcaatgtgttatgaaagctggtttatattcttaaaataattataataat 1014


>Contig-U11678-1 (Contig-U11678-1Q) /CSM_Contig/Contig-U11678-1Q.Seq.d
Length = 1514

Score = 40.1 bits (20), Expect = 0.005
Identities = 32/36 (88%)
Strand = Plus / Plus


Query: 535 gatgttggtggtcaacgttctgaaagaaagaaatgg 570
||||||||||||||| | ||||||||||||||||
Sbjct: 841 gatgttggtggtcaaagaaatgaaagaaagaaatgg 876


Score = 30.2 bits (15), Expect = 4.6
Identities = 21/23 (91%)
Strand = Plus / Plus


Query: 37 ggtgctggtgaatctggtaaatc 59
|||||||||||| |||||||||
Sbjct: 361 ggtgctggtgaaagtggtaaatc 383


>Contig-U11405-1 (Contig-U11405-1Q) /CSM_Contig/Contig-U11405-1Q.Seq.d
Length = 1328

Score = 38.2 bits (19), Expect = 0.019
Identities = 19/19 (100%)
Strand = Plus / Plus


Query: 555 tgaaagaaagaaatggtta 573
|||||||||||||||||||
Sbjct: 932 tgaaagaaagaaatggtta 950


Database: CSM
Posted date: Jun 9, 2004 7:35 PM
Number of letters in database: 5,674,871
Number of sequences in database: 6905

Lambda K H
1.37 0.711 1.31

Gapped
Lambda K H
1.37 0.711 1.31


Matrix: blastn matrix:1 -3
Gap Penalties: Existence: 5, Extension: 2
Number of Hits to DB: 17,064
Number of Sequences: 6905
Number of extensions: 17064
Number of successful extensions: 2029
Number of sequences better than 10.0: 277
length of query: 1064
length of database: 5,674,871
effective HSP length: 16
effective length of query: 1048
effective length of database: 5,564,391
effective search space: 5831481768
effective search space used: 5831481768
T: 0
A: 40
X1: 6 (11.9 bits)
X2: 15 (29.7 bits)
S1: 12 (24.3 bits)
S2: 15 (30.2 bits)
dna update 2008.12. 9
Homology vs DNA
Query= Contig-U13406-1 (Contig-U13406-1Q) /CSM_Contig/Contig-U13406-1Q.Seq.d
(1064 letters)

Database: ddbj_A
92,845,959 sequences; 95,242,211,685 total letters

Searching..................................................done

Score E
Sequences producing significant alignments: (bits) Value N

(M25061) D.discoideum G protein alpha-subunit 2 mRNA, comple... 2010 0.0 1
(AC116924) Dictyostelium discoideum chromosome 2 map 6357117... 1576 0.0 1
(AU037405) Dictyostelium discoideum slug cDNA, clone SSD594. 1088 0.0 1
(AU075090) Dictyostelium discoideum slug cDNA, clone SSA217. 476 e-130 1
(AU072968) Dictyostelium discoideum slug cDNA, clone SSF589. 476 e-130 1
(AU033968) Dictyostelium discoideum slug cDNA, clone SLB672. 460 e-125 1
(L33847) Dictyostelium discoideum G protein alpha-7 subunit ... 68 6e-22 4
(U64319) Dictyostelium discoideum GTP-binding protein alpha ... 94 4e-21 3
(M25060) D.discoideum G protein alpha-subunit 1 mRNA, comple... 56 1e-20 5
(BP191532) Dugesia japonica cDNA, clone: 01791_HH, expressed... 76 3e-13 2
(EC824852) SME00003485 esmbsro2 Sawyeria marylandensis cDNA,... 56 5e-13 4
(BW238009) Ciona intestinalis cDNA, clone:citb058i17, 5' end... 56 1e-11 3
(BW293859) Ciona intestinalis cDNA, clone:cigd005m18, 5' end... 56 2e-11 3
(AC114261) Dictyostelium discoideum chromosome 2 map 126059-... 68 2e-11 5
(FF749154) XABT58365.fwd Gateway compatible cien cDNA librar... 56 2e-11 3
(S55498) G alpha 4=Guanine nucleotide-binding protein [Dicty... 64 5e-11 3
(AB066281) Ciona intestinalis CiGi1 for G protein alpha subu... 56 1e-10 3
(BD421143) Newly found genes, derived from Ciona intestinali... 56 1e-10 3
(AK116213) Ciona intestinalis cDNA, clone:citb015m10, full i... 56 1e-10 3
(C91463) Dictyostelium discoideum slug cDNA, clone SSK311. 50 6e-10 3
(BJ373959) Dictyostelium discoideum cDNA clone:ddc5h14, 3' e... 50 7e-10 3
(BJ364499) Dictyostelium discoideum cDNA clone:ddc31o24, 5' ... 68 1e-09 2
(BJ326939) Dictyostelium discoideum cDNA clone:dda18g17, 5' ... 68 1e-09 2
(FF744797) XABT55260.fwd Gateway compatible cien cDNA librar... 50 1e-09 3
(AB066282) Ciona intestinalis CiGi1 for G protein alpha subu... 56 3e-09 2
(BW255618) Ciona intestinalis cDNA, clone:citb081g04, 5' end... 48 3e-09 3
(FF935005) CBWU71199.b1 Yutaka Satou unpublished cDNA librar... 48 4e-09 3
(FF915066) CBWU58117.b1 Yutaka Satou unpublished cDNA librar... 48 5e-09 3
(BJ362766) Dictyostelium discoideum cDNA clone:ddc23l07, 5' ... 64 2e-08 2
(U20806) Dictyostelium discoideum guanine nucleotide-binding... 50 2e-08 3
(FF731711) XABT46046.fwd Gateway compatible cien cDNA librar... 46 6e-08 3
(FK091590) XABT143276.b1 Gateway compatible cien cDNA librar... 46 1e-07 3
(FF695591) XABT106635.fwd Gateway compatible cien cDNA libra... 46 2e-07 3
(CR382139) Debaryomyces hansenii chromosome G of strain CBS7... 48 2e-07 2
(EH013505) USDA-FP_186298 Lysiphlebus testaceipes adult whol... 68 7e-07 1
(EE004703) ROE00008639 Rhizopus oryzae Company Rhizopus oryz... 68 7e-07 1
(AA228634) RRAMCA407SK Brugia malayi adult male cDNA (SAW94N... 68 7e-07 1
(CS297211) Sequence 2 from Patent WO2006035208. 48 1e-06 2
(EC826584) SME00003428 esmbsro2 Sawyeria marylandensis cDNA,... 64 1e-05 1
(EC822271) SME00003794 esmbsro2 Sawyeria marylandensis cDNA,... 64 1e-05 1
(FG080463) UI-FF-IH0-aau-h-08-0-UI.r1 Ceratitis capitata adu... 42 1e-05 3
(CB097550) ku42b05.y1 Strongyloides ratti PA female naive pA... 40 2e-05 3
(CD523738) kw24c03.y1 Strongyloides ratti PA female naive pA... 40 2e-05 3
(AB025780) Octopus vulgaris OvGai mRNA for G protein alpha s... 52 5e-05 2
(FC820473) Sr_pAMT7_017m18_T7 S. ratti mixed stage pAMP Stro... 40 5e-05 3
(CZ528433) SRAA-aac55d05.b1 Strongyloides ratti whole genome... 40 5e-05 3
(C92850) Dictyostelium discoideum slug cDNA, clone SSF503. 38 7e-05 3
(AL409384) T3 end of clone AV0AA014E12 of library AV0AA from... 38 7e-05 4
(FF756085) XABT62973.fwd Gateway compatible cien cDNA librar... 46 1e-04 3
(FF872078) CBWU15778.b1 Yutaka Satou unpublished cDNA librar... 46 1e-04 3
(ES406551) MUT11-M20.x1d-t SHGC-MUT Mytilus californianus cD... 42 2e-04 2
(AU267942) Dictyostelium discoideum vegetative cDNA clone:VS... 60 2e-04 1
(FC818832) Sr_pAMT7_013b06_T7 S. ratti mixed stage pAMP Stro... 40 7e-04 2
(EH641916) EST13024 LK04 Laupala kohalensis cDNA clone 10610... 58 7e-04 1
(EH640357) EST11465 LK04 Laupala kohalensis cDNA clone 10610... 58 7e-04 1
(EH639560) EST10668 LK04 Laupala kohalensis cDNA clone 10610... 58 7e-04 1
(EH638832) EST9940 LK04 Laupala kohalensis cDNA clone 106102... 58 7e-04 1
(EH638095) EST9203 LK04 Laupala kohalensis cDNA clone 106102... 58 7e-04 1
(EH637757) EST8865 LK04 Laupala kohalensis cDNA clone 106102... 58 7e-04 1
(EH636720) EST7828 LK04 Laupala kohalensis cDNA clone 106102... 58 7e-04 1
(EH636462) EST7570 LK04 Laupala kohalensis cDNA clone 106102... 58 7e-04 1
(EH636415) EST7523 LK04 Laupala kohalensis cDNA clone 106102... 58 7e-04 1
(EH635977) EST7085 LK04 Laupala kohalensis cDNA clone 106102... 58 7e-04 1
(EH635787) EST6895 LK04 Laupala kohalensis cDNA clone 106102... 58 7e-04 1
(EH634420) EST5528 LK04 Laupala kohalensis cDNA clone 106102... 58 7e-04 1
(EH634332) EST5440 LK04 Laupala kohalensis cDNA clone 106102... 58 7e-04 1
(EH633813) EST4920 LK04 Laupala kohalensis cDNA clone 106102... 58 7e-04 1
(EH633444) EST4551 LK04 Laupala kohalensis cDNA clone 106102... 58 7e-04 1
(EH633321) EST4428 LK04 Laupala kohalensis cDNA clone 106102... 58 7e-04 1
(EH633249) EST4356 LK04 Laupala kohalensis cDNA clone 106102... 58 7e-04 1
(EH632583) EST3690 LK04 Laupala kohalensis cDNA clone 106102... 58 7e-04 1
(EH630892) EST1999 LK04 Laupala kohalensis cDNA clone 106102... 58 7e-04 1
(EH630743) EST1850 LK04 Laupala kohalensis cDNA clone 106102... 58 7e-04 1
(EH630707) EST1814 LK04 Laupala kohalensis cDNA clone 106102... 58 7e-04 1
(EH629951) EST1058 LK04 Laupala kohalensis cDNA clone 106102... 58 7e-04 1
(EH629059) EST166 LK01 Laupala kohalensis cDNA clone 1061020... 58 7e-04 1
(AB047083) Halocynthia roretzi HrGi-2 mRNA for G protein alp... 34 0.001 4
(FF887474) CBWU24939.b1 Yutaka Satou unpublished cDNA librar... 46 0.002 3
(FF717719) XABT35952.fwd Gateway compatible cien cDNA librar... 46 0.002 3
(AM823532) Nicotiana tabacum EST, clone nt005189062. 52 0.002 2
(DK151812) Oryzias latipes cDNA, clone: olec9a24, 5' end. 38 0.003 2
(FF728210) XABT43274.fwd Gateway compatible cien cDNA librar... 46 0.003 2
(FF982549) CBWU96481.b1 Yutaka Satou unpublished cDNA librar... 46 0.003 2
(FF904750) CBWU36554.b1 Yutaka Satou unpublished cDNA librar... 46 0.003 2
(FF712449) XABT32467.fwd Gateway compatible cien cDNA librar... 46 0.003 2
(DK140754) Oryzias latipes cDNA, clone: olec17a02, 5' end. 38 0.003 2
(FF745184) XABT55526.fwd Gateway compatible cien cDNA librar... 46 0.003 2
(DK139973) Oryzias latipes cDNA, clone: olec14n06, 5' end. 38 0.003 2
(FF706341) XABT27807.fwd Gateway compatible cien cDNA librar... 46 0.003 2
(FF979567) CBWU102980.b1 Yutaka Satou unpublished cDNA libra... 46 0.003 2
(DK092044) Oryzias latipes cDNA, clone: oleb8d07, 5' end. 38 0.003 2
(FK113171) XABT157660.b1 Gateway compatible cien cDNA librar... 46 0.003 2
(FF740272) XABT52247.fwd Gateway compatible cien cDNA librar... 46 0.003 2
(FK216106) XABT220931.b1 Gateway compatible cien cDNA librar... 46 0.003 2
(FK093860) XABT144676.b1 Gateway compatible cien cDNA librar... 46 0.003 2
(FF901275) CBWU33614.b1 Yutaka Satou unpublished cDNA librar... 46 0.003 2
(FF974578) CBWU95973.b1 Yutaka Satou unpublished cDNA librar... 46 0.003 2
(FF755849) XABT62821.fwd Gateway compatible cien cDNA librar... 46 0.003 2
(FF695344) XABT106469.fwd Gateway compatible cien cDNA libra... 46 0.003 2
(FF750038) XABT58937.fwd Gateway compatible cien cDNA librar... 46 0.003 2

