NBDC - アーカイブトップ - ヘルプ
データベースの説明 | データ項目の説明 | 利用許諾 | ヘルプ
Dicty_cDB
Contig List | Clone List | cDNA Library List
Atlas
Atlas | Atlas Image List
NBDC - LSDB Archive
Description of this DB | Description of data items | Download | License
Dicty_cDB
Contig List | Clone List | cDNA Library List
Atlas
Atlas | Atlas Image List
Contig-U12937-1
Contig ID Contig-U12937-1
Contig update 2002.12.18
Contig sequence 
>Contig-U12937-1 (Contig-U12937-1Q) /CSM_Contig/Contig-U12937-1Q.Seq.d
NNNNNNNNNNGATGCCATNGTNGAACCAAAACGTCCACACGATAAACCAT
TACGTATTCCATTACAANAAACTGAAAAATTNGTTGNTCAAGTTATNGTC
CTCAACCATCCAGGTCAAATCCATGCTGGTTACTCACCAGTNTTANATTG
TCACNCTGCTCACATTGCCTGTAAATTCNCTGAAATCGTCGATAAAGTTG
ATCGTCGNACTGGNGCCGTCGTTGCCAAANAAGGNACTGCCNCCGTCGTC
TTAAAGAATGGTGATGCTGCTATGGTCGAATTAACCCCATCTCGTCCAAT
GTGTGTTGAATCATTCNCTGAANACCCNCCNTTAGGTCGTTTCNCCGTCA
NANATATGAGACAAACCGTTGCCGTCGGTGTCATCAAANCAACCGTCAAN
AAAGCCCCAGGTAAAGCAGGTTATAANAAAGGTGCTGCTGCTCCATCAAA
GAAGAAATAAATAATTTTAAAAAAAATTTTATATTATTCTAAAAATAAAA
AAAAAAA
Gap no gap
Contig length 507
Chromosome number (1..6, M) 1
Chromosome length 4919822
Start point 2427665
End point 2427167
Strand (PLUS/MINUS) MINUS
Number of clones 1
Number of EST 1
Link to clone list U12937
List of clone(s) 

est1=CHC511Z,1,498
Translated Amino Acid sequence 
XXXDAXVEPKRPHDKPLRIPLQXTEKXVXQVXVLNHPGQIHAGYSPVLXCHXAHIACKFX
EIVDKVDRRTGAVVAKXGTAXVVLKNGDAAMVELTPSRPMCVESFXEXPPLGRFXVXXMR
QTVAVGVIKXTVXKAPGKAGYXKGAAAPSKKK*iilkkilyysknkkk
Translated Amino Acid sequence (All Frames) 
Frame A:
xxxxchxxtktstr*titysitxn*kixxssyxpqpsrsnpcwlltsxxlsxcshcl*ix
*nrr*s*ssxwxrrcqxrxcxrrlkew*ccygrinpissnvc*iix*xpxxrsfxrxxye
tnrcrrchqxnrqxspr*srl*xrcccsikeeinnfkknfilf*k*kkk


Frame B:
XXXDAXVEPKRPHDKPLRIPLQXTEKXVXQVXVLNHPGQIHAGYSPVLXCHXAHIACKFX
EIVDKVDRRTGAVVAKXGTAXVVLKNGDAAMVELTPSRPMCVESFXEXPPLGRFXVXXMR
QTVAVGVIKXTVXKAPGKAGYXKGAAAPSKKK*iilkkilyysknkkk


Frame C:
xxxmpxxnqnvhtinhyvfhyxklknxlxklxsstiqvksmlvthqxxivtlltlpvnsl
kssiklivxlxpslpxkxlppss*rmvmllwsn*phlvqcvlnhslxtxx*vvspsxi*d
kplpsvssxqpsxkpqvkqvixkvlllhqrrnk*f*kkfyiilkikkk
own update 2004. 6.10
Homology vs CSM-cDNA 
Query= Contig-U12937-1 (Contig-U12937-1Q)
/CSM_Contig/Contig-U12937-1Q.Seq.d
         (507 letters)

Database: CSM
           6905 sequences; 5,674,871 total letters


                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

Contig-U12937-1 (Contig-U12937-1Q) /CSM_Contig/Conti...   759  0.0
Contig-U06058-1 (Contig-U06058-1Q) /CSM_Contig/Conti...   587  e-168
Contig-U06827-1 (Contig-U06827-1Q) /CSM_Contig/Conti...    36  0.035
Contig-U02593-1 (Contig-U02593-1Q) /CSM_Contig/Conti...    34  0.14
Contig-U13807-1 (Contig-U13807-1Q) /CSM_Contig/Conti...    32  0.55
Contig-U11142-1 (Contig-U11142-1Q) /CSM_Contig/Conti...    32  0.55
Contig-U00133-1 (Contig-U00133-1Q) /CSM_Contig/Conti...    32  0.55
Contig-U14460-1 (Contig-U14460-1Q) /CSM_Contig/Conti...    30  2.2
Contig-U12398-1 (Contig-U12398-1Q) /CSM_Contig/Conti...    30  2.2
Contig-U12392-1 (Contig-U12392-1Q) /CSM_Contig/Conti...    30  2.2

>Contig-U12937-1 (Contig-U12937-1Q) /CSM_Contig/Contig-U12937-1Q.Seq.d
          Length = 507

 Score =  759 bits (383), Expect = 0.0
 Identities = 458/458 (100%)
 Strand = Plus / Plus

                                                                       
Query: 11  gatgccatngtngaaccaaaacgtccacacgataaaccattacgtattccattacaanaa 70
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 11  gatgccatngtngaaccaaaacgtccacacgataaaccattacgtattccattacaanaa 70

                                                                       
Query: 71  actgaaaaattngttgntcaagttatngtcctcaaccatccaggtcaaatccatgctggt 130
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 71  actgaaaaattngttgntcaagttatngtcctcaaccatccaggtcaaatccatgctggt 130

                                                                       
Query: 131 tactcaccagtnttanattgtcacnctgctcacattgcctgtaaattcnctgaaatcgtc 190
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 131 tactcaccagtnttanattgtcacnctgctcacattgcctgtaaattcnctgaaatcgtc 190

                                                                       
Query: 191 gataaagttgatcgtcgnactggngccgtcgttgccaaanaaggnactgccnccgtcgtc 250
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 191 gataaagttgatcgtcgnactggngccgtcgttgccaaanaaggnactgccnccgtcgtc 250

                                                                       
Query: 251 ttaaagaatggtgatgctgctatggtcgaattaaccccatctcgtccaatgtgtgttgaa 310
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 251 ttaaagaatggtgatgctgctatggtcgaattaaccccatctcgtccaatgtgtgttgaa 310

                                                                       
Query: 311 tcattcnctgaanacccnccnttaggtcgtttcnccgtcananatatgagacaaaccgtt 370
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 311 tcattcnctgaanacccnccnttaggtcgtttcnccgtcananatatgagacaaaccgtt 370

                                                                       
Query: 371 gccgtcggtgtcatcaaancaaccgtcaanaaagccccaggtaaagcaggttataanaaa 430
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 371 gccgtcggtgtcatcaaancaaccgtcaanaaagccccaggtaaagcaggttataanaaa 430

                                                 
Query: 431 ggtgctgctgctccatcaaagaagaaataaataatttt 468
           ||||||||||||||||||||||||||||||||||||||
Sbjct: 431 ggtgctgctgctccatcaaagaagaaataaataatttt 468


>Contig-U06058-1 (Contig-U06058-1Q) /CSM_Contig/Contig-U06058-1Q.Seq.d
          Length = 1185

 Score =  587 bits (296), Expect = e-168
 Identities = 370/401 (92%), Gaps = 1/401 (0%)
 Strand = Plus / Plus

                                                                        
Query: 64   acaanaaactgaaaaattngttgntcaagttatngtcctcaaccatccaggtcaaatcca 123
            |||| ||||||||||||| |||| ||||||||| ||||||||||||||||||||||||||
Sbjct: 784  acaagaaactgaaaaattcgttgctcaagttatcgtcctcaaccatccaggtcaaatcca 843

                                                                        
Query: 124  tgctggttactcaccagtnttanattgtcacnctgctcacattgcctgtaaattcnctga 183
            ||| |||||||||||||| ||| |||||||| ||||||||||||||||||||||| ||||
Sbjct: 844  tgccggttactcaccagtcttagattgtcacactgctcacattgcctgtaaattcactga 903

                                                                        
Query: 184  aatcgtcgataaagttgatcgtcgnactggngccgtcgttgccaaanaaggnactgccnc 243
            |||||||||||||||||||||||| ||||| ||||||||||||||| |||| |||||| |
Sbjct: 904  aatcgtcgataaagttgatcgtcgtactggtgccgtcgttgccaaagaaggtactgccgc 963

                                                                        
Query: 244  cgtcgtcttaaagaatggtgatgctgctatggtcgaattaaccccatctcgtccaatgtg 303
            |||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||
Sbjct: 964  cgtcgtcttaaagaatggtgatgccgctatggtcgaattaaccccatctcgtccaatgtg 1023

                                                                        
Query: 304  tgttgaatcattcnctgaanacccnccnttaggtcgtttcnccgtcananatatgagaca 363
            ||||||||| ||| ||||| |||| || |||||||||||| |||||| | ||||||||||
Sbjct: 1024 tgttgaatccttcactgaatacccaccattaggtcgtttcgccgtcagagatatgagaca 1083

                                                                        
Query: 364  aaccgttgccgtcggtgtcatcaaancaaccgtcaanaaagccccaggtaaagcaggtta 423
            |||||| |||||||||||||||||| |||||||||| ||||||||||||||||| || ||
Sbjct: 1084 aaccgtcgccgtcggtgtcatcaaatcaaccgtcaagaaagccccaggtaaagccgg-ta 1142

                                                     
Query: 424  taanaaaggtgctgctgctccatcaaagaagaaataaataa 464
            ||| |||||||||||||| |||||||| |||||||||||||
Sbjct: 1143 taagaaaggtgctgctgccccatcaaaaaagaaataaataa 1183


 Score =  101 bits (51), Expect = 7e-22
 Identities = 55/57 (96%)
 Strand = Plus / Plus