>(M25061) D.discoideum G protein alpha-subunit 2 mRNA, complete cds.
Length = 1174

Score = 2010 bits (1014), Expect = 0.0
Identities = 1014/1014 (100%)
Strand = Plus / Plus


Query: 1 aaaaagaaacataatgaagttaaattattattacttggtgctggtgaatctggtaaatca 60
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 147 aaaaagaaacataatgaagttaaattattattacttggtgctggtgaatctggtaaatca 206


Query: 61 acaatttcaaaacaaatgaaaattattcatcaaagtggttacagtaatgaagaaagaaaa 120
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 207 acaatttcaaaacaaatgaaaattattcatcaaagtggttacagtaatgaagaaagaaaa 266


Query: 121 gaatttaaaccaattattacaagaaatattcttgataatatgagagtattattggatgga 180
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 267 gaatttaaaccaattattacaagaaatattcttgataatatgagagtattattggatgga 326


Query: 181 atgggaagacttggaatgacaattgacccaagtaattcagacgcagcagttatgattaaa 240
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 327 atgggaagacttggaatgacaattgacccaagtaattcagacgcagcagttatgattaaa 386


Query: 241 gaattaacatcattacaagcatcaattgttacagattgttggggagaattaaatgaagat 300
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 387 gaattaacatcattacaagcatcaattgttacagattgttggggagaattaaatgaagat 446


Query: 301 caaggtaaaaagataaaagccttatggacagacccaggtgtcaaacaggcaatgagaaga 360
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 447 caaggtaaaaagataaaagccttatggacagacccaggtgtcaaacaggcaatgagaaga 506


Query: 361 gcaaatgaatttagtacattaccagattcagctccatatttctttgatagtatagatcgt 420
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 507 gcaaatgaatttagtacattaccagattcagctccatatttctttgatagtatagatcgt 566


Query: 421 atgacatcaccagtttatattccaactgatcaagatattttacatactcgtgttatgaca 480
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 567 atgacatcaccagtttatattccaactgatcaagatattttacatactcgtgttatgaca 626


Query: 481 agaggtgttcatgaaacaaactttgaaattggtaaaatcaaatttagattagtagatgtt 540
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 627 agaggtgttcatgaaacaaactttgaaattggtaaaatcaaatttagattagtagatgtt 686


Query: 541 ggtggtcaacgttctgaaagaaagaaatggttatcatgtttcgatgatgttacagcagtt 600
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 687 ggtggtcaacgttctgaaagaaagaaatggttatcatgtttcgatgatgttacagcagtt 746


Query: 601 gtattttgtgttgccttgtccgaatatgatttattattgtatgaagataattcaaccaat 660
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 747 gtattttgtgttgccttgtccgaatatgatttattattgtatgaagataattcaaccaat 806


Query: 661 cgtatgttggaaagtttacgtgtattcagtgatgtttgcaatagttggtttgtaaatact 720
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 807 cgtatgttggaaagtttacgtgtattcagtgatgtttgcaatagttggtttgtaaatact 866


Query: 721 ccaatcattttattcttaaacaaatctgatttattcagagagaaaatcaaacatgttgat 780
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 867 ccaatcattttattcttaaacaaatctgatttattcagagagaaaatcaaacatgttgat 926


Query: 781 ctctctgaaactttcccagaatataaaggtggtagagattacgaaagagcctcaaactat 840
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 927 ctctctgaaactttcccagaatataaaggtggtagagattacgaaagagcctcaaactat 986


Query: 841 atcaaagaacgtttctggcaaatcaataaaaccgaacaaaaagcaatctattctcatatc 900
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 987 atcaaagaacgtttctggcaaatcaataaaaccgaacaaaaagcaatctattctcatatc 1046


Query: 901 acttgtgccaccgatacaaataatattcgtgtcgtttttgaagctgtaaaagatattatt 960
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1047 acttgtgccaccgatacaaataatattcgtgtcgtttttgaagctgtaaaagatattatt 1106


Query: 961 ttcactcaatgtgttatgaaagctggtttatattcttaaaataattataataat 1014
||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1107 ttcactcaatgtgttatgaaagctggtttatattcttaaaataattataataat 1160

Lambda K H
1.37 0.711 1.31

Matrix: blastn matrix:1 -3
Number of Sequences: 92845959
Number of Hits to DB: 1,342,709,929
Number of extensions: 88073441
Number of successful extensions: 7375896
Number of sequences better than 10.0: 680
Length of query: 1064
Length of database: 95,242,211,685
Length adjustment: 24
Effective length of query: 1040
Effective length of database: 97,308,875,965
Effective search space: 101201231003600
Effective search space used: 101201231003600
X1: 11 (21.8 bits)
S2: 22 (44.1 bits)

protein update 2009. 7. 7
Homology vs Protein
Query= Contig-U13406-1 (Contig-U13406-1Q) /CSM_Contig/Contig-U13406-1Q.Seq.d
(1064 letters)