                                                                    
Query: 11  gatgccatngtngaaccaaaacgtccacacgataaaccattacgtattccattacaa 67
           |||||||| || |||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 479 gatgccatcgtcgaaccaaaacgtccacacgataaaccattacgtattccattacaa 535


>Contig-U06827-1 (Contig-U06827-1Q) /CSM_Contig/Contig-U06827-1Q.Seq.d
          Length = 486

 Score = 36.2 bits (18), Expect = 0.035
 Identities = 18/18 (100%)
 Strand = Plus / Plus

                             
Query: 448 aaagaagaaataaataat 465
           ||||||||||||||||||
Sbjct: 47  aaagaagaaataaataat 64


  Database: CSM
    Posted date:  Jun 9, 2004  7:35 PM
  Number of letters in database: 5,674,871
  Number of sequences in database:  6905
  
Lambda     K      H
    1.37    0.711     1.31 

Gapped
Lambda     K      H
    1.37    0.711     1.31 


Matrix: blastn matrix:1 -3
Gap Penalties: Existence: 5, Extension: 2
Number of Hits to DB: 2875
Number of Sequences: 6905
Number of extensions: 2875
Number of successful extensions: 282
Number of sequences better than 10.0: 85
length of query: 507
length of database: 5,674,871
effective HSP length: 16
effective length of query: 491
effective length of database: 5,564,391
effective search space: 2732115981
effective search space used: 2732115981
T: 0
A: 40
X1: 6 (11.9 bits)
X2: 15 (29.7 bits)
S1: 12 (24.3 bits)
S2: 14 (28.2 bits)
dna update 2008.12. 4
Homology vs DNA 
Query= Contig-U12937-1 (Contig-U12937-1Q) /CSM_Contig/Contig-U12937-1Q.Seq.d
         (507 letters)

Database: ddbj_A
           92,845,959 sequences; 95,242,211,685 total letters

Searching..................................................done

                                                             Score    E
Sequences producing significant alignments:                  (bits) Value  N

(BJ378080) Dictyostelium discoideum cDNA clone:ddc27e03, 3' ...   729   0.0    1
(BJ435567) Dictyostelium discoideum cDNA clone:ddv27d17, 3' ...   630   0.0    2
(BJ400770) Dictyostelium discoideum cDNA clone:dds14a19, 3' ...   630   0.0    2
(BJ431483) Dictyostelium discoideum cDNA clone:ddv14h09, 3' ...   630   0.0    2
(BJ374150) Dictyostelium discoideum cDNA clone:ddc6a23, 3' e...   630   0.0    2
(BJ372920) Dictyostelium discoideum cDNA clone:ddc15a05, 3' ...   630   0.0    2
(BJ376991) Dictyostelium discoideum cDNA clone:ddc30m22, 3' ...   630   0.0    2
(BJ430392) Dictyostelium discoideum cDNA clone:ddv7h03, 3' e...   630   0.0    2
(BJ432396) Dictyostelium discoideum cDNA clone:ddv18f18, 3' ...   630   0.0    2
(BJ430160) Dictyostelium discoideum cDNA clone:ddv6d12, 3' e...   630   0.0    2
(BJ377488) Dictyostelium discoideum cDNA clone:ddc24c20, 3' ...   630   0.0    2
(BJ374061) Dictyostelium discoideum cDNA clone:ddc6h12, 3' e...   630   0.0    2
(BJ377478) Dictyostelium discoideum cDNA clone:ddc24p16, 3' ...   630   0.0    2
(BJ372329) Dictyostelium discoideum cDNA clone:ddc12l05, 3' ...   622   0.0    2
(X55972) D. discoideum EF1-II gene for elongation factor 1 a...   622   0.0    2
(BJ374186) Dictyostelium discoideum cDNA clone:ddc6l20, 3' e...   630   0.0    2
(BJ373777) Dictyostelium discoideum cDNA clone:ddc4n23, 3' e...   579   0.0    3
(BJ373752) Dictyostelium discoideum cDNA clone:ddc4h22, 3' e...   579   0.0    3
(BJ371774) Dictyostelium discoideum cDNA clone:ddc1n10, 3' e...   579   0.0    3
(BJ373671) Dictyostelium discoideum cDNA clone:ddc4m09, 3' e...   579   0.0    3
(BJ431096) Dictyostelium discoideum cDNA clone:ddv9i21, 3' e...   630   0.0    3
(BJ430716) Dictyostelium discoideum cDNA clone:ddv8n12, 3' e...   579   0.0    3
(BJ436312) Dictyostelium discoideum cDNA clone:ddv30c22, 3' ...   571   0.0    3
(BJ431433) Dictyostelium discoideum cDNA clone:ddv14l05, 3' ...   571   0.0    3
(BJ433615) Dictyostelium discoideum cDNA clone:ddv22m09, 3' ...   630   0.0    2
(BJ374380) Dictyostelium discoideum cDNA clone:ddc7c14, 3' e...   605   0.0    2
(BJ342649) Dictyostelium discoideum cDNA clone:dda14p21, 3' ...   630   0.0    2
(BJ341997) Dictyostelium discoideum cDNA clone:dda9g05, 3' e...   630   0.0    2
(BJ343377) Dictyostelium discoideum cDNA clone:dda22k19, 3' ...   630   0.0    2
(BJ401276) Dictyostelium discoideum cDNA clone:dds22p18, 3' ...   630   0.0    2
(BJ377707) Dictyostelium discoideum cDNA clone:ddc25c17, 3' ...   630   0.0    2
(AU052242) Dictyostelium discoideum slug cDNA, clone SLA413.      607   0.0    2
(BJ375665) Dictyostelium discoideum cDNA clone:ddc19d15, 3' ...   630   0.0    2
(BJ375730) Dictyostelium discoideum cDNA clone:ddc19b21, 3' ...   630   0.0    2
(BJ401203) Dictyostelium discoideum cDNA clone:dds22a13, 3' ...   622   0.0    2
(BJ372574) Dictyostelium discoideum cDNA clone:ddc13o04, 3' ...   577   0.0    3
(BJ428628) Dictyostelium discoideum cDNA clone:ddv12k18, 3' ...   585   0.0    2
(BJ430976) Dictyostelium discoideum cDNA clone:ddv9n11, 3' e...   585   0.0    2
(BJ373834) Dictyostelium discoideum cDNA clone:ddc5a03, 3' e...   585   0.0    2
(BJ432464) Dictyostelium discoideum cDNA clone:ddv18c22, 3' ...   583   0.0    2
(BJ434531) Dictyostelium discoideum cDNA clone:ddv24l01, 3' ...   583   0.0    2
(BJ400445) Dictyostelium discoideum cDNA clone:dds13g11, 3' ...   583   0.0    2
(BJ432085) Dictyostelium discoideum cDNA clone:ddv17f18, 3' ...   583   0.0    2
(BJ431537) Dictyostelium discoideum cDNA clone:ddv14d16, 3' ...   583   0.0    2
(BJ374173) Dictyostelium discoideum cDNA clone:ddc6i19, 3' e...   583   0.0    2
(BJ435153) Dictyostelium discoideum cDNA clone:ddv26b12, 3' ...   583   0.0    2
(BJ432586) Dictyostelium discoideum cDNA clone:ddv19j05, 3' ...   583   0.0    2
(BJ430770) Dictyostelium discoideum cDNA clone:ddv8m18, 3' e...   583   0.0    2
(BJ428479) Dictyostelium discoideum cDNA clone:ddv12h06, 3' ...   583   0.0    2
(BJ432657) Dictyostelium discoideum cDNA clone:ddv19h10, 3' ...   583   0.0    2
(BJ431946) Dictyostelium discoideum cDNA clone:ddv17j04, 3' ...   583   0.0    2
(BJ436165) Dictyostelium discoideum cDNA clone:ddv30o04, 3' ...   583   0.0    2
(BJ435407) Dictyostelium discoideum cDNA clone:ddv27d05, 3' ...   583   0.0    2
(BJ341591) Dictyostelium discoideum cDNA clone:dda7g10, 3' e...   583   0.0    2
(BJ435666) Dictyostelium discoideum cDNA clone:ddv27h19, 3' ...   583   0.0    2
(BJ433888) Dictyostelium discoideum cDNA clone:ddv23b10, 3' ...   583   0.0    2
(BJ431109) Dictyostelium discoideum cDNA clone:ddv9l22, 3' e...   583   0.0    2
(AU033534) Dictyostelium discoideum slug cDNA, clone SLB141.      583   0.0    2
(BJ435156) Dictyostelium discoideum cDNA clone:ddv26c09, 3' ...   583   0.0    2
(BJ432297) Dictyostelium discoideum cDNA clone:ddv18d10, 3' ...   583   0.0    2
(BJ376316) Dictyostelium discoideum cDNA clone:ddc28d03, 3' ...   583   0.0    2
(BJ432612) Dictyostelium discoideum cDNA clone:ddv19o04, 3' ...   583   0.0    2
(BJ430645) Dictyostelium discoideum cDNA clone:ddv8i05, 3' e...   583   0.0    2
(BJ432458) Dictyostelium discoideum cDNA clone:ddv18b21, 3' ...   583   0.0    2
(BJ430607) Dictyostelium discoideum cDNA clone:ddv7n23, 3' e...   583   0.0    2
(BJ429777) Dictyostelium discoideum cDNA clone:ddv4h21, 3' e...   583   0.0    2
(BJ402753) Dictyostelium discoideum cDNA clone:dds17m19, 3' ...   583   0.0    2
(BJ375550) Dictyostelium discoideum cDNA clone:ddc19j06, 3' ...   583   0.0    2
(BJ432494) Dictyostelium discoideum cDNA clone:ddv18i21, 3' ...   583   0.0    2
(BJ432408) Dictyostelium discoideum cDNA clone:ddv18i13, 3' ...   583   0.0    2
(BJ429750) Dictyostelium discoideum cDNA clone:ddv4b23, 3' e...   583   0.0    2
(BJ435510) Dictyostelium discoideum cDNA clone:ddv27j07, 3' ...   583   0.0    2
(BJ432256) Dictyostelium discoideum cDNA clone:ddv18l06, 3' ...   583   0.0    2
(BJ432390) Dictyostelium discoideum cDNA clone:ddv18e18, 3' ...   583   0.0    2
(BJ375456) Dictyostelium discoideum cDNA clone:ddc18d22, 3' ...   583   0.0    2
(BJ431089) Dictyostelium discoideum cDNA clone:ddv9g23, 3' e...   583   0.0    2
(BJ430472) Dictyostelium discoideum cDNA clone:ddv7j11, 3' e...   583   0.0    2
(BJ432530) Dictyostelium discoideum cDNA clone:ddv18p20, 3' ...   583   0.0    2
(BJ431028) Dictyostelium discoideum cDNA clone:ddv9j16, 3' e...   583   0.0    2
(BJ429727) Dictyostelium discoideum cDNA clone:ddv4n14, 3' e...   583   0.0    2
(BJ432272) Dictyostelium discoideum cDNA clone:ddv18p01, 3' ...   583   0.0    2
(BJ430949) Dictyostelium discoideum cDNA clone:ddv9i11, 3' e...   583   0.0    2
(BJ430082) Dictyostelium discoideum cDNA clone:ddv6c05, 3' e...   583   0.0    2
(BJ430408) Dictyostelium discoideum cDNA clone:ddv7l05, 3' e...   583   0.0    2
(BJ430357) Dictyostelium discoideum cDNA clone:ddv7a03, 3' e...   583   0.0    2
(BJ435638) Dictyostelium discoideum cDNA clone:ddv27c19, 3' ...   583   0.0    2
(BJ429730) Dictyostelium discoideum cDNA clone:ddv4o13, 3' e...   583   0.0    2
(BJ373889) Dictyostelium discoideum cDNA clone:ddc5a12, 3' e...   583   0.0    2
(AU033535) Dictyostelium discoideum slug cDNA, clone SLB142.      583   0.0    2
(BJ432526) Dictyostelium discoideum cDNA clone:ddv18o22, 3' ...   583   0.0    2
(BJ428296) Dictyostelium discoideum cDNA clone:ddv11m12, 3' ...   583   0.0    2
(BJ398777) Dictyostelium discoideum cDNA clone:dds2o04, 3' e...   583   0.0    2
(BJ430589) Dictyostelium discoideum cDNA clone:ddv7h22, 3' e...   583   0.0    2
(BJ430284) Dictyostelium discoideum cDNA clone:ddv6o16, 3' e...   583   0.0    2
(BJ429790) Dictyostelium discoideum cDNA clone:ddv4k21, 3' e...   573   0.0    3
(BJ374948) Dictyostelium discoideum cDNA clone:ddc16k21, 3' ...   571   0.0    3
(BJ400871) Dictyostelium discoideum cDNA clone:dds15m03, 3' ...   579   0.0    2
(BJ399297) Dictyostelium discoideum cDNA clone:dds5e12, 3' e...   630   0.0    2
(BJ342506) Dictyostelium discoideum cDNA clone:dda14h10, 3' ...   630   0.0    2
(BJ373464) Dictyostelium discoideum cDNA clone:ddc3n02, 3' e...   577   0.0    2