Database: nrp_B
3,236,559 sequences; 1,051,180,864 total letters

Searching..................................................done

Score E
Sequences producing significant alignments: (bits) Value

(P16894) RecName: Full=Guanine nucleotide-binding protein alpha-... 340 5e-92
DQ182016_1(DQ182016|pid:none) Anopheles gambiae G(alpha)i mRNA, ... 334 3e-90
AF329891_1(AF329891|pid:none) Pisolithus sp. 441 G protein alpha... 330 5e-89
AF407334_1(AF407334|pid:none) Lentinula edodes guanine nucleotid... 329 1e-88
AB051903_1(AB051903|pid:none) Schizophyllum commune ScGP-B gene ... 327 4e-88
(P20353) RecName: Full=Guanine nucleotide-binding protein G(i) s... 326 7e-88
(P87032) RecName: Full=Guanine nucleotide-binding protein alpha-... 325 1e-87
AF370014_1(AF370014|pid:none) Leptosphaeria maculans G-protein a... 324 3e-87
AP007161_483(AP007161|pid:none) Aspergillus oryzae RIB40 genomic... 324 3e-87
(O74227) RecName: Full=Guanine nucleotide-binding protein subuni... 324 4e-87
AB239917_1(AB239917|pid:none) Alternaria alternata AGA1 gene for... 324 4e-87
AM270168_167(AM270168|pid:none) Aspergillus niger contig An08c01... 324 4e-87
AF448796_1(AF448796|pid:none) Penicillium marneffei G-alpha subu... 324 4e-87
(Q00743) RecName: Full=Guanine nucleotide-binding protein subuni... 323 5e-87
AF540394_1(AF540394|pid:none) Schistosoma mansoni trimeric G-pro... 323 8e-87
(P30683) RecName: Full=Guanine nucleotide-binding protein G(o) s... 322 1e-86
AY603976_1(AY603976|pid:none) Sitobion avenae guanine nucleotide... 321 2e-86
DQ458049_1(DQ458049|pid:none) Mycosphaerella graminicola G-prote... 320 7e-86
(O15976) RecName: Full=Guanine nucleotide-binding protein G(o) s... 319 9e-86
DQ656112_1(DQ656112|pid:none) Aplysia californica guanine nucleo... 319 9e-86
DQ656111_1(DQ656111|pid:none) Aplysia californica guanine nucleo... 319 1e-85
AJ294815_1(AJ294815|pid:none) Tapesia yallundae tyg1 gene for G ... 319 1e-85
(P30676) RecName: Full=Guanine nucleotide-binding protein G(i) s... 318 3e-85
AY634286_1(AY634286|pid:none) Caenorhabditis briggsae strain AF1... 318 3e-85
(P38404) RecName: Full=Guanine nucleotide-binding protein G(o) s... 317 5e-85
AB167957_1(AB167957|pid:none) Bombyx mori mRNA for G protein alp... 317 5e-85
(O13315) RecName: Full=Guanine nucleotide-binding protein subuni... 317 5e-85
AB025781_1(AB025781|pid:none) Octopus vulgaris OvGao mRNA for G ... 317 6e-85
DQ863321_1(DQ863321|pid:none) Penicillium marneffei GPA2-like pr... 316 8e-85
AM888285_1(AM888285|pid:none) Sordaria macrospora gsa1 gene for ... 316 8e-85
(P29348) RecName: Full=Guanine nucleotide-binding protein G(t) s... 316 1e-84
AB066282_1(AB066282|pid:none) Ciona intestinalis CiGi1 for G pro... 316 1e-84
AB022098_1(AB022098|pid:none) Halocynthia roretzi mRNA for G pro... 316 1e-84
AY814015_1(AY814015|pid:none) Schistosoma japonicum SJCHGC05797 ... 315 1e-84
(Q05425) RecName: Full=Guanine nucleotide-binding protein alpha-... 315 1e-84
AF011341_1(AF011341|pid:none) Magnaporthe grisea G alpha subunit... 315 2e-84
AB047082_1(AB047082|pid:none) Halocynthia roretzi HrGi-1 mRNA fo... 315 2e-84
(O42784) RecName: Full=Guanine nucleotide-binding protein subuni... 315 2e-84
DQ327708_1(DQ327708|pid:none) Schistosoma japonicum GTP-binding ... 315 2e-84
AY036905_1(AY036905|pid:none) Trichoderma atroviride protein GTP... 314 3e-84
(P30682) RecName: Full=Guanine nucleotide-binding protein G(i) s... 314 3e-84
(P51876) RecName: Full=Guanine nucleotide-binding protein G(i) s... 314 4e-84
AE013599_1135(AE013599|pid:none) Drosophila melanogaster chromos... 314 4e-84
(P16378) RecName: Full=Guanine nucleotide-binding protein G(o) s... 314 4e-84
(P50149) RecName: Full=Guanine nucleotide-binding protein G(t) s... 313 5e-84
AY254175_1(AY254175|pid:none) Mucor circinelloides G protein alp... 313 7e-84
AB066281_1(AB066281|pid:none) Ciona intestinalis CiGi1 for G pro... 313 7e-84
AK009388_1(AK009388|pid:none) Mus musculus adult male tongue cDN... 313 7e-84
(P38400) RecName: Full=Guanine nucleotide-binding protein G(i), ... 313 9e-84
FN318225_1(FN318225|pid:none) Schistosoma japonicum isolate Anhu... 312 1e-83
DQ917649_1(DQ917649|pid:none) Sus scrofa GBI2 mRNA, complete cds. 312 1e-83
(O74259) RecName: Full=Guanine nucleotide-binding protein subuni... 311 2e-83
(P50146) RecName: Full=Guanine nucleotide-binding protein G(i), ... 311 2e-83
BC063931_1(BC063931|pid:none) Xenopus tropicalis hypothetical pr... 311 2e-83
FN357320_6(FN357320|pid:none) Schistosoma mansoni genome sequenc... 311 2e-83
FN357329_24(FN357329|pid:none) Schistosoma mansoni genome sequen... 311 3e-83
(P04899) RecName: Full=Guanine nucleotide-binding protein G(i), ... 311 3e-83
AY327542_1(AY327542|pid:none) Phaeosphaeria nodorum G-alpha subu... 311 3e-83
(A8MTJ3) RecName: Full=Guanine nucleotide-binding protein G(t) s... 311 3e-83
CR859352_1(CR859352|pid:none) Pongo abelii mRNA; cDNA DKFZp469C1... 310 4e-83
BT019775_1(BT019775|pid:none) Homo sapiens guanine nucleotide bi... 310 4e-83
(P27044) RecName: Full=Guanine nucleotide-binding protein G(i), ... 310 6e-83
FJ958357_1(FJ958357|pid:none) Ovis aries GNAZ (GNAZ) mRNA, compl... 310 6e-83
L24550_1(L24550|pid:none) Gallus gallus G protein alpha subunit ... 310 7e-83
(P63096) RecName: Full=Guanine nucleotide-binding protein G(i), ... 310 7e-83
(P28052) RecName: Full=Guanine nucleotide-binding protein alpha-... 309 9e-83
BC084923_1(BC084923|pid:none) Xenopus laevis guanine nucleotide ... 309 9e-83
J03004_1(J03004|pid:none) Human guanine nucleotide-binding regul... 309 9e-83
DQ100319_1(DQ100319|pid:none) Uta stansburiana cone transducin m... 309 9e-83
(P08239) RecName: Full=Guanine nucleotide-binding protein G(o) s... 309 1e-82
DQ917648_1(DQ917648|pid:none) Sus scrofa GBI1 mRNA, complete cds. 309 1e-82
PDBN(1CIP)A MOL_ID: 1;MOL_ID: 1; MOLECULE: GUANINE NUCLEOTIDE-BI... 309 1e-82
(P10824) RecName: Full=Guanine nucleotide-binding protein G(i), ... 309 1e-82
BC155288_1(BC155288|pid:none) Danio rerio guanine nucleotide bin... 309 1e-82
(Q5RAD4) RecName: Full=Guanine nucleotide-binding protein G(i), ... 308 2e-82
DQ100316_1(DQ100316|pid:none) Uta stansburiana gustducin mRNA, c... 308 2e-82
(P09471) RecName: Full=Guanine nucleotide-binding protein G(o) s... 308 2e-82
AK157998_1(AK157998|pid:none) Mus musculus adult inner ear cDNA,... 308 3e-82
X12924_1(X12924|pid:none) Bovine mRNA for GTP-binding protein G39. 308 3e-82
M60162_1(M60162|pid:none) Human guanine nucleotide-binding regul... 308 3e-82
(P59215) RecName: Full=Guanine nucleotide-binding protein G(o) s... 308 3e-82
BC170086_1(BC170086|pid:none) Xenopus laevis G protein alpha sub... 307 4e-82
BC044123_1(BC044123|pid:none) Xenopus laevis alpha-subunit of G-... 307 4e-82
(Q9DC51) RecName: Full=Guanine nucleotide-binding protein G(k) s... 307 4e-82
BC049537_1(BC049537|pid:none) Danio rerio guanine nucleotide bin... 307 4e-82
L24551_1(L24551|pid:none) Gallus gallus G protein (Galpa i3-o) m... 307 4e-82
AY892781_1(AY892781|pid:none) Synthetic construct Homo sapiens c... 307 4e-82
(P08752) RecName: Full=Guanine nucleotide-binding protein G(i), ... 307 4e-82
BC014627_1(BC014627|pid:none) Homo sapiens guanine nucleotide bi... 307 4e-82
S71213_1(S71213|pid:none) G protein Gi2 alpha [mice, CBA/J, coch... 307 5e-82
BC170080_1(BC170080|pid:none) Xenopus laevis G protein alpha sub... 307 5e-82
(P38403) RecName: Full=Guanine nucleotide-binding protein G(k) s... 307 5e-82
AF200339_1(AF200339|pid:none) Gallus gallus cone-type transducin... 306 6e-82
(P19627) RecName: Full=Guanine nucleotide-binding protein G(z) s... 306 6e-82
M13963_1(M13963|pid:none) Mouse inhibitory G protein of adenylat... 306 6e-82
DQ917647_1(DQ917647|pid:none) Sus scrofa GBAK mRNA, complete cds. 306 6e-82
(P38401) RecName: Full=Guanine nucleotide-binding protein G(i), ... 306 6e-82
AY891138_1(AY891138|pid:none) Synthetic construct Homo sapiens c... 306 6e-82
(P08753) RecName: Full=Guanine nucleotide-binding protein G(k) s... 306 8e-82
BC053164_1(BC053164|pid:none) Danio rerio guanine nucleotide bin... 306 8e-82
DQ202703_1(DQ202703|pid:none) Cricetulus griseus guanine nucleot... 306 8e-82
BC059637_1(BC059637|pid:none) Danio rerio guanine nucleotide bin... 306 8e-82
BC122955_1(BC122955|pid:none) Xenopus tropicalis hypothetical pr... 306 1e-81
(Q9N2V6) RecName: Full=Guanine nucleotide-binding protein alpha-... 306 1e-81
(O70443) RecName: Full=Guanine nucleotide-binding protein G(z) s... 305 1e-81
AF050654_1(AF050654|pid:none) Ambystoma tigrinum cone transducin... 305 1e-81
AK167438_1(AK167438|pid:none) Mus musculus 15 days pregnant adul... 305 1e-81
(Q60W52) RecName: Full=Guanine nucleotide-binding protein alpha-... 305 2e-81
DQ202702_1(DQ202702|pid:none) Cricetulus griseus guanine nucleot... 305 2e-81
(O13055) RecName: Full=Guanine nucleotide-binding protein G(i) s... 305 2e-81
(P08754) RecName: Full=Guanine nucleotide-binding protein G(k) s... 305 2e-81
DQ202701_1(DQ202701|pid:none) Cricetulus griseus guanine nucleot... 305 2e-81
BC026326_1(BC026326|pid:none) Homo sapiens guanine nucleotide bi... 305 2e-81
M19182_1(M19182|pid:none) Homo sapiens guanine nucleotide-bindin... 304 3e-81
(P10825) RecName: Full=Guanine nucleotide-binding protein G(o) s... 304 3e-81
CQ871846_1(CQ871846|pid:none) Sequence 19 from Patent WO20040790... 304 4e-81
AB180747_1(AB180747|pid:none) Cyprinus carpio Galpha-t2 mRNA for... 304 4e-81
FJ455725_1(FJ455725|pid:none) Caenorhabditis remanei strain PB24... 304 4e-81
(Q9BIG5) RecName: Full=Guanine nucleotide-binding protein alpha-... 303 7e-81
RGXLOA(S02785)GTP-binding regulatory protein Go alpha chain - Af... 303 9e-81
AK056008_1(AK056008|pid:none) Homo sapiens cDNA FLJ31446 fis, cl... 303 9e-81
BC037333_1(BC037333|pid:none) Homo sapiens guanine nucleotide bi... 303 9e-81
NRL(1GIA) Gi alpha 1 (active form with bound gtp-gamma-s) - Rattus 303 9e-81
D90150_1(D90150|pid:none) Homo sapiens Gx-alpha gene for pertuss... 303 9e-81
(P19086) RecName: Full=Guanine nucleotide-binding protein G(z) s... 302 1e-80
EU571208_1(EU571208|pid:none) Petromyzon marinus short photorece... 302 1e-80
(Q61B55) RecName: Full=Guanine nucleotide-binding protein alpha-... 302 2e-80
RGRTO2(D40436;S12990)GTP-binding regulatory protein Go alpha cha... 301 2e-80
AY357297_1(AY357297|pid:none) Cryptococcus neoformans var. grubi... 301 2e-80
AY328525_1(AY328525|pid:none) Gekko gecko photoreceptor transduc... 301 2e-80
BT044658_1(BT044658|pid:none) Salmo salar clone ssal-rgf-002-092... 301 3e-80
BC168083_1(BC168083|pid:none) Xenopus tropicalis cDNA clone MGC:... 300 4e-80
(Q86FX7) RecName: Full=Guanine nucleotide-binding protein alpha-... 300 7e-80
BC026342_1(BC026342|pid:none) Homo sapiens guanine nucleotide bi... 299 1e-79
AF050653_1(AF050653|pid:none) Ambystoma tigrinum rod transducin ... 299 1e-79
(P38407) RecName: Full=Guanine nucleotide-binding protein G(t) s... 298 2e-79
AE017341_175(AE017341|pid:none) Cryptococcus neoformans var. neo... 298 2e-79
AY146577_1(AY146577|pid:none) Caenorhabditis remanei strain EM46... 298 2e-79
BC016995_1(BC016995|pid:none) Homo sapiens guanine nucleotide bi... 298 2e-79
AY146576_1(AY146576|pid:none) Caenorhabditis remanei strain PB26... 298 2e-79
AY146574_1(AY146574|pid:none) Caenorhabditis remanei strain PB24... 298 2e-79
AY146571_1(AY146571|pid:none) Caenorhabditis remanei strain PB23... 298 2e-79
BT045919_1(BT045919|pid:none) Salmo salar clone ssal-rgf-536-281... 298 2e-79
AK302330_1(AK302330|pid:none) Homo sapiens cDNA FLJ61190 complet... 298 2e-79
AK096299_1(AK096299|pid:none) Homo sapiens cDNA FLJ38980 fis, cl... 298 2e-79
AY391429_1(AY391429|pid:none) Danio rerio guanine nucleotide bin... 298 3e-79
(Q60XS3) RecName: Full=Guanine nucleotide-binding protein alpha-... 297 4e-79
AY146560_1(AY146560|pid:none) Caenorhabditis elegans strain CB49... 296 8e-79
S47614_1(S47614|pid:none) G-protein alpha i subunit [Homarus ame... 296 8e-79
AY146566_1(AY146566|pid:none) Caenorhabditis elegans strain AB3 ... 296 8e-79
EU257502_1(EU257502|pid:none) Cavia porcellus alpha-transducin (... 296 1e-78
AY146558_1(AY146558|pid:none) Caenorhabditis elegans strain DH42... 295 2e-78
AF292562_1(AF292562|pid:none) Strongyloides stercoralis G protei... 295 2e-78
AY146562_1(AY146562|pid:none) Caenorhabditis elegans strain CB48... 294 4e-78
(Q21917) RecName: Full=Guanine nucleotide-binding protein alpha-... 293 5e-78
(Q28300) RecName: Full=Guanine nucleotide-binding protein G(t) s... 293 9e-78
EU369353_1(EU369353|pid:none) Oncorhynchus mykiss G protein alph... 293 9e-78
AY677118_1(AY677118|pid:none) Homo sapiens Galphai2 protein mRNA... 293 9e-78
(P04695) RecName: Full=Guanine nucleotide-binding protein G(t) s... 292 1e-77
(P11488) RecName: Full=Guanine nucleotide-binding protein G(t) s... 292 2e-77
(P20612) RecName: Full=Guanine nucleotide-binding protein G(t) s... 292 2e-77
AF200338_1(AF200338|pid:none) Gallus gallus rod-type transducin ... 292 2e-77
FJ230781_1(FJ230781|pid:none) Drechslerella dactyloides G protei... 291 3e-77
AB180748_1(AB180748|pid:none) Cyprinus carpio Galpha-t1-1 mRNA f... 291 3e-77
NRL(1TNDA) Transducin (alpha subunit) complexed with the Nonhydr... 290 5e-77
BC075229_1(BC075229|pid:none) Xenopus laevis MGC84417 protein, m... 290 6e-77
(P54853) RecName: Full=Guanine nucleotide-binding protein subuni... 289 1e-76
EU571207_1(EU571207|pid:none) Petromyzon marinus long photorecep... 289 1e-76
AB083056_1(AB083056|pid:none) Helicobasidium mompa hga1-2 gene f... 288 2e-76
(O14438) RecName: Full=Guanine nucleotide-binding protein alpha-... 288 2e-76
NRL(1TNDB) Transducin (alpha subunit) complexed with the Nonhydr... 288 2e-76
NRL(1TAG) Transducin-alpha complexed with gdp and magnesium 288 3e-76
AM920428_1167(AM920428|pid:none) Penicillium chrysogenum Wiscons... 286 1e-75
X15088_1(X15088|pid:none) Human GNAT1 mRNA for transducin alpha-... 286 1e-75
AF452097_1(AF452097|pid:none) Trichoderma atroviride G protein a... 285 2e-75
AJ132944_1(AJ132944|pid:none) Sclerotinia sclerotiorum sgp1 gene... 283 6e-75
DQ993172_1(DQ993172|pid:none) Hypocrea jecorina G-alpha protein ... 283 7e-75
BT001768_1(BT001768|pid:none) Drosophila melanogaster RH09776 fu... 282 2e-74
AY170625_1(AY170625|pid:none) Penicillium marneffei G protein al... 281 3e-74
(P38408) RecName: Full=Guanine nucleotide-binding protein subuni... 280 8e-74
(P34043) RecName: Full=Guanine nucleotide-binding protein alpha-... 279 1e-73
AM888287_1(AM888287|pid:none) Sordaria macrospora partial gsa3 g... 278 3e-73
(O95837) RecName: Full=Guanine nucleotide-binding protein subuni... 278 3e-73
(P10823) RecName: Full=Guanine nucleotide-binding protein alpha-... 276 7e-73
AK304473_1(AK304473|pid:none) Homo sapiens cDNA FLJ61561 complet... 276 9e-73
AB274828_1(AB274828|pid:none) Capra hircus Gi2 mRNA for guanine ... 276 9e-73
EU057176_1(EU057176|pid:none) Helicoverpa assulta G(alpha)q mRNA... 276 9e-73
BC030027_1(BC030027|pid:none) Homo sapiens guanine nucleotide bi... 276 1e-72
(P30677) RecName: Full=Guanine nucleotide-binding protein subuni... 274 3e-72
AK126708_1(AK126708|pid:none) Homo sapiens cDNA FLJ44754 fis, cl... 274 3e-72
AB066503_1(AB066503|pid:none) Schizophyllum commune ScGP-A gene ... 273 6e-72
AY957405_1(AY957405|pid:none) Helicoverpa armigera GTP-binding p... 273 7e-72
AB105070_1(AB105070|pid:none) Bombyx mori mRNA for Gq-like G pro... 273 7e-72
AF521583_1(AF521583|pid:none) Loligo pealei visual iGq-alpha pro... 273 7e-72
AB006550_1(AB006550|pid:none) Ephydatia fluviatilis mRNA for G p... 271 3e-71
AK040065_1(AK040065|pid:none) Mus musculus 0 day neonate thymus ... 271 3e-71
AB271925_1(AB271925|pid:none) Sus scrofa GNAQ mRNA for guanine n... 270 5e-71
(P50148) RecName: Full=Guanine nucleotide-binding protein G(q) s... 270 5e-71
L79908_1(L79908|pid:none) Takifugu rubripes G protein alpha subu... 270 5e-71