>(BJ378080) Dictyostelium discoideum cDNA clone:ddc27e03, 3' end,
           single read.
          Length = 498

 Score =  729 bits (368), Expect = 0.0
 Identities = 443/443 (100%)
 Strand = Plus / Minus


Query: 12  atgccatngtngaaccaaaacgtccacacgataaaccattacgtattccattacaanaaa 71
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 497 atgccatngtngaaccaaaacgtccacacgataaaccattacgtattccattacaanaaa 438


Query: 72  ctgaaaaattngttgntcaagttatngtcctcaaccatccaggtcaaatccatgctggtt 131
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 437 ctgaaaaattngttgntcaagttatngtcctcaaccatccaggtcaaatccatgctggtt 378


Query: 132 actcaccagtnttanattgtcacnctgctcacattgcctgtaaattcnctgaaatcgtcg 191
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 377 actcaccagtnttanattgtcacnctgctcacattgcctgtaaattcnctgaaatcgtcg 318


Query: 192 ataaagttgatcgtcgnactggngccgtcgttgccaaanaaggnactgccnccgtcgtct 251
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 317 ataaagttgatcgtcgnactggngccgtcgttgccaaanaaggnactgccnccgtcgtct 258


Query: 252 taaagaatggtgatgctgctatggtcgaattaaccccatctcgtccaatgtgtgttgaat 311
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 257 taaagaatggtgatgctgctatggtcgaattaaccccatctcgtccaatgtgtgttgaat 198


Query: 312 cattcnctgaanacccnccnttaggtcgtttcnccgtcananatatgagacaaaccgttg 371
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 197 cattcnctgaanacccnccnttaggtcgtttcnccgtcananatatgagacaaaccgttg 138


Query: 372 ccgtcggtgtcatcaaancaaccgtcaanaaagccccaggtaaagcaggttataanaaag 431
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 137 ccgtcggtgtcatcaaancaaccgtcaanaaagccccaggtaaagcaggttataanaaag 78


Query: 432 gtgctgctgctccatcaaagaag 454
           |||||||||||||||||||||||
Sbjct: 77  gtgctgctgctccatcaaagaag 55

Lambda     K      H
    1.37    0.711     1.31

Matrix: blastn matrix:1 -3
Number of Sequences: 92845959
Number of Hits to DB: 238,238,440
Number of extensions: 13062298
Number of successful extensions: 797684
Number of sequences better than 10.0: 13228
Length of query: 507
Length of database: 95,242,211,685
Length adjustment: 23
Effective length of query: 484
Effective length of database: 93,106,754,628
Effective search space: 45063669239952
Effective search space used: 45063669239952
X1: 11 (21.8 bits)
S2: 21 (42.1 bits)
protein update 2009. 7. 5
Homology vs Protein 
Query= Contig-U12937-1 (Contig-U12937-1Q) /CSM_Contig/Contig-U12937-1Q.Seq.d
         (507 letters)

Database: nrp_B
           3,236,559 sequences; 1,051,180,864 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