L76256_1(L76256|pid:none) Homo sapiens G alpha q mRNA, 5' end of... 270 5e-71
AF011496_1(AF011496|pid:none) Homo sapiens GTP-binding protein a... 270 5e-71
AK147393_1(AK147393|pid:none) Mus musculus cDNA, RIKEN full-leng... 270 8e-71
AF234260_1(AF234260|pid:none) Rattus norvegicus heterotrimeric g... 269 1e-70
L47105_1(L47105|pid:none) Kluyveromyces lactis G protein alpha s... 269 1e-70
(O15975) RecName: Full=Guanine nucleotide-binding protein G(q) s... 268 2e-70
(O73819) RecName: Full=Guanine nucleotide-binding protein subuni... 268 2e-70
BC080940_1(BC080940|pid:none) Xenopus tropicalis guanine nucleot... 268 3e-70
(P28051) RecName: Full=Guanine nucleotide-binding protein alpha-... 268 3e-70
(Q4VT35) RecName: Full=Guanine nucleotide-binding protein alpha-... 267 4e-70
(P34042) RecName: Full=Guanine nucleotide-binding protein alpha-... 267 5e-70
(Q9XZV4) RecName: Full=Guanine nucleotide-binding protein G(q) s... 266 7e-70
BC108552_1(BC108552|pid:none) Xenopus laevis hypothetical protei... 266 9e-70
CR761976_1(CR761976|pid:none) Xenopus tropicalis finished cDNA, ... 266 9e-70
AJ851735_1(AJ851735|pid:none) Gallus gallus mRNA for hypothetica... 266 9e-70
BC011169_1(BC011169|pid:none) Mus musculus guanine nucleotide bi... 266 1e-69
AY487343_1(AY487343|pid:none) Sporothrix schenckii G-protein alp... 265 2e-69
FJ230780_1(FJ230780|pid:none) Arthrobotrys oligospora G protein ... 265 2e-69
(P34045) RecName: Full=Guanine nucleotide-binding protein alpha-... 265 2e-69
U37413_1(U37413|pid:none) Mus musculus guanine nucleotide-bindin... 265 2e-69
BC061608_1(BC061608|pid:none) Xenopus tropicalis guanine nucleot... 265 2e-69
AB045579_1(AB045579|pid:none) Rosellinia necatrix WGA3 gene for ... 265 2e-69
BC081126_1(BC081126|pid:none) Xenopus laevis guanine nucleotide ... 265 3e-69
(P38410) RecName: Full=Guanine nucleotide-binding protein G(q) s... 264 3e-69
AF157496_1(AF157496|pid:none) Suillus bovinus heterotrimeric G p... 264 3e-69
AY899210_1(AY899210|pid:none) Rattus norvegicus GTP-binding prot... 264 3e-69
(P43444) RecName: Full=Guanine nucleotide-binding protein subuni... 264 3e-69
AY626792_1(AY626792|pid:none) Litopenaeus vannamei heterotrimeri... 264 3e-69
AY534108_1(AY534108|pid:none) Strongylocentrotus purpuratus guan... 264 3e-69
AY534107_1(AY534107|pid:none) Lytechinus variegatus guanine nucl... 264 3e-69
AF306530_1(AF306530|pid:none) Schizophyllum commune heterotrimer... 264 3e-69
(Q9JID2) RecName: Full=Guanine nucleotide-binding protein subuni... 264 5e-69
(P38409) RecName: Full=Guanine nucleotide-binding protein subuni... 264 5e-69
FN357299_30(FN357299|pid:none) Schistosoma mansoni genome sequen... 264 5e-69
AE016815_371(AE016815|pid:none) Ashbya gossypii (= Eremothecium ... 263 8e-69
DQ397515_1(DQ397515|pid:none) Aplysia californica guanine nucleo... 263 1e-68
CP000498_625(CP000498|pid:none) Pichia stipitis CBS 6054 chromos... 263 1e-68
AF011342_1(AF011342|pid:none) Magnaporthe grisea G alpha subunit... 263 1e-68
CU459096_4(CU459096|pid:none) Zebrafish DNA sequence from clone ... 262 1e-68
CU640366_1097(CU640366|pid:none) Podospora anserina genomic DNA ... 262 2e-68
BC085433_1(BC085433|pid:none) Danio rerio zgc:101761, mRNA (cDNA... 262 2e-68
AY091588_1(AY091588|pid:none) Cryphonectria parasitica G-protein... 261 2e-68
(Q60MJ0) RecName: Full=Guanine nucleotide-binding protein alpha-... 261 3e-68
AB209435_1(AB209435|pid:none) Homo sapiens mRNA for Guanine nucl... 261 3e-68
AY168002_1(AY168002|pid:none) Hypocrea virens G protein alpha su... 261 3e-68
BX005248_1(BX005248|pid:none) Zebrafish DNA sequence from clone ... 261 3e-68
AF157495_1(AF157495|pid:none) Schizophyllum commune heterotrimer... 261 4e-68
L33847_1(L33847|pid:none) Dictyostelium discoideum G protein alp... 260 5e-68
CR382127_296(CR382127|pid:none) Yarrowia lipolytica strain CLIB1... 260 5e-68
(P22454) RecName: Full=Guanine nucleotide-binding protein alpha-... 260 5e-68
FJ362377_4(FJ362377|pid:none) Caenorhabditis sp. PS1010 contig J... 260 7e-68
M69013_1(M69013|pid:none) Human guanine nucleotide-binding regul... 259 1e-67
CQ830630_1(CQ830630|pid:none) Sequence 1 from Patent WO2004055048. 259 1e-67
AB051904_1(AB051904|pid:none) Schizophyllum commune ScGP-C gene ... 259 1e-67
T32578(T32578)hypothetical protein T07A9.7 - Caenorhabditis eleg... 259 1e-67
BC077141_1(BC077141|pid:none) Danio rerio zgc:100942, mRNA (cDNA... 258 2e-67
AJ294816_1(AJ294816|pid:none) Tapesia yallundae tyg2 gene for G ... 258 2e-67
FJ455134_1(FJ455134|pid:none) Gibberella moniliformis G protein ... 258 2e-67
AY301989_1(AY301989|pid:none) Penicillium marneffei G-alpha subu... 258 3e-67
DQ066424_1(DQ066424|pid:none) Caenorhabditis remanei strain EM46... 258 3e-67
AF201328_1(AF201328|pid:none) Panulirus argus Gq/11 protein alph... 257 4e-67
EU170368_1(EU170368|pid:none) Dipolydora quadrilobata guanine nu... 257 4e-67
CU928169_56(CU928169|pid:none) Kluyveromyces thermotolerans stra... 257 6e-67
AB006548_1(AB006548|pid:none) Ephydatia fluviatilis mRNA for G p... 256 7e-67
(Q54R41) RecName: Full=Guanine nucleotide-binding protein alpha-... 256 7e-67
AB025782_1(AB025782|pid:none) Octopus vulgaris OvGaq mRNA for G ... 256 9e-67
AK035320_1(AK035320|pid:none) Mus musculus adult male urinary bl... 256 9e-67
BC162964_1(BC162964|pid:none) Danio rerio guanine nucleotide bin... 256 9e-67
CR382139_99(CR382139|pid:none) Debaryomyces hansenii strain CBS7... 256 1e-66
AY634285_1(AY634285|pid:none) Caenorhabditis briggsae strain AF1... 255 2e-66
AF004846_1(AF004846|pid:none) Neurospora crassa G protein alpha ... 255 2e-66
(Q05424) RecName: Full=Guanine nucleotide-binding protein alpha-... 255 2e-66
AX657506_1(AX657506|pid:none) Sequence 89 from Patent WO03000893. 254 4e-66
AY371698_1(AY371698|pid:none) Cryptococcus neoformans var. grubi... 253 6e-66
AJ250443_1(AJ250443|pid:none) Calliphora vicina mRNA for guanine... 253 8e-66
AP007151_631(AP007151|pid:none) Aspergillus oryzae RIB40 genomic... 252 1e-65
DQ156150_9(DQ156150|pid:none) Salmo salar BAC S0188I22, partial ... 252 1e-65
(Q04665) RecName: Full=Guanine nucleotide-binding protein alpha-... 252 2e-65
AB425233_1(AB425233|pid:none) Bombyx mori Gq mRNA for G protein ... 251 4e-65
AM270019_27(AM270019|pid:none) Aspergillus niger contig An02c024... 250 5e-65
AY369812_1(AY369812|pid:none) Pan troglodytes guanine nucleotide... 250 5e-65
AY369813_1(AY369813|pid:none) Macaca mulatta guanine nucleotide-... 250 5e-65
FM992692_479(FM992692|pid:none) Candida dubliniensis CD36 chromo... 249 9e-65
AM920433_161(AM920433|pid:none) Penicillium chrysogenum Wisconsi... 249 9e-65
AY550248_1(AY550248|pid:none) Paracoccidioides brasiliensis smal... 248 2e-64
M14207_1(M14207|pid:none) Cow GTP-binding protein alpha-h subuni... 248 3e-64
JN0115(JN0115)GTP-binding regulatory protein dgq alpha chain - f... 247 4e-64
CP000496_1010(CP000496|pid:none) Pichia stipitis CBS 6054 chromo... 247 4e-64
AB006549_1(AB006549|pid:none) Ephydatia fluviatilis mRNA for G p... 246 1e-63
(P34044) RecName: Full=Guanine nucleotide-binding protein alpha-... 246 1e-63
(P30679) RecName: Full=Guanine nucleotide-binding protein subuni... 245 2e-63
BC134004_1(BC134004|pid:none) Danio rerio guanine nucleotide bin... 244 4e-63
AK055574_1(AK055574|pid:none) Homo sapiens cDNA FLJ31012 fis, cl... 244 4e-63
A46393(A46393)GTP-binding protein alpha chain gpa2 - fission yea... 244 4e-63
AY534101_1(AY534101|pid:none) Strongylocentrotus purpuratus guan... 244 4e-63
AK291329_1(AK291329|pid:none) Homo sapiens cDNA FLJ76843 complet... 243 6e-63
(Q14344) RecName: Full=Guanine nucleotide-binding protein subuni... 243 1e-62
DQ156149_9(DQ156149|pid:none) Salmo salar clone BAC S0085O16, pa... 242 1e-62
U30792_1(U30792|pid:none) Pneumocystis carinii guanine nucleotid... 241 2e-62
(P27600) RecName: Full=Guanine nucleotide-binding protein subuni... 241 3e-62