X55973_1(X55973|pid:none) D. discoideum EF1-I gene for elongatio...   165   7e-40
X55972_1(X55972|pid:none) D. discoideum EF1-II gene for elongati...   165   7e-40
(P18624) RecName: Full=Elongation factor 1-alpha;          Short...   165   7e-40
AY582829_1(AY582829|pid:none) Acanthamoeba culbertsoni ef1a gene...   134   1e-30
AJ581004_1(AJ581004|pid:none) Axinella verrucosa mRNA for elonga...   132   4e-30
DQ157428_1(DQ157428|pid:none) Agalma elegans elongation factor 1...   132   5e-30
AB126336_1(AB126336|pid:none) Nematostella vectensis EF1alpha mR...   132   6e-30
AY542532_1(AY542532|pid:none) Cladonema radiatum translation elo...   132   6e-30
FN392319_1522(FN392319|pid:none) Pichia pastoris GS115 chromosom...   131   8e-30
(P62631) RecName: Full=Elongation factor 1-alpha 2;          Sho...   130   1e-29
AL450341_18(AL450341|pid:none) Mouse DNA sequence from clone RP2...   130   1e-29
AY891103_1(AY891103|pid:none) Synthetic construct Homo sapiens c...   130   1e-29
L10340_1(L10340|pid:none) Human elongation factor-1 alpha (ef-1)...   130   1e-29
BC060907_1(BC060907|pid:none) Danio rerio zgc:73138, mRNA (cDNA ...   130   1e-29
AY891104_1(AY891104|pid:none) Synthetic construct Homo sapiens c...   130   1e-29
DQ028590_1(DQ028590|pid:none) Cintractia sorghi-vulgaris isolate...   130   2e-29
Y09023_1(Y09023|pid:none) G.cydonium mRNA for elongation factor ...   130   2e-29
BC092884_1(BC092884|pid:none) Danio rerio zgc:110335, mRNA (cDNA...   129   3e-29
BC054279_1(BC054279|pid:none) Xenopus laevis eukaryotic translat...   129   3e-29
BC088010_1(BC088010|pid:none) Xenopus tropicalis eukaryotic tran...   129   4e-29
AB326305_1(AB326305|pid:none) Solea senegalensis SseEF1A4 mRNA f...   129   4e-29
AJ970312_1(AJ970312|pid:none) Hebeloma cylindrosporum mRNA for e...   129   5e-29
FN323397_1(FN323397|pid:none) Schistosoma japonicum isolate Anhu...   129   5e-29
FN316460_1(FN316460|pid:none) Schistosoma japonicum isolate Anhu...   129   5e-29
(P40911) RecName: Full=Elongation factor 1-alpha;          Short...   129   5e-29
FN316452_1(FN316452|pid:none) Schistosoma japonicum isolate Anhu...   129   5e-29
FN316451_1(FN316451|pid:none) Schistosoma japonicum isolate Anhu...   129   5e-29
AY813247_1(AY813247|pid:none) Schistosoma japonicum clone SJCHGC...   129   5e-29
FJ695618_1(FJ695618|pid:none) Piriformospora indica translation ...   128   9e-29
(P27634) RecName: Full=Elongation factor 1-alpha;          Short...   128   9e-29
AY682093_1(AY682093|pid:none) Scleronephthya gracillimum transla...   128   9e-29
(Q00251) RecName: Full=Elongation factor 1-alpha;          Short...   128   9e-29
AB199910_1(AB199910|pid:none) Hyla japonica ef 1a mRNA for elong...   128   9e-29
EU574868_1(EU574868|pid:none) Ornithodoros coriaceus clone OC-59...   128   9e-29
(P27592) RecName: Full=Elongation factor 1-alpha;          Short...   127   1e-28
AM270408_32(AM270408|pid:none) Aspergillus niger contig An18c016...   127   1e-28
AY264216_1(AY264216|pid:none) Pterodoras granulosus elongation f...   127   2e-28
EF014948_1(EF014948|pid:none) Pichia pastoris translation elonga...   127   2e-28
AY849694_1(AY849694|pid:none) Magnaporthe grisea elongation fact...   127   2e-28
BC075885_1(BC075885|pid:none) Danio rerio zgc:92085, mRNA (cDNA ...   127   2e-28
A29820_1(A29820|pid:none) A.gossypi translation elongation facto...   127   2e-28
AY643820_1(AY643820|pid:none) Arcyria denudata elongation factor...   127   2e-28
FJ538310_1(FJ538310|pid:none) Stephos longipes eukaryotic transl...   127   2e-28
AB116235_1(AB116235|pid:none) Rosellinia sp. PF1022 tef1 gene fo...   127   2e-28
FB784609_1(FB784609|pid:none) Sequence 3882 from Patent WO200803...   127   2e-28
AY643816_1(AY643816|pid:none) Lycogala epidendrum elongation fac...   127   2e-28
BC014377_1(BC014377|pid:none) Homo sapiens, clone IMAGE:4041545,...   127   2e-28
AK222519_1(AK222519|pid:none) Homo sapiens mRNA for eukaryotic t...   127   2e-28
EU016386_1(EU016386|pid:none) Trichoplusia ni clone L608 elongat...   127   2e-28
BC012509_1(BC012509|pid:none) Homo sapiens eukaryotic translatio...   127   2e-28
AB174733_1(AB174733|pid:none) Macaca fascicularis brain cDNA clo...   127   2e-28
DQ148147_1(DQ148147|pid:none) Macaca mulatta clone sl1_c22_t7_36...   127   2e-28
(P10126) RecName: Full=Elongation factor 1-alpha 1;          Sho...   127   2e-28
M22432_1(M22432|pid:none) Mus musculus protein synthesis elongat...   127   2e-28
BC065761_1(BC065761|pid:none) Homo sapiens eukaryotic translatio...   127   2e-28
BC071619_1(BC071619|pid:none) Homo sapiens eukaryotic translatio...   127   2e-28
AF054510_1(AF054510|pid:none) Yarrowia lipolytica translation el...   127   2e-28
AF397403_1(AF397403|pid:none) Homo sapiens translation elongatio...   127   2e-28
AK223042_1(AK223042|pid:none) Homo sapiens mRNA for eukaryotic t...   127   2e-28
DQ223573_1(DQ223573|pid:none) Ovis aries clone TO-DOWN-B6-2 elon...   127   2e-28
EF676249_1(EF676249|pid:none) Picea sitchensis clone WS02724_D06...   127   2e-28
X56698_1(X56698|pid:none) X. laevis mRNA for 42Sp48.                  127   2e-28
AB171290_1(AB171290|pid:none) Macaca fascicularis brain cDNA clo...   127   2e-28
M29548_1(M29548|pid:none) Human elongation factor 1-alpha (EF1A)...   127   2e-28
AY893896_1(AY893896|pid:none) Synthetic construct Homo sapiens c...   127   2e-28
AF322220_1(AF322220|pid:none) Homo sapiens cervical cancer suppr...   127   2e-28
BC071727_1(BC071727|pid:none) Homo sapiens eukaryotic translatio...   127   2e-28
AF174496_1(AF174496|pid:none) Homo sapiens glucocorticoid recept...   127   2e-28
DQ440206_1(DQ440206|pid:none) Aedes aegypti clone AET-205 transl...   127   2e-28
AK222551_1(AK222551|pid:none) Homo sapiens mRNA for eukaryotic t...   127   2e-28
AK223046_1(AK223046|pid:none) Homo sapiens mRNA for eukaryotic t...   127   2e-28
AK300922_1(AK300922|pid:none) Homo sapiens cDNA FLJ56859 complet...   127   2e-28
DQ402094_1(DQ402094|pid:none) Ovis aries elongation factor-1 alp...   127   2e-28
DQ883774_1(DQ883774|pid:none) Diploschistes cinereocaesius isola...   127   2e-28
AB124568_1(AB124568|pid:none) Pelodiscus sinensis PsEF1a mRNA fo...   127   2e-28
AK133725_1(AK133725|pid:none) Mus musculus 6 days neonate head c...   127   2e-28
AK297878_1(AK297878|pid:none) Homo sapiens cDNA FLJ52573 complet...   127   2e-28
(P29520) RecName: Full=Elongation factor 1-alpha;          Short...   127   2e-28
AK032914_1(AK032914|pid:none) Mus musculus 12 days embryo male w...   127   2e-28
AB253792_1(AB253792|pid:none) Athalia rosae EF-1-alpha mRNA for ...   127   2e-28
(Q01765) RecName: Full=Elongation factor 1-alpha;          Short...   127   2e-28
AK292639_1(AK292639|pid:none) Homo sapiens cDNA FLJ76726 complet...   127   2e-28
BC105315_1(BC105315|pid:none) Bos taurus eukaryotic translation ...   127   2e-28
CR861176_1(CR861176|pid:none) Pongo abelii mRNA; cDNA DKFZp459L0...   127   2e-28
(O42820) RecName: Full=Elongation factor 1-alpha;          Short...   127   2e-28
(Q96WZ1) RecName: Full=Elongation factor 1-alpha;          Short...   127   2e-28
BC014892_1(BC014892|pid:none) Homo sapiens, clone IMAGE:3909122,...   127   2e-28
(P68103) RecName: Full=Elongation factor 1-alpha 1;          Sho...   127   2e-28
(P14864) RecName: Full=Elongation factor 1-alpha;          Short...   127   2e-28
(Q90835) RecName: Full=Elongation factor 1-alpha 1;          Sho...   126   3e-28
(P41745) RecName: Full=Elongation factor 1-alpha;          Short...   126   3e-28
FN323413_1(FN323413|pid:none) Schistosoma japonicum isolate Anhu...   126   3e-28
AY336495_1(AY336495|pid:none) Schistosoma japonicum elongation f...   126   3e-28
AB245432_1(AB245432|pid:none) Pocillopora damicornis EF1-alpha m...   126   3e-28
CU928170_492(CU928170|pid:none) Kluyveromyces thermotolerans str...   126   3e-28
DQ353797_1(DQ353797|pid:none) Ictalurus punctatus isolate C94SB1...   126   3e-28
DQ883804_1(DQ883804|pid:none) Pleopsidium gobiense isolate AFTOL...   126   3e-28
DQ138080_1(DQ138080|pid:none) Phytophthora parasitica isolate 14...   126   3e-28
(P51554) RecName: Full=Elongation factor 1-alpha;          Short...   126   3e-28
AF157282_1(AF157282|pid:none) Rhizomucor miehei translation elon...   126   3e-28
AJ249839_1(AJ249839|pid:none) Phytophthora infestans partial mRN...   126   3e-28
AJ549292_1(AJ549292|pid:none) Podocoryne carnea mRNA for elongat...   126   3e-28
FM992689_752(FM992689|pid:none) Candida dubliniensis CD36 chromo...   126   3e-28
BC157768_1(BC157768|pid:none) Xenopus tropicalis eukaryotic tran...   126   3e-28
(P16017) RecName: Full=Elongation factor 1-alpha;          Short...   126   3e-28
(P13549) RecName: Full=Elongation factor 1-alpha, somatic form; ...   126   3e-28
CP000496_913(CP000496|pid:none) Pichia stipitis CBS 6054 chromos...   126   3e-28
CR382136_102(CR382136|pid:none) Debaryomyces hansenii strain CBS...   126   3e-28
FJ539138_1(FJ539138|pid:none) Ignatius tetrasporus strain UTEX B...   125   4e-28
AY752802_1(AY752802|pid:none) Culicoides sonorensis clone CsEF1a...   125   4e-28
DQ675557_1(DQ675557|pid:none) Diaphorina citri clone WHDc1285 pu...   125   4e-28
(P17508) RecName: Full=Elongation factor 1-alpha, oocyte form; A...   125   4e-28
AY729871_1(AY729871|pid:none) Apodachlya brachynema elongation f...   125   4e-28
BC064177_1(BC064177|pid:none) Xenopus tropicalis eukaryotic tran...   125   4e-28
FJ890356_1(FJ890356|pid:none) Oncorhynchus tshawytscha elongatio...   125   4e-28
X52977_1(X52977|pid:none) X.laevis mRNA for elongation factor 1-...   125   4e-28
AY445082_1(AY445082|pid:none) Metarhizium anisopliae strain E6 t...   125   6e-28
AY264207_1(AY264207|pid:none) Centrodoras cf. brachiatus elongat...   125   6e-28
AY089522_1(AY089522|pid:none) Drosophila melanogaster GM14559 fu...   125   6e-28
FJ263903_1(FJ263903|pid:none) Artemia franciscana clone 11GM10.0...   125   6e-28
AY500140_1(AY500140|pid:none) Homalodisca coagulata putative elo...   125   6e-28
(Q9Y713) RecName: Full=Elongation factor 1-alpha;          Short...   125   6e-28
(P08736) RecName: Full=Elongation factor 1-alpha 1;          Sho...   125   6e-28
AF157299_1(AF157299|pid:none) Thermomucor indicae-seudaticae tra...   125   6e-28
AY264208_1(AY264208|pid:none) Platydoras costatus elongation fac...   125   6e-28
AY264218_1(AY264218|pid:none) Doras carinatus elongation factor-...   125   6e-28
DQ403163_1(DQ403163|pid:none) Capsaspora owczarzaki translation ...   125   6e-28
AY115575_1(AY115575|pid:none) Trichophyton rubrum elongation fac...   125   6e-28
(Q92005) RecName: Full=Elongation factor 1-alpha;          Short...   125   8e-28
AY264241_1(AY264241|pid:none) Leptodoras cf. copei elongation fa...   125   8e-28
FN323396_1(FN323396|pid:none) Schistosoma japonicum isolate Anhu...   125   8e-28
(P50256) RecName: Full=Elongation factor 1-alpha C;          Sho...   125   8e-28
AF157291_1(AF157291|pid:none) Saksenaea vasiformis translation e...   125   8e-28
AF157231_1(AF157231|pid:none) Apophysomyces elegans translation ...   125   8e-28
AY264232_1(AY264232|pid:none) Leptodoras juruensis elongation fa...   125   8e-28
M25504_1(M25504|pid:none) X.laevis elongation factor-1 alpha-cha...   125   8e-28
AY264239_1(AY264239|pid:none) Leptodoras praelongus elongation f...   125   8e-28
AY264238_1(AY264238|pid:none) Leptodoras cf. praelongus elongati...   125   8e-28
AY264212_1(AY264212|pid:none) Orinocodoras eigenmanni elongation...   125   8e-28
(P02994) RecName: Full=Elongation factor 1-alpha;          Short...   125   8e-28
CR382122_362(CR382122|pid:none) Kluyveromyces lactis strain NRRL...   125   8e-28
AY264254_1(AY264254|pid:none) Liosomadoras morrowi elongation fa...   125   8e-28
AY582823_1(AY582823|pid:none) Chytriomyces confervae strain CBS ...   125   8e-28
AY264220_1(AY264220|pid:none) Nemadoras trimaculatus elongation ...   125   8e-28
AB005588_1(AB005588|pid:none) Cynops pyrrhogaster mRNA for newt ...   125   8e-28
AY264251_1(AY264251|pid:none) Auchenipterus demerarae elongation...   125   8e-28
DQ333888_1(DQ333888|pid:none) Hirudo medicinalis putative elonga...   125   8e-28
CR380950_46(CR380950|pid:none) Candida glabrata strain CBS138 ch...   125   8e-28
AY264221_1(AY264221|pid:none) Nemadoras hemipeltis elongation fa...   125   8e-28
EU152294_1(EU152294|pid:none) Dictyocaulus viviparus elongation ...   125   8e-28
DQ083545_1(DQ083545|pid:none) Danio rerio eukaryotic translation...   125   8e-28
AJ250539_1(AJ250539|pid:none) Anisakis simplex mRNA for putative...   125   8e-28
(P28295) RecName: Full=Elongation factor 1-alpha;          Short...   125   8e-28
AY264200_1(AY264200|pid:none) Amblydoras nauticus elongation fac...   124   1e-27
AY264255_1(AY264255|pid:none) Centromochlus heckelii elongation ...   124   1e-27
AY264246_1(AY264246|pid:none) Doras punctatus elongation factor-...   124   1e-27
AY264226_1(AY264226|pid:none) Hemidoras stenopeltis haplotype I ...   124   1e-27
AY264201_1(AY264201|pid:none) Amblydoras cf. monitor elongation ...   124   1e-27
AY264249_1(AY264249|pid:none) Parauchenipterus cf. galeatus elon...   124   1e-27
AY264197_1(AY264197|pid:none) Sorubim lima elongation factor-1 a...   124   1e-27
AB490338_1(AB490338|pid:none) Polypedilum vanderplanki PvEf1-alp...   124   1e-27
AF498320_1(AF498320|pid:none) Oncorhynchus mykiss elongation fac...   124   1e-27
(P34825) RecName: Full=Elongation factor 1-alpha;          Short...   124   1e-27
FJ539142_1(FJ539142|pid:none) Caulerpa cf. racemosa GG-2009 elon...   124   1e-27
AF157234_1(AF157234|pid:none) Benjaminiella poitrasii translatio...   124   1e-27
AY264257_1(AY264257|pid:none) Henonemus punctatus elongation fac...   124   1e-27
AF157245_1(AF157245|pid:none) Dichotomocladium elegans translati...   124   1e-27
AF157293_1(AF157293|pid:none) Sporodiniella umbellata translatio...   124   1e-27
BC022412_1(BC022412|pid:none) Homo sapiens, clone IMAGE:4134193,...   124   1e-27
(A2Q0Z0) RecName: Full=Elongation factor 1-alpha 1;          Sho...   124   1e-27
AY264247_1(AY264247|pid:none) Acanthodoras spinosissimus elongat...   124   1e-27
AB293568_1(AB293568|pid:none) Mordacia mordax MmoEF1a mRNA for e...   124   1e-27
AF157304_1(AF157304|pid:none) Zygorhynchus heterogamus translati...   124   2e-27
AK167843_1(AK167843|pid:none) Mus musculus TIB-55 BB88 cDNA, RIK...   124   2e-27
EU718262_1(EU718262|pid:none) Aschersonia sp. WYYS-47 translatio...   124   2e-27
(Q2HJN6) RecName: Full=Elongation factor 1-alpha 3;          Sho...   124   2e-27
AF157294_1(AF157294|pid:none) Syncephalastrum monosporum var. pl...   124   2e-27
EU718254_1(EU718254|pid:none) Aschersonia sp. WYYS-52 translatio...   124   2e-27
EU718257_1(EU718257|pid:none) Aschersonia sp. WYYS-46 translatio...   124   2e-27
DQ883764_1(DQ883764|pid:none) Teloschistes exilis isolate AFTOL-...   124   2e-27
FJ807243_1(FJ807243|pid:none) Peranema trichophorum strain CCAP ...   124   2e-27
EU718255_1(EU718255|pid:none) Aschersonia sp. WYSD translation e...   124   2e-27
AY062434_1(AY062434|pid:none) Homo sapiens elongation factor 1-a...   124   2e-27
AY582824_1(AY582824|pid:none) Monosiga ovata ef1a mRNA, partial ...   124   2e-27
(Q2HJN9) RecName: Full=Elongation factor 1-alpha 4;          Sho...   124   2e-27
(Q2HJN8) RecName: Full=Elongation factor 1-alpha 2;          Sho...   124   2e-27
AF157260_1(AF157260|pid:none) Mortierella multidivaricata transl...   124   2e-27
AY928339_1(AY928339|pid:none) Oscheius tipulae clone pA1 eukaryo...   124   2e-27
AY264210_1(AY264210|pid:none) Rhinodoras cf. boehlkei elongation...   123   2e-27
AY643400_1(AY643400|pid:none) Pimephales promelas elongation fac...   123   2e-27
AY264203_1(AY264203|pid:none) Physopyxis lyra elongation factor-...   123   2e-27
AB306940_1(AB306940|pid:none) Echinococcus shiquicus ef1a gene f...   123   2e-27
AF157262_1(AF157262|pid:none) Mortierella verticillata translati...   123   2e-27
S01193(S01193) translation elongation factor eEF-1 alpha chain (...   123   2e-27
D45837_1(D45837|pid:none) Neurospora crassa DNA for elongation f...   123   2e-27
AY531943_1(AY531943|pid:none) Beauveria bassiana isolate 6721 tr...   123   2e-27
AF157244_1(AF157244|pid:none) Cunninghamella echinulata translat...   123   2e-27
EU718261_1(EU718261|pid:none) Aschersonia sp. WYSD-14 translatio...   123   3e-27
AY264230_1(AY264230|pid:none) Leptodoras hasemani elongation fac...   123   3e-27
AF157242_1(AF157242|pid:none) Cokeromyces recurvatus translation...   123   3e-27
EF490880_1(EF490880|pid:none) Lepeophtheirus salmonis clone LS00...   123   3e-27
AF157258_1(AF157258|pid:none) Micromucor ramannianus translation...   123   3e-27
AF157243_1(AF157243|pid:none) Cunninghamella bertholletiae trans...   122   4e-27
D82573_1(D82573|pid:none) Schizosaccharomyces pombe mRNA for elo...   122   4e-27
AF157300_1(AF157300|pid:none) Umbelopsis isabellina translation ...   122   4e-27
AF157287_1(AF157287|pid:none) Rhizopus microsporus var. rhizopod...   122   4e-27
(Q10119) RecName: Full=Elongation factor 1-alpha-B/C;          S...   122   4e-27
(P50522) RecName: Full=Elongation factor 1-alpha-A;          Sho...   122   4e-27
AF157273_1(AF157273|pid:none) Parasitella parasitica translation...   122   4e-27
D89112_1(D89112|pid:none) Schizosaccharomyces pombe mRNA, partia...   122   4e-27
DQ250681_1(DQ250681|pid:none) Ancylostoma ceylanicum translation...   122   4e-27
DQ862130_1(DQ862130|pid:none) Beauveria bassiana isolate IBL0318...   122   5e-27
EU726793_1(EU726793|pid:none) Caenorhabditis brenneri clone 9B2C...   122   5e-27
AY264233_1(AY264233|pid:none) Leptodoras acipenserinus elongatio...   122   5e-27
AY264215_1(AY264215|pid:none) Agamyxis albomaculatus elongation ...   122   5e-27
AY190693_1(AY190693|pid:none) Pagrus major elongation factor 1-a...   122   6e-27
AY264198_1(AY264198|pid:none) Zungaro zungaro elongation factor-...   122   6e-27
DQ059051_1(DQ059051|pid:none) Trechispora sp. PBM418 isolate AFT...   122   6e-27
AB097424_1(AB097424|pid:none) Dimargaris cristalligena EF-1a gen...   122   6e-27
BT043569_1(BT043569|pid:none) Salmo salar clone HM4_2380 elongat...   122   6e-27
AY264211_1(AY264211|pid:none) Rhinodoras thomersoni elongation f...   122   6e-27
FN357919_5(FN357919|pid:none) Schistosoma mansoni genome sequenc...   122   6e-27
DQ463994_1(DQ463994|pid:none) Metarhizium anisopliae var. anisop...   122   6e-27
AF015267_1(AF015267|pid:none) Apis mellifera elongation factor-1...   121   8e-27
AF157272_1(AF157272|pid:none) Mycotypha microspora translation e...   121   8e-27
AF157255_1(AF157255|pid:none) Hesseltinella vesiculosa translati...   121   8e-27
U81803_1(U81803|pid:none) Filobasidiella neoformans translation ...   121   8e-27
AF157226_1(AF157226|pid:none) Absidia coerulea translation elong...   121   8e-27
AF172083_1(AF172083|pid:none) Paramecium tetraurelia translation...   121   8e-27
AF157238_1(AF157238|pid:none) Chlamydoabsidia padenii translatio...   121   8e-27
U81804_1(U81804|pid:none) Filobasidiella neoformans translation ...   121   8e-27
AF056109_1(AF056109|pid:none) Telotrochidium henneguyii translat...   121   8e-27
AB306938_1(AB306938|pid:none) Echinococcus vogeli ef1a gene for ...   121   8e-27
AB458256_1(AB458256|pid:none) Marsupenaeus japonicus EF1-alpha m...   121   8e-27
DQ402371_1(DQ402371|pid:none) Gadus morhua eukaryotic elongation...   121   1e-26
AB365126_1(AB365126|pid:none) Upogebia major mRNA for elongation...   121   1e-26
FJ807241_1(FJ807241|pid:none) Jakoba libera elongation factor 1 ...   121   1e-26
BC080974_1(BC080974|pid:none) Xenopus tropicalis hypothetical LO...   120   1e-26
AF388870_1(AF388870|pid:none) Cortinarius globuliformis elongati...   120   1e-26
FJ807238_1(FJ807238|pid:none) Euglena gracilis elongation factor...   120   1e-26
DQ782888_1(DQ782888|pid:none) Cladonia caroliniana isolate AFTOL...   120   1e-26
AF388878_1(AF388878|pid:none) Hymenogaster bulliardii elongation...   120   1e-26
CP001142_85(CP001142|pid:none) Phaeodactylum tricornutum CCAP 10...   120   2e-26
AY048275_1(AY048275|pid:none) Arabidopsis thaliana At1g07930/T6D...   120   2e-26
AC026875_2(AC026875|pid:none) Genomic sequence for Arabidopsis t...   120   2e-26
AY065008_1(AY065008|pid:none) Arabidopsis thaliana At1g07930/T6D...   120   2e-26
AF360167_1(AF360167|pid:none) Arabidopsis thaliana putative tran...   120   2e-26
AY582825_1(AY582825|pid:none) Ministeria vibrans strain ATCC 505...   120   2e-26
(P53013) RecName: Full=Elongation factor 1-alpha;          Short...   120   2e-26
AB122066_1(AB122066|pid:none) Crassostrea gigas EF1-alpha mRNA f...   120   2e-26