(Q61DE0) RecName: Full=Guanine nucleotide-binding protein alpha-... 241 3e-62
(Q63210) RecName: Full=Guanine nucleotide-binding protein subuni... 240 5e-62
AY386360_1(AY386360|pid:none) Danio rerio G-protein alpha 13a mR... 240 7e-62
BC095814_1(BC095814|pid:none) Danio rerio guanine nucleotide bin... 240 7e-62
DQ202707_1(DQ202707|pid:none) Cricetulus griseus guanine nucleot... 240 7e-62
(P27601) RecName: Full=Guanine nucleotide-binding protein subuni... 239 9e-62
AK149766_1(AK149766|pid:none) Mus musculus bone marrow macrophag... 239 9e-62
(Q20907) RecName: Full=Guanine nucleotide-binding protein alpha-... 239 2e-61
(Q9TU29) RecName: Full=Guanine nucleotide-binding protein subuni... 239 2e-61
AF493901_1(AF493901|pid:none) Homo sapiens guanine nucleotide bi... 239 2e-61
(Q03113) RecName: Full=Guanine nucleotide-binding protein subuni... 239 2e-61
(P30678) RecName: Full=Guanine nucleotide-binding protein subuni... 238 2e-61
BT059303_1(BT059303|pid:none) Salmo salar clone ssal-rgf-540-070... 238 2e-61
AE013599_1607(AE013599|pid:none) Drosophila melanogaster chromos... 238 3e-61
AY534102_1(AY534102|pid:none) Lytechinus variegatus guanine nucl... 238 3e-61
DQ458050_1(DQ458050|pid:none) Mycosphaerella graminicola G-prote... 237 5e-61
BC087537_1(BC087537|pid:none) Homo sapiens guanine nucleotide bi... 237 5e-61
BC057665_1(BC057665|pid:none) Mus musculus guanine nucleotide bi... 237 6e-61
AY292281_1(AY292281|pid:none) Synthetic construct rod transducin... 237 6e-61
DQ156149_10(DQ156149|pid:none) Salmo salar clone BAC S0085O16, p... 236 8e-61
AY542969_1(AY542969|pid:none) Bigelowiella natans guanine nucleo... 236 1e-60
BC085540_1(BC085540|pid:none) Danio rerio guanine nucleotide bin... 236 1e-60
(Q61MC6) RecName: Full=Guanine nucleotide-binding protein alpha-... 235 2e-60
BC161136_1(BC161136|pid:none) Xenopus tropicalis hypothetical pr... 235 2e-60
BC088948_1(BC088948|pid:none) Xenopus laevis hypothetical LOC496... 234 3e-60
AB003486_1(AB003486|pid:none) Caenorhabditis elegans mRNA for G ... 234 4e-60
AY634306_1(AY634306|pid:none) Caenorhabditis briggsae strain AF1... 234 4e-60
AE013599_1606(AE013599|pid:none) Drosophila melanogaster chromos... 231 3e-59
BC168579_1(BC168579|pid:none) Xenopus tropicalis cDNA clone MGC:... 231 3e-59
CQ760002_1(CQ760002|pid:none) Sequence 28 from Patent EP1382613. 230 6e-59
AL953843_1(AL953843|pid:none) Zebrafish DNA sequence from clone ... 230 7e-59
AY576989_1(AY576989|pid:none) Danio rerio clone RK054A1C04 GNAS ... 230 7e-59
BC149402_1(BC149402|pid:none) Bos taurus guanine nucleotide bind... 230 7e-59
BC078439_1(BC078439|pid:none) Mus musculus guanine nucleotide bi... 229 1e-58
BC050021_1(BC050021|pid:none) Homo sapiens guanine nucleotide bi... 229 1e-58
AB006541_1(AB006541|pid:none) Hydra magnipapillata mRNA for G pr... 229 1e-58
AY248719_1(AY248719|pid:none) Oryctolagus cuniculus guanine nucl... 229 2e-58
BC170038_1(BC170038|pid:none) Xenopus laevis GNAS complex locus,... 229 2e-58
D87723(D87723)protein R06A10.2 [imported] - Caenorhabditis elegans 229 2e-58
BC066923_1(BC066923|pid:none) Homo sapiens GNAS complex locus, m... 228 3e-58
AL109840_15(AL109840|pid:none) Human DNA sequence from clone RP4... 228 3e-58
M13964_1(M13964|pid:none) Mouse stimulatory G protein of adenyla... 228 3e-58
AL593857_10(AL593857|pid:none) Mouse DNA sequence from clone RP2... 228 3e-58
(P24799) RecName: Full=Guanine nucleotide-binding protein G(s) s... 228 3e-58
BC063735_1(BC063735|pid:none) Xenopus laevis hypothetical protei... 228 4e-58
AK158831_1(AK158831|pid:none) Mus musculus visual cortex cDNA, R... 228 4e-58
AB047087_1(AB047087|pid:none) Halocynthia roretzi HrGs mRNA for ... 227 6e-58
AF003739_2(AF003739|pid:none) Caenorhabditis elegans cosmid M01D... 226 8e-58
AL593857_5(AL593857|pid:none) Mouse DNA sequence from clone RP23... 226 1e-57
CR956413_6(CR956413|pid:none) Pig DNA sequence from clone CH242-... 226 1e-57
BC022875_1(BC022875|pid:none) Homo sapiens, Similar to GNAS comp... 226 1e-57
AF116268_1(AF116268|pid:none) Mus musculus G-protein XLalphas mR... 226 1e-57
AL109840_3(AL109840|pid:none) Human DNA sequence from clone RP4-... 226 1e-57
AL121917_14(AL121917|pid:none) Human DNA sequence from clone RP1... 226 1e-57
AB006545_1(AB006545|pid:none) Ephydatia fluviatilis mRNA for G p... 226 1e-57
AK147051_1(AK147051|pid:none) Mus musculus cDNA, RIKEN full-leng... 226 1e-57
(P08539) RecName: Full=Guanine nucleotide-binding protein alpha-... 226 1e-57
(Q7PD79) RecName: Full=Guanine nucleotide-binding protein G(s) s... 226 1e-57
M17414_1(M17414|pid:none) Saccharomyces cerevisiae SCG1 gene enc... 225 2e-57
AB006546_1(AB006546|pid:none) Ephydatia fluviatilis mRNA for G p... 225 2e-57
T23705(T23705)hypothetical protein M04C7.1 - Caenorhabditis eleg... 225 2e-57
BC106133_1(BC106133|pid:none) Mus musculus GNAS (guanine nucleot... 225 2e-57
S27015(S27015;S25590)GTP-binding regulatory protein Gs alpha cha... 225 2e-57
BC076540_1(BC076540|pid:none) Danio rerio zgc:92392, mRNA (cDNA ... 224 3e-57
AY534105_1(AY534105|pid:none) Strongylocentrotus purpuratus guan... 224 3e-57
EF188807_1(EF188807|pid:none) Bombyx mori strain P50 G protein a... 223 9e-57
DQ288161_1(DQ288161|pid:none) Mucor circinelloides GPA4 (gpa4) g... 222 2e-56
AE013599_3968(AE013599|pid:none) Drosophila melanogaster chromos... 222 2e-56
(P34046) RecName: Full=Guanine nucleotide-binding protein alpha-... 222 2e-56
(O16118) RecName: Full=Guanine nucleotide-binding protein G(s) s... 222 2e-56
(Q292P9) RecName: Full=Guanine nucleotide-binding protein G(s) s... 221 3e-56
(P29797) RecName: Full=Guanine nucleotide-binding protein G(s) s... 221 3e-56
CU928181_26(CU928181|pid:none) Zygosaccharomyces rouxii strain C... 221 3e-56
(P25157) RecName: Full=Guanine nucleotide-binding protein subuni... 220 6e-56
A41106(A41106) GTP-binding protein alpha chain gpa1 - fission ye... 219 1e-55
AK168996_1(AK168996|pid:none) Mus musculus 17 days embryo stomac... 219 1e-55
(Q6R0H7) RecName: Full=Guanine nucleotide-binding protein G(s) s... 219 1e-55
AY892114_1(AY892114|pid:none) Synthetic construct Homo sapiens c... 219 1e-55
X07036_1(X07036|pid:none) Human mRNA stimulatory GTP-binding pro... 219 1e-55
RGMSA2(S03075) GTP-binding regulatory protein Gs alpha-S2 chain ... 219 1e-55
(P04896) RecName: Full=Guanine nucleotide-binding protein G(s) s... 219 1e-55
AL109840_17(AL109840|pid:none) Human DNA sequence from clone RP4... 219 1e-55
(P63093) RecName: Full=Guanine nucleotide-binding protein G(s) s... 219 1e-55
CR956413_3(CR956413|pid:none) Pig DNA sequence from clone CH242-... 219 1e-55
AL109840_2(AL109840|pid:none) Human DNA sequence from clone RP4-... 219 2e-55
AB006544_1(AB006544|pid:none) Ephydatia fluviatilis mRNA for G p... 219 2e-55
AB274829_1(AB274829|pid:none) Capra hircus Golf mRNA for guanine... 219 2e-55
DQ413186_1(DQ413186|pid:none) Sepia officinalis visual iGq-alpha... 218 3e-55
BX649295_2(BX649295|pid:none) Zebrafish DNA sequence from clone ... 218 4e-55
(Q19572) RecName: Full=Guanine nucleotide-binding protein alpha-... 217 6e-55
(P27584) RecName: Full=Guanine nucleotide-binding protein alpha-... 217 6e-55
(Q63803) RecName: Full=Guanine nucleotide-binding protein G(s) s... 216 8e-55
X84047_1(X84047|pid:none) Rattus norvegicus mRNA for XLalphas pr... 216 8e-55
S52418(S52418)GTP-binding regulatory protein Gs alpha-XL chain -... 216 8e-55
AE016817_554(AE016817|pid:none) Ashbya gossypii (= Eremothecium ... 216 1e-54
(P30669) RecName: Full=Guanine nucleotide-binding protein G(s) s... 215 2e-54
AK159563_1(AK159563|pid:none) Mus musculus osteoclast-like cell ... 215 2e-54
CR382136_587(CR382136|pid:none) Debaryomyces hansenii strain CBS... 214 5e-54
AY634289_1(AY634289|pid:none) Caenorhabditis briggsae strain AF1... 213 7e-54
AF107844_2(AF107844|pid:none) Rattus norvegicus neuroendocrine-s... 213 9e-54
BC036081_1(BC036081|pid:none) Homo sapiens GNAS complex locus, m... 213 1e-53
CU928167_40(CU928167|pid:none) Kluyveromyces thermotolerans stra... 213 1e-53
AB274883_1(AB274883|pid:none) Mauremys reevesii mRNA for guanine... 212 2e-53
AB006540_1(AB006540|pid:none) Hydra magnipapillata hyGa-2 mRNA f... 210 6e-53
(Q9XZV5) RecName: Full=Guanine nucleotide-binding protein G(s) s... 210 8e-53
S34421(S34421;S40964) GTP-binding regulatory protein Gs alpha ch... 210 8e-53
T09152(T09152) GTP-binding regulatory protein alpha chain - spin... 210 8e-53
AY815795_1(AY815795|pid:none) Schistosoma japonicum SJCHGC09316 ... 209 1e-52
AB172008_1(AB172008|pid:none) Macaca fascicularis brain cDNA clo... 209 1e-52
U64319_1(U64319|pid:none) Dictyostelium discoideum GTP-binding p... 209 2e-52
AF010476_1(AF010476|pid:none) Avena fatua Af12-amino acid (Af12-... 208 2e-52
EU489474_1(EU489474|pid:none) Scoparia dulcis heterotrimeric GTP... 208 2e-52
AF135552_1(AF135552|pid:none) Kluyveromyces lactis heterotrimeri... 208 2e-52
EU142020_1(EU142020|pid:none) Phaseolus vulgaris hetrotrimeric G... 207 4e-52
(Q93743) RecName: Full=Guanine nucleotide-binding protein alpha-... 207 4e-52
(Q9Y7B7) RecName: Full=Guanine nucleotide-binding protein alpha-... 207 4e-52
(Q54VG1) RecName: Full=Guanine nucleotide-binding protein alpha-... 207 7e-52
BX649295_4(BX649295|pid:none) Zebrafish DNA sequence from clone ... 207 7e-52
CR380952_270(CR380952|pid:none) Candida glabrata strain CBS138 c... 206 1e-51
(P26981) RecName: Full=Guanine nucleotide-binding protein alpha-... 206 1e-51
BT060740_1(BT060740|pid:none) Zea mays full-length cDNA clone ZM... 205 2e-51
AF533439_1(AF533439|pid:none) Pisum sativum G protein alpha II s... 204 3e-51
AB192569_1(AB192569|pid:none) Lyophyllum shimeji gpa1 gene for g... 204 4e-51
EU069505_1(EU069505|pid:none) Sorghum bicolor G protein alpha su... 204 6e-51
AF533438_1(AF533438|pid:none) Pisum sativum G protein alpha II s... 204 6e-51
(O04279) RecName: Full=Guanine nucleotide-binding protein alpha-... 203 7e-51
(P93564) RecName: Full=Guanine nucleotide-binding protein alpha-... 203 7e-51
AY063128_1(AY063128|pid:none) Solanum tuberosum G protein alpha ... 203 1e-50
CR956413_7(CR956413|pid:none) Pig DNA sequence from clone CH242-... 201 3e-50
(Q4VT31) RecName: Full=Guanine nucleotide-binding protein alpha-... 201 5e-50
U11250_1(U11250|pid:none) Sus scrofa Gi-alpha-2 protein mRNA, pa... 200 8e-50
(P18064) RecName: Full=Guanine nucleotide-binding protein alpha-... 200 8e-50
(Q40224) RecName: Full=Guanine nucleotide-binding protein alpha-... 199 1e-49
EU142021_1(EU142021|pid:none) Phaseolus vulgaris hetrotrimeric G... 199 1e-49
AK295088_1(AK295088|pid:none) Homo sapiens cDNA FLJ55310 complet... 199 1e-49
AP008211_854(AP008211|pid:none) Oryza sativa (japonica cultivar-... 199 2e-49
AB234091_1(AB234091|pid:none) Phaseolus lunatus PlGPA2 mRNA for ... 198 3e-49
EF095216_1(EF095216|pid:none) Daucus carota GTP-binding protein ... 197 4e-49
(P49082) RecName: Full=Guanine nucleotide-binding protein alpha-... 197 7e-49
AB066594_1(AB066594|pid:none) Nicotiana tomentosiformis NtGA2t g... 197 7e-49
AF249742_1(AF249742|pid:none) Nicotiana tabacum heterotrimeric G... 196 9e-49
FN357726_16(FN357726|pid:none) Schistosoma mansoni genome sequen... 196 9e-49
(Q05337) RecName: Full=Guanine nucleotide-binding protein G(f) s... 196 9e-49
AB066592_1(AB066592|pid:none) Nicotiana tabacum NtGA1 gene for h... 196 2e-48
AF267485_1(AF267485|pid:none) Hordeum vulgare G protein alpha su... 196 2e-48
(P49084) RecName: Full=Guanine nucleotide-binding protein alpha-... 195 2e-48
CP001141_76(CP001141|pid:none) Phaeodactylum tricornutum CCAP 10... 193 8e-48
AB006539_1(AB006539|pid:none) Hydra magnipapillata mRNA for G pr... 193 8e-48
(Q4VT42) RecName: Full=Guanine nucleotide-binding protein alpha-... 193 8e-48
GQ223793_1(GQ223793|pid:none) Nicotiana benthamiana heterotrimer... 193 8e-48
AB066591_1(AB066591|pid:none) Nicotiana tabacum NtGA2 gene for h... 193 1e-47
L28001_1(L28001|pid:none) Rice G protein alpha-subunit (RGA1) mR... 192 2e-47
AK302400_1(AK302400|pid:none) Homo sapiens cDNA FLJ50732 complet... 192 2e-47
AB435550_1(AB435550|pid:none) Carybdea rastonii cuboGs mRNA for ... 191 4e-47
JH0813(JH0813)GTP-binding regulatory protein Gs alpha chain isof... 191 5e-47
AB220439_1(AB220439|pid:none) Macaca fascicularis mRNA, clone Qc... 190 6e-47
(Q20910) RecName: Full=Guanine nucleotide-binding protein alpha-... 190 8e-47
AL671854_10(AL671854|pid:none) Mouse DNA sequence from clone RP2... 190 8e-47
U11249_1(U11249|pid:none) Sus scrofa Gi-alpha-1 protein mRNA, pa... 189 1e-46
T29826(T29826)hypothetical protein C55H1.2 - Caenorhabditis eleg... 189 1e-46
AK295830_1(AK295830|pid:none) Homo sapiens cDNA FLJ55846 complet... 189 2e-46
S56670(S56670;S56669)GTP-binding regulatory protein alpha chain ... 189 2e-46
BC048834_1(BC048834|pid:none) Mus musculus GNAS (guanine nucleot... 188 2e-46
AY650382_1(AY650382|pid:none) Macaca fascicularis guanine nucleo... 188 3e-46
AF056973_1(AF056973|pid:none) Mus musculus GTP binding protein G... 187 5e-46
AF354744_1(AF354744|pid:none) Bos taurus inhibitory GTP-binding ... 187 7e-46
(Q86D96) RecName: Full=Guanine nucleotide-binding protein subuni... 185 2e-45
Z47551_1(Z47551|pid:none) L.stagnalis G protein alpha-a subunit. 183 1e-44
AB274882_1(AB274882|pid:none) Mauremys reevesii mRNA for guanine... 182 1e-44
(Q4VT38) RecName: Full=Guanine nucleotide-binding protein alpha-... 179 1e-43
FJ362364_1(FJ362364|pid:none) Caenorhabditis brenneri contig JD1... 179 2e-43
AF252394_1(AF252394|pid:none) Coccidioides posadasii G protein a... 177 7e-43
FN357454_4(FN357454|pid:none) Schistosoma mansoni genome sequenc... 176 2e-42
AY724808_1(AY724808|pid:none) Anopheles gambiae G protein alpha ... 175 3e-42
AK128701_1(AK128701|pid:none) Homo sapiens cDNA FLJ46868 fis, cl... 175 3e-42
AJ310909_1(AJ310909|pid:none) Mucor racemosus partial gpa2 gene ... 174 6e-42
AL121917_29(AL121917|pid:none) Human DNA sequence from clone RP1... 173 8e-42
DQ082114_1(DQ082114|pid:none) Felis catus GNAZ (GNAZ) gene, part... 168 3e-40
AL671854_12(AL671854|pid:none) Mouse DNA sequence from clone RP2... 166 1e-39
AE014134_3720(AE014134|pid:none) Drosophila melanogaster chromos... 165 2e-39
FN357327_58(FN357327|pid:none) Schistosoma mansoni genome sequen... 165 3e-39
AY724804_1(AY724804|pid:none) Anopheles gambiae G protein alpha ... 163 8e-39
(P52206) RecName: Full=Guanine nucleotide-binding protein subuni... 163 8e-39
DQ115329_1(DQ115329|pid:none) Caenorhabditis remanei heterotrime... 163 1e-38
AY724805_1(AY724805|pid:none) Anopheles gambiae G protein alpha ... 161 3e-38
BT061033_1(BT061033|pid:none) Zea mays full-length cDNA clone ZM... 160 7e-38
DQ082152_1(DQ082152|pid:none) Prionodon linsang GNAZ (GNAZ) gene... 159 1e-37
FJ882150_1(FJ882150|pid:none) Pleurotus abalonus strain YMF1.020... 155 3e-36
FJ374687_1(FJ374687|pid:none) Spodoptera frugiperda heterotrimer... 155 3e-36
AB435551_1(AB435551|pid:none) Carybdea rastonii cuboG12 mRNA for... 154 5e-36
AL121917_28(AL121917|pid:none) Human DNA sequence from clone RP1... 153 9e-36
AY724803_1(AY724803|pid:none) Anopheles gambiae G protein alpha ... 153 1e-35
AB172909_1(AB172909|pid:none) Macaca fascicularis brain cDNA clo... 152 3e-35
CU462975_6(CU462975|pid:none) Zebrafish DNA sequence from clone ... 148 3e-34
AY376066_1(AY376066|pid:none) Bos taurus guanine nucleotide bind... 148 4e-34
DQ082154_1(DQ082154|pid:none) Paradoxurus hermaphroditus GNAZ (G... 147 5e-34
AL109840_18(AL109840|pid:none) Human DNA sequence from clone RP4... 146 1e-33
AJ563468_1(AJ563468|pid:none) Crassostrea gigas mRNA for guanine... 139 1e-31
CR860241_1(CR860241|pid:none) Pongo abelii mRNA; cDNA DKFZp469M0... 137 6e-31
AC004933_1(AC004933|pid:none) Homo sapiens PAC clone RP5-952L21 ... 137 6e-31
AJ879481_1(AJ879481|pid:none) Sordaria macrospora partial gna1 g... 136 1e-30