EF474126_1(EF474126|pid:none) Monocercomonoides sp. PA clone 2/2...   120   2e-26
FJ807244_1(FJ807244|pid:none) Reclinomonas americana elongation ...   120   2e-26
AK317744_1(AK317744|pid:none) Arabidopsis thaliana AT1G07940 mRN...   120   2e-26
(P13905) RecName: Full=Elongation factor 1-alpha;          Short...   120   2e-26
AF157252_1(AF157252|pid:none) Gongronella butleri translation el...   120   2e-26
S08534(S08534) translation elongation factor eEF-1 alpha chain (...   120   2e-26
EF474125_1(EF474125|pid:none) Monocercomonoides sp. PA clone 1/2...   120   2e-26
AB077103_1(AB077103|pid:none) Piptocephalis freseniana EF-1 alph...   120   2e-26
AF388876_1(AF388876|pid:none) Hebeloma longicaudum elongation fa...   120   2e-26
AK221176_1(AK221176|pid:none) Arabidopsis thaliana mRNA for tran...   120   2e-26
FB784713_1(FB784713|pid:none) Sequence 3986 from Patent WO200803...   120   2e-26
EU436163_1(EU436163|pid:none) Rhipicephalus microplus subolesin-...   120   2e-26
DQ782893_1(DQ782893|pid:none) Dermatocarpon miniatum isolate AFT...   120   2e-26
(Q04634) RecName: Full=Elongation factor 1-alpha;          Short...   120   2e-26
AB294182_1(AB294182|pid:none) Malus x domestica mRNA for hypothe...   120   2e-26
(Q9YIC0) RecName: Full=Elongation factor 1-alpha;          Short...   120   2e-26
DQ782898_1(DQ782898|pid:none) Mycoblastus sanguinarius isolate A...   120   2e-26
EU057531_1(EU057531|pid:none) Saccharomycopsis javanensis strain...   119   3e-26
AF056108_1(AF056108|pid:none) Stylonychia mytilus translation el...   119   3e-26
EU520324_1(EU520324|pid:none) Apodemia mormo elongation factor 1...   119   3e-26
AF157302_1(AF157302|pid:none) Utharomyces epallocaulus translati...   119   3e-26
AF157247_1(AF157247|pid:none) Dissophora decumbens translation e...   119   3e-26
DQ782917_1(DQ782917|pid:none) Agonimia sp. AFTOL 684 elongation ...   119   3e-26
AY883429_1(AY883429|pid:none) Suillus pictus isolate AFTOL-ID 71...   119   4e-26
AK317216_1(AK317216|pid:none) Arabidopsis thaliana AT1G07930 mRN...   119   4e-26
AY729874_1(AY729874|pid:none) Plectospira myriandra elongation f...   119   4e-26
AF388844_1(AF388844|pid:none) Cortinarius elaiochrous elongation...   119   4e-26
DQ782901_1(DQ782901|pid:none) Lecanora hybocarpa isolate AFTOL-I...   119   4e-26
AF388868_1(AF388868|pid:none) Cortinarius acutus elongation fact...   119   4e-26
AF388863_1(AF388863|pid:none) Cortinarius cinereobrunneus elonga...   119   4e-26
AF056098_1(AF056098|pid:none) Colpoda inflata translation elonga...   119   4e-26
AF388857_1(AF388857|pid:none) Cortinarius talus elongation facto...   119   4e-26
FN323419_1(FN323419|pid:none) Schistosoma japonicum isolate Anhu...   119   4e-26
U97366_1(U97366|pid:none) Schizosaccharomyces pombe translation ...   119   4e-26
AF388864_1(AF388864|pid:none) Cortinarius infractus elongation f...   119   4e-26
AB097425_1(AB097425|pid:none) Syncephalis depressa EF-1a gene fo...   119   4e-26
AF388858_1(AF388858|pid:none) Protoglossum luteum elongation fac...   119   4e-26
AF388854_1(AF388854|pid:none) Cortinarius calochrous elongation ...   119   4e-26
AY264243_1(AY264243|pid:none) Trachydoras steindachneri elongati...   119   4e-26
DQ782919_1(DQ782919|pid:none) Peltula umbilicata isolate AFTOL-I...   119   4e-26
DQ028604_1(DQ028604|pid:none) Polyozellus multiplex isolate AFTO...   119   4e-26
EU057543_1(EU057543|pid:none) Saccharomycopsis microspora strain...   119   5e-26
AF388850_1(AF388850|pid:none) Cortinarius scaurus elongation fac...   119   5e-26
AF388847_1(AF388847|pid:none) Cortinarius magellanicus elongatio...   119   5e-26
FB784741_1(FB784741|pid:none) Sequence 4014 from Patent WO200803...   119   5e-26
DQ522357_1(DQ522357|pid:none) Simplicillium lanosoniveum strain ...   119   5e-26
EU072931_1(EU072931|pid:none) Paeonia suffruticosa clone 1 elong...   119   5e-26
EF551322_1(EF551322|pid:none) Chara australis elongation factor ...   119   5e-26
FJ539141_1(FJ539141|pid:none) Parvocaulis pusilla strain UTEX LB...   119   5e-26
AF331849_1(AF331849|pid:none) Saccharum hybrid cultivar CP65-357...   119   5e-26
AM111324_1(AM111324|pid:none) Plantago major partial mRNA for tr...   119   5e-26
DQ352829_1(DQ352829|pid:none) Sporisorium scitamineum isolate Br...   118   7e-26
AF388853_1(AF388853|pid:none) Cortinarius salor elongation facto...   118   7e-26
(O64937) RecName: Full=Elongation factor 1-alpha;          Short...   118   7e-26
FB784587_1(FB784587|pid:none) Sequence 3860 from Patent WO200803...   118   7e-26
EU976709_1(EU976709|pid:none) Zea mays clone 988175 elongation f...   118   7e-26
AB073631_1(AB073631|pid:none) Salsola komarovii skef-1A mRNA for...   118   7e-26
(Q07051) RecName: Full=Elongation factor 1-alpha;          Short...   118   9e-26
DQ352830_1(DQ352830|pid:none) Ustilago maydis isolate B-PBi-4-1-...   118   9e-26
EF588667_1(EF588667|pid:none) Loricera pilicornis elongation fac...   118   9e-26
AJ223969_1(AJ223969|pid:none) Malus domestica mRNA for elongatio...   118   9e-26
AF157264_1(AF157264|pid:none) Mucor circinelloides f. lusitanicu...   118   9e-26
FB784589_1(FB784589|pid:none) Sequence 3862 from Patent WO200803...   118   9e-26
EU326289_1(EU326289|pid:none) Lycaena heteronea elongation facto...   118   9e-26
D63396_1(D63396|pid:none) Nicotiana tabacum mRNA for elongation ...   118   9e-26
AY157315_1(AY157315|pid:none) Stevia rebaudiana elongation facto...   118   9e-26
DQ273144_1(DQ273144|pid:none) Simulium transiens elongation fact...   118   9e-26
DQ522352_1(DQ522352|pid:none) Metarhizium album strain ARSEF 208...   118   9e-26
AB097423_1(AB097423|pid:none) Coemansia mojavensis EF1a gene for...   118   9e-26
Y08487_1(Y08487|pid:none) S.mansoni mRNA for elongation factor 1...   118   9e-26
AB294183_1(AB294183|pid:none) Malus x domestica mRNA for hypothe...   118   9e-26
EU326288_1(EU326288|pid:none) Lycaena nivalis elongation factor ...   118   9e-26
AY489632_1(AY489632|pid:none) Verticillium dahliae strain ATCC 1...   118   9e-26
AM426329_1(AM426329|pid:none) Vitis vinifera contig VV78X075083....   118   9e-26
AJ250733_1(AJ250733|pid:none) Dreissena polymorpha mRNA for tran...   118   9e-26
(Q41011) RecName: Full=Elongation factor 1-alpha;          Short...   118   9e-26
AF181492_1(AF181492|pid:none) Lilium longiflorum elongation fact...   118   9e-26
U80268_1(U80268|pid:none) Malus domestica elongation factor 1 al...   118   9e-26
AJ536671_1(AJ536671|pid:none) Solanum tuberosum mRNA for elongat...   118   9e-26
AF388859_1(AF388859|pid:none) Cortinarius callisteus elongation ...   117   1e-25
AM055942_137(AM055942|pid:none) Toxoplasma gondii RH, genomic DN...   117   1e-25
DQ228347_1(DQ228347|pid:none) Solanum tuberosum clone 149A09 elo...   117   1e-25
AF157275_1(AF157275|pid:none) Phycomyces blakesleeanus translati...   117   1e-25
FB784607_1(FB784607|pid:none) Sequence 3880 from Patent WO200803...   117   1e-25
AY300042_1(AY300042|pid:none) Solanum tuberosum putative transla...   117   1e-25
DQ222490_1(DQ222490|pid:none) Solanum tuberosum clone 098G02 elo...   117   1e-25
AF388849_1(AF388849|pid:none) Cortinarius vibratilis elongation ...   117   1e-25
M81088_1(M81088|pid:none) Rat EF-1-alpha mRNA, 3' end.                117   1e-25
(P17786) RecName: Full=Elongation factor 1-alpha;          Short...   117   1e-25
AF388875_1(AF388875|pid:none) Cortinarius brunneus elongation fa...   117   1e-25
AY496125_1(AY496125|pid:none) Capsicum annuum elongation factor ...   117   1e-25
AF181491_1(AF181491|pid:none) Lilium longiflorum elongation fact...   117   1e-25
DQ029199_1(DQ029199|pid:none) Aureoboletus thibetanus isolate AF...   117   1e-25
AM494954_9(AM494954|pid:none) Leishmania braziliensis chromosome...   117   1e-25
DQ294264_1(DQ294264|pid:none) Solanum tuberosum clone 131C12 elo...   117   1e-25
DQ228326_1(DQ228326|pid:none) Solanum tuberosum clone 135F02 elo...   117   1e-25
(Q41803) RecName: Full=Elongation factor 1-alpha;          Short...   117   1e-25
AF388841_1(AF388841|pid:none) Cortinarius collinitus elongation ...   117   1e-25
AB061263_1(AB061263|pid:none) Solanum tuberosum EF-1-alpha mRNA ...   117   1e-25
DQ832233_1(DQ832233|pid:none) Sporisorium reilianum AFTOL-ID 490...   117   1e-25
DQ174254_1(DQ174254|pid:none) Gossypium hirsutum translation elo...   117   2e-25
DQ174255_1(DQ174255|pid:none) Gossypium hirsutum translation elo...   117   2e-25
DQ522339_1(DQ522339|pid:none) Cordyceps unilateralis strain OSC ...   117   2e-25
BT071272_1(BT071272|pid:none) Picea sitchensis clone WS02817_F13...   117   2e-25
EF676955_1(EF676955|pid:none) Picea sitchensis clone WS02758_N22...   117   2e-25
AF091355_1(AF091355|pid:none) Blastocystis hominis isolate C elo...   117   2e-25
DQ407753_1(DQ407753|pid:none) Gymnadenia conopsea EF-1 alpha mRN...   117   2e-25
DQ174250_1(DQ174250|pid:none) Gossypium hirsutum translation elo...   117   2e-25
I54251(I54251) translation elongation factor eEF-1 alpha - human...   117   2e-25
DQ174253_1(DQ174253|pid:none) Gossypium hirsutum translation elo...   117   2e-25
AY785668_1(AY785668|pid:none) Trypanosoma cruzi strain Silvio X1...   117   2e-25
EF145289_1(EF145289|pid:none) Populus trichocarpa clone WS01122_...   117   2e-25
EU326287_1(EU326287|pid:none) Speyeria mormonia elongation facto...   117   2e-25
AY695068_1(AY695068|pid:none) Monacrosporium parvicolle translat...   117   2e-25
DQ522333_1(DQ522333|pid:none) Cordyceps nutans strain OSC 110994...   117   2e-25
AY785691_1(AY785691|pid:none) Trypanosoma cruzi strain Esmeraldo...   117   2e-25
AY785665_1(AY785665|pid:none) Trypanosoma cruzi strain M6241 cl6...   117   2e-25
FB784593_1(FB784593|pid:none) Sequence 3866 from Patent WO200803...   117   2e-25
AY785675_1(AY785675|pid:none) Trypanosoma cruzi strain NR cl3 cl...   117   2e-25
AY785676_1(AY785676|pid:none) Trypanosoma cruzi strain NR cl3 cl...   117   2e-25
AY813512_1(AY813512|pid:none) Schistosoma japonicum clone SJCHGC...   117   2e-25
BT036587_1(BT036587|pid:none) Zea mays full-length cDNA clone ZM...   117   2e-25
AY785684_1(AY785684|pid:none) Trypanosoma cruzi strain MT4167 cl...   117   2e-25
AY785685_1(AY785685|pid:none) Trypanosoma cruzi strain Basileu c...   117   2e-25
AY785660_1(AY785660|pid:none) Trypanosoma cruzi strain Dm 28 c c...   117   2e-25