>(P16894) RecName: Full=Guanine nucleotide-binding protein alpha-1
subunit; Short=G alpha-1; &A32945(A32945)
&M25060_1(M25060|pid:none)
Length = 356

Score = 340 bits (872), Expect = 5e-92
Identities = 172/330 (52%), Positives = 232/330 (70%), Gaps = 1/330 (0%)
Frame = +1

Query: 4 KKHNEVKLLLLGAGESGKSTISKQMKIIHQSGYSNEERKEFKPIITRNILDNMRVLLDGM 183
K E+KLLLLGAGESGKSTI+KQMKIIH +G+++EE+ +K II N + +MRVL++
Sbjct: 32 KLEGEIKLLLLGAGESGKSTIAKQMKIIHLNGFNDEEKSSYKTIIYNNTVGSMRVLVNAA 91

Query: 184 GRLGMTIDPSNSDAAVMIKELTSLQASIVTDCWGELNEDQGKKIKALWTDPGVKQAMRRA 363
L + I +N +AA I + G L + + IKALW DPG++ +R+
Sbjct: 92 EELKIGISENNKEAASRISN------DLGDHFNGVLTAELAQDIKALWADPGIQNTFQRS 145

Query: 364 NEFSTLPDSAPYFFDSIDRMTSPVYIPTDQDILHTRVMTRGVHETNFEIGKIKFRLVDVG 543
+EF L DSA Y+FDSIDR++ P+Y+P++ D+L +R T G+ ET FEI FR+VDVG
Sbjct: 146 SEFQ-LNDSAAYYFDSIDRISQPLYLPSENDVLRSRTKTTGIIETVFEIQNSTFRMVDVG 204

Query: 544 GQRSERKKWLSCFDDVTAVVFCVALSEYDLLLYEDNSTNRMLESLRVFSDVCNS-WFVNT 720
GQRSERKKW+ CF +VTAV+FCVALSEYDL LYED++TNRM ESL++F ++CN+ WF NT
Sbjct: 205 GQRSERKKWMHCFQEVTAVIFCVALSEYDLKLYEDDTTNRMQESLKLFKEICNTKWFANT 264

Query: 721 PIILFLNKSDLFREKIKHVDLSETFPEYKGGRDYERASNYIKERFWQINKTEQKAIYSHI 900
+ILFLNK D+F EKI ++ F EY G + YE S +IK++F N+ +K+IY H+
Sbjct: 265 AMILFLNKRDIFSEKITKTPITVCFKEYDGPQTYEGCSEFIKQQFINQNENPKKSIYPHL 324

Query: 901 TCATDTNNIRVVFEAVKDIIFTQCVMKAGL 990
TCATDTNNI VVF AVKDI+ + +AG+
Sbjct: 325 TCATDTNNILVVFNAVKDIVLNLTLGEAGM 354

Lambda K H
0.318 0.134 0.401

Gapped
Lambda K H
0.267 0.0410 0.140

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3236559
Number of Hits to DB: 1,620,272,414
Number of extensions: 31812510
Number of successful extensions: 95381
Number of sequences better than 10.0: 828
Number of HSP's gapped: 93652
Number of HSP's successfully gapped: 866
Length of query: 354
Length of database: 1,051,180,864
Length adjustment: 129
Effective length of query: 225
Effective length of database: 633,664,753
Effective search space: 142574569425
Effective search space used: 142574569425
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 32 (16.9 bits)

PSORT

psg: 0.82 gvh: 0.42 alm: 0.32 top: 0.27 tms: 0.07 mit: 0.14 mip: 0.00
nuc: 0.02 erl: 0.00 erm: 0.00 pox: 0.00 px2: 0.00 vac: 0.00 rnp: 0.00
act: 0.00 caa: 0.00 yqr: 1.00 tyr: 0.00 leu: 0.08 gpi: 0.00 myr: 0.00
dna: 0.00 rib: 0.00 bac: 0.00 m1a: 0.00 m1b: 0.00 m2 : 1.00 mNt: 0.00
m3a: 0.00 m3b: 0.00 m_ : 0.00

24.0 %: cytoplasmic
24.0 %: endoplasmic reticulum
20.0 %: nuclear
16.0 %: mitochondrial
4.0 %: extracellular, including cell wall
4.0 %: Golgi
4.0 %: plasma membrane
4.0 %: vesicles of secretory system

>> prediction for Contig-U13406-1 is cyt

VS (DIR, S) 0
VH (FL, L) 0
VF (FL, S) 0
AH (FL, L) 0
AF (FL, S) 0
SL (DIR, L) 1
SS (DIR, S) 3
SH (FL, L) 0
SF (FL, S) 0
CH (FL, L) 0
CF (FL, S) 0
FCL (DIR, L) 0
FC (DIR, S) 0
FC-IC (SUB) 0