AF136826_1(AF136826|pid:none) Zea mays clone d elongation factor...   117   2e-25
FB784601_1(FB784601|pid:none) Sequence 3874 from Patent WO200803...   117   2e-25
DQ174251_1(DQ174251|pid:none) Gossypium hirsutum translation elo...   117   2e-25
AY785666_1(AY785666|pid:none) Trypanosoma cruzi strain M6241 cl6...   117   2e-25
JC5117(JC5117) translation elongation factor eEF-1 alpha - Trypa...   117   2e-25
AY785688_1(AY785688|pid:none) Trypanosoma cruzi strain CA1 clone...   117   2e-25
AY785657_1(AY785657|pid:none) Trypanosoma cruzi strain Colombian...   117   2e-25
DQ464004_1(DQ464004|pid:none) Metarhizium flavoviride var. pemph...   116   3e-25
EF469063_1(EF469063|pid:none) Hirsutella sp. NHJ 12525 translati...   116   3e-25
AB106676_1(AB106676|pid:none) Avicennia marina EF1-A mRNA for el...   116   3e-25
AY062553_1(AY062553|pid:none) Arabidopsis thaliana putative elon...   116   3e-25
AF016240_1(AF016240|pid:none) Planoprotostelium aurantium protei...   116   3e-25
DQ463997_1(DQ463997|pid:none) Metarhizium flavoviride var. flavo...   116   3e-25
(P32186) RecName: Full=Elongation factor 1-alpha;          Short...   116   3e-25
EF588666_1(EF588666|pid:none) Caenocholax fenyesi elongation fac...   116   3e-25
AY832556_1(AY832556|pid:none) Pseudotsuga menziesii var. menzies...   116   4e-25
FB784751_1(FB784751|pid:none) Sequence 4024 from Patent WO200803...   116   4e-25
AF388845_1(AF388845|pid:none) Cortinarius fulvo-ochrascens elong...   116   4e-25
AB032900_1(AB032900|pid:none) Seriola quinqueradiata mRNA for el...   116   4e-25
BT070606_1(BT070606|pid:none) Picea sitchensis clone WS02739_H11...   116   4e-25
BT070573_1(BT070573|pid:none) Picea sitchensis clone WS02736_O15...   116   4e-25
AM286248_1(AM286248|pid:none) Platanus x acerifolia partial mRNA...   116   4e-25
FB784731_1(FB784731|pid:none) Sequence 4004 from Patent WO200803...   116   4e-25
DQ522320_1(DQ522320|pid:none) Claviceps fusiformis strain ATCC 2...   116   4e-25
AF121261_1(AF121261|pid:none) Lilium longiflorum elongation fact...   116   4e-25
BT071731_1(BT071731|pid:none) Picea sitchensis clone WS0443_M05 ...   116   4e-25
EF469070_1(EF469070|pid:none) Roumegueriella rufula strain GJS 9...   116   4e-25
AF543784_1(AF543784|pid:none) Hypomyces polyporinus strain ATCC ...   116   4e-25
EF660340_1(EF660340|pid:none) Phaseolus vulgaris elongation fact...   116   4e-25
AJ010225_1(AJ010225|pid:none) Cicer arietinum mRNA for elongatio...   116   4e-25
EF085539_1(EF085539|pid:none) Picea sitchensis clone WS02729_N03...   116   4e-25
X96678_1(X96678|pid:none) N.pseudonarcissu mRNA for elongation f...   116   4e-25
U72244_1(U72244|pid:none) Leishmania braziliensis tandemly repea...   115   5e-25
EU080442_1(EU080442|pid:none) Phytophthora undulata isolate PD_0...   115   5e-25
EU953172_1(EU953172|pid:none) Zea mays clone 1388537 elongation ...   115   5e-25
A54760(A54760;C49394)translation elongation factor eEF-1 alpha c...   115   5e-25
AY785728_1(AY785728|pid:none) Trypanosoma rangeli strain San Agu...   115   5e-25
AF416379_1(AF416379|pid:none) Leishmania donovani elongation fac...   115   5e-25
AY695062_1(AY695062|pid:none) Monacrosporium drechsleri translat...   115   5e-25
AY489610_1(AY489610|pid:none) Balansia henningsiana strain AEG96...   115   5e-25
DQ522345_1(DQ522345|pid:none) Cordyceps irangiensis strain OSC 1...   115   5e-25
AF136823_1(AF136823|pid:none) Zea mays clone a elongation factor...   115   5e-25
EF469072_1(EF469072|pid:none) Shimizuomyces paradoxus strain EFC...   115   5e-25
CT005256_10(CT005256|pid:none) Leishmania major strain Friedlin,...   115   5e-25
DQ471426_1(DQ471426|pid:none) Litchi chinensis elongation factor...   115   5e-25
EF468743_1(EF468743|pid:none) Balansia epichloe strain AEG 96-15...   115   5e-25
AY885160_1(AY885160|pid:none) Ustilago maydis isolate AFTOL-ID 5...   115   5e-25
AY973258_1(AY973258|pid:none) Leishmania major elongation factor...   115   5e-25
DQ522318_1(DQ522318|pid:none) Aschersonia placenta strain BCC 79...   115   5e-25
(P41166) RecName: Full=Elongation factor 1-alpha;          Short...   115   5e-25
DQ522319_1(DQ522319|pid:none) Balansia pilulaeformis strain AEG ...   115   5e-25
AM443412_1(AM443412|pid:none) Vitis vinifera contig VV78X070573....   115   5e-25
AB491177_1(AB491177|pid:none) Nelumbo nucifera NnEF1a mRNA for e...   115   6e-25
AF302930_1(AF302930|pid:none) Corcyra cephalonica elongation fac...   115   6e-25
AF136827_1(AF136827|pid:none) Zea mays clone e elongation factor...   115   6e-25
AY651886_1(AY651886|pid:none) Glycine max elongation factor 1A S...   115   6e-25
DQ832215_1(DQ832215|pid:none) Schizonella melanogramma AFTOL-ID ...   115   6e-25
EU969402_1(EU969402|pid:none) Zea mays clone 329758 elongation f...   115   6e-25
DQ522344_1(DQ522344|pid:none) Hydropisphaera erubescens strain A...   115   6e-25
(P25698) RecName: Full=Elongation factor 1-alpha;          Short...   115   6e-25
FB784723_1(FB784723|pid:none) Sequence 3996 from Patent WO200803...   115   6e-25
DQ522347_1(DQ522347|pid:none) Hypocrella nectrioides strain GJS ...   115   6e-25
FJ807246_1(FJ807246|pid:none) Stachyamoeba lipophora elongation ...   115   6e-25
FB784591_1(FB784591|pid:none) Sequence 3864 from Patent WO200803...   115   6e-25
FB784725_1(FB784725|pid:none) Sequence 3998 from Patent WO200803...   115   6e-25
AF543778_1(AF543778|pid:none) Claviceps purpurea strain AEG 97-2...   115   8e-25
AY695064_1(AY695064|pid:none) Monacrosporium ellipsosporum trans...   115   8e-25
AY489615_1(AY489615|pid:none) Cordyceps capitata translation elo...   115   8e-25
AY643817_1(AY643817|pid:none) Fuligo septica elongation factor 1...   115   8e-25
DQ174257_1(DQ174257|pid:none) Gossypium hirsutum translation elo...   115   8e-25
EF468770_1(EF468770|pid:none) Cordyceps sp. EFCC 2131 translatio...   115   8e-25
EF147322_1(EF147322|pid:none) Populus trichocarpa clone WS0122_J...   115   8e-25
DQ522327_1(DQ522327|pid:none) Cordyceps chlamydosporia strain CB...   115   8e-25
EF468785_1(EF468785|pid:none) Microhilum oncoperae strain AFSEF ...   115   8e-25
EF468776_1(EF468776|pid:none) Cordyceps staphylinidicola strain ...   115   8e-25
AY489618_1(AY489618|pid:none) Cordyceps ophioglossoides translat...   115   8e-25
AK221085_1(AK221085|pid:none) Arabidopsis thaliana mRNA for elon...   115   8e-25
DQ522328_1(DQ522328|pid:none) Cordyceps fracta strain OSC 110990...   115   8e-25
DQ522335_1(DQ522335|pid:none) Cordyceps scarabaeicola strain ARS...   115   8e-25
DQ522342_1(DQ522342|pid:none) Haptocillium balanoides strain CBS...   115   8e-25
DQ522340_1(DQ522340|pid:none) Cordyceps variabilis strain ARSEF ...   115   8e-25
DQ522330_1(DQ522330|pid:none) Cordyceps japonica strain OSC 1109...   115   8e-25
DQ174252_1(DQ174252|pid:none) Gossypium hirsutum translation elo...   115   8e-25
AF543785_1(AF543785|pid:none) Nectria cinnabarina strain GJS 89-...   115   8e-25
DQ522343_1(DQ522343|pid:none) Haptocillium sinense strain CBS 56...   115   8e-25
DQ322644_1(DQ322644|pid:none) Babesia bovis strain Mo7 elongatio...   114   1e-24
EU420127_1(EU420127|pid:none) Clavicipitaceae sp. CV-2008a trans...   114   1e-24
DQ056288_1(DQ056288|pid:none) Platygloea disciformis isolate AFT...   114   1e-24
EF468761_1(EF468761|pid:none) Cordyceps cf. pruinosa NHJ 10684 t...   114   1e-24
DQ174256_1(DQ174256|pid:none) Gossypium hirsutum translation elo...   114   1e-24
DQ522321_1(DQ522321|pid:none) Claviceps paspali strain ATCC 1389...   114   1e-24
EF468790_1(EF468790|pid:none) Paecilomyces lilacinus strain ARSE...   114   1e-24
EF468794_1(EF468794|pid:none) Phytocordyceps ninchukispora strai...   114   1e-24
DQ522323_1(DQ522323|pid:none) Cordyceps aphodii strain ARSEF 549...   114   1e-24
(P90519) RecName: Full=Elongation factor 1-alpha;          Short...   114   1e-24
AF543779_1(AF543779|pid:none) Ophionectria trichospora strain CB...   114   1e-24
(P34824) RecName: Full=Elongation factor 1-alpha;          Short...   114   1e-24
EU057533_1(EU057533|pid:none) Candida lassenensis strain NRRL YB...   114   1e-24
EF468764_1(EF468764|pid:none) Ophiocordyceps rhizoidea strain NH...   114   1e-24
AY582826_1(AY582826|pid:none) Corallochytrium limacisporum ef1a ...   114   1e-24
AY264242_1(AY264242|pid:none) Trachydoras nattereri haplotype I ...   114   1e-24
EF468771_1(EF468771|pid:none) Cordyceps sp. NHJ 12582 translatio...   114   1e-24
DQ059053_1(DQ059053|pid:none) Hydnellum geogenium isolate AFTOL-...   114   1e-24
(Q40034) RecName: Full=Elongation factor 1-alpha;          Short...   114   1e-24
EF469068_1(EF469068|pid:none) Nectria sp. CBS 478.75 translation...   114   1e-24
AF479046_1(AF479046|pid:none) Triticum aestivum elongation facto...   114   1e-24
AF136829_1(AF136829|pid:none) Zea mays clone g elongation factor...   114   2e-24
AB070233_1(AB070233|pid:none) Branchiostoma floridae EF-1a gene ...   114   2e-24
AF543781_1(AF543781|pid:none) Hypocrea lutea strain ATCC 208838 ...   114   2e-24
AY883427_1(AY883427|pid:none) Hygrophoropsis aurantiaca isolate ...   114   2e-24
(O49169) RecName: Full=Elongation factor 1-alpha;          Short...   114   2e-24
S17434(S17434;S27130;S18002)translation elongation factor eEF-1 ...   114   2e-24
AL844509_554(AL844509|pid:none) Plasmodium falciparum 3D7 chromo...   114   2e-24
DQ848182_1(DQ848182|pid:none) Escovopsis sp. agh030627-08 esc1 e...   114   2e-24
DQ848157_1(DQ848157|pid:none) Escovopsis sp. nmg010816-05 esc1 e...   114   2e-24
EF677879_1(EF677879|pid:none) Picea sitchensis clone WS0277_C20 ...   114   2e-24
DQ522331_1(DQ522331|pid:none) Cordyceps melolonthae strain OSC 1...   114   2e-24
AF016241_1(AF016241|pid:none) Planoprotostelium aurantium protei...   114   2e-24
A37159(A37159)translation elongation factor eEF-1 alpha-related ...   114   2e-24
AY531884_1(AY531884|pid:none) Beauveria bassiana isolate 1153 tr...   113   2e-24
AY531881_1(AY531881|pid:none) Beauveria bassiana isolate 1040 tr...   113   2e-24
EF147714_1(EF147714|pid:none) Populus trichocarpa clone WS0124_H...   113   2e-24
AF281361_1(AF281361|pid:none) Saccharum officinarum elongation f...   113   2e-24
AY531894_1(AY531894|pid:none) Beauveria bassiana isolate 1567 tr...   113   2e-24
AY531940_1(AY531940|pid:none) Beauveria bassiana isolate 5718 tr...   113   2e-24

>X55973_1(X55973|pid:none) D. discoideum EF1-I gene for elongation
           factor 1 alpha.
          Length = 453

 Score =  165 bits (417), Expect = 7e-40
 Identities = 85/113 (75%), Positives = 85/113 (75%)
 Frame = +2

Query: 59  PLQXTEKXVXQVXVLNHPGQIHAGYSPVLXCHXAHIACKFXEIVDKVDRRXXXXXXXXXX 238
           P Q TEK V QV VLNHPGQIHAGYSPVL CH AHIACKF EIVDKVDRR
Sbjct: 324 PPQETEKFVAQVIVLNHPGQIHAGYSPVLDCHTAHIACKFTEIVDKVDRRTGAVVAKEGT 383

Query: 239 XXXXLKNGDAAMVELTPSRPMCVESFXEXPPLGRFXVXXMRQTVAVGVIKXTV 397
               LKNGDAAMVELTPSRPMCVESF E PPLGRF V  MRQTVAVGVIK TV
Sbjct: 384 AAVVLKNGDAAMVELTPSRPMCVESFTEYPPLGRFAVRDMRQTVAVGVIKSTV 436

 Score = 42.7 bits (99), Expect = 0.005
 Identities = 19/23 (82%), Positives = 19/23 (82%)
 Frame = +2

Query: 11  DAXVEPKRPHDKPLRIPLQXTEK 79
           DA VEPKRPHDKPLRIPLQ   K
Sbjct: 224 DAIVEPKRPHDKPLRIPLQDVYK 246

Lambda     K      H
   0.318    0.134    0.401

Gapped
Lambda     K      H
   0.267   0.0410    0.140

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3236559
Number of Hits to DB: 428,917,152
Number of extensions: 4840839
Number of successful extensions: 18797
Number of sequences better than 10.0: 4820
Number of HSP's gapped: 15385
Number of HSP's successfully gapped: 5695
Length of query: 169
Length of database: 1,051,180,864
Length adjustment: 119
Effective length of query: 50
Effective length of database: 666,030,343
Effective search space: 33301517150
Effective search space used: 33301517150
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 30 (16.2 bits)
PSORT 

 psg: 0.75  gvh: 0.50  alm: 0.44  top: 0.53  tms: 0.00  mit: 0.14  mip: 0.00
 nuc: 0.00  erl: 0.00  erm: 0.40  pox: 0.00  px2: 0.00  vac: 0.00  rnp: 0.00
 act: 0.00  caa: 0.00  yqr: 0.00  tyr: 0.00  leu: 0.00  gpi: 0.00  myr: 0.00
 dna: 0.00  rib: 0.00  bac: 0.00  m1a: 0.00  m1b: 0.00  m2 : 0.00  mNt: 0.00
 m3a: 0.00  m3b: 0.00  m_ : 1.00 

	 40.0 %: cytoplasmic
	 28.0 %: nuclear
	 16.0 %: mitochondrial
	  8.0 %: vacuolar
	  4.0 %: peroxisomal
	  4.0 %: endoplasmic reticulum

>> prediction for Contig-U12937-1 is cyt
VS (DIR, S) 0
VH (FL, L) 0
VF (FL, S) 0
AH (FL, L) 0
AF (FL, S) 0
SL (DIR, L) 0
SS (DIR, S) 0
SH (FL, L) 0
SF (FL, S) 0
CH (FL, L) 1
CF (FL, S) 0
FCL (DIR, L) 0
FC (DIR, S) 0
FC-IC (SUB) 0