Contig-U12414-1 |
Contig ID |
Contig-U12414-1 |
Contig update |
2002.12.18 |
Contig sequence |
|
Gap |
gap included |
Contig length |
1285 |
Chromosome number (1..6, M) |
3 |
Chromosome length |
6358359 |
Start point |
2482304 |
End point |
2481038 |
Strand (PLUS/MINUS) |
MINUS |
Number of clones |
1 |
Number of EST |
2 |
Link to clone list |
U12414 |
List of clone(s) |
|
Translated Amino Acid sequence |
|
Translated Amino Acid sequence (All Frames) |
|
own update |
2004. 6.10 |
Homology vs CSM-cDNA |
|
dna update |
2008.11.30 |
Homology vs DNA |
Query= Contig-U12414-1 (Contig-U12414-1Q) /CSM_Contig/Contig-U12414-1Q.Seq.d (1295 letters)
Database: ddbj_A 92,845,959 sequences; 95,242,211,685 total letters
Searching..................................................done
Score E Sequences producing significant alignments: (bits) Value N
(D82024) Dictyostelium discoideum topA gene for DNA topoisom... 1168 0.0 1 (BJ419390) Dictyostelium discoideum cDNA clone:ddv35p21, 5' ... 1168 0.0 1 (BJ437974) Dictyostelium discoideum cDNA clone:ddv35p21, 3' ... 1041 0.0 3 (EK334018) 1095467034148 Global-Ocean-Sampling_GS-31-01-01-1... 68 1e-14 4 (AY504965) Entamoeba histolytica topoisomerase II gene, comp... 84 2e-11 1 (BJ397293) Dictyostelium discoideum cDNA clone:dds45d23, 5' ... 82 6e-11 1 (BJ394687) Dictyostelium discoideum cDNA clone:dds36k04, 5' ... 82 6e-11 1 (BJ331732) Dictyostelium discoideum cDNA clone:dda36i22, 5' ... 82 6e-11 1 (DJ131571) Method for identification of useful proteins deri... 78 2e-10 2 (Z71364) S.cerevisiae chromosome XIV reading frame ORF YNL088w. 78 9e-10 1 (X89016) S.cerevisiae genes RHO2, TOP2, MKT1, END2, PMS1 AND... 78 9e-10 1 (M13814) Saccharomyces cerevisiae topoisomerase II (TOP2) ge... 78 9e-10 1 (DQ115393) Saccharomyces cerevisiae Pol1p (POL1) gene, parti... 78 9e-10 1 (AF458981) Saccharomyces cerevisiae strain YJM627, partial g... 78 9e-10 1 (AF458980) Saccharomyces cerevisiae strain YJM270, partial g... 78 9e-10 1 (AF458979) Saccharomyces cerevisiae strain YJM269, partial g... 78 9e-10 1 (AF458978) Saccharomyces cerevisiae strain YJM1129, partial ... 78 9e-10 1 (AF458977) Saccharomyces cerevisiae strain W303, partial gen... 78 9e-10 1 (AF458976) Saccharomyces cerevisiae strain SK1, partial genome. 78 9e-10 1 (AF458975) Saccharomyces cerevisiae strain YJM789, partial g... 78 9e-10 1 (AF458974) Saccharomyces cerevisiae strain YJM421, partial g... 78 9e-10 1 (AF458973) Saccharomyces cerevisiae strain YJM339, partial g... 78 9e-10 1 (AF458972) Saccharomyces cerevisiae strain YJM326, partial g... 78 9e-10 1 (AF458971) Saccharomyces cerevisiae strain YJM320, partial g... 78 9e-10 1 (AF458970) Saccharomyces cerevisiae strain YJM280, partial g... 78 9e-10 1 (AF458969) Saccharomyces cerevisiae strain S96, partial genome. 78 9e-10 1 (EA376844) Sequence 25667 from patent US 7314974. 78 9e-10 1 (DJ210473) Method for identification of useful proteins deri... 78 9e-10 1 (DJ025882) Genome-wide DNA marker of Saccharomyces cerevisiae. 78 9e-10 1 (AX829724) Sequence 444 from Patent WO03072602. 78 9e-10 1 (AX818694) Sequence 444 from Patent EP1338608. 78 9e-10 1 (AX595294) Sequence 948 from Patent EP1258494. 78 9e-10 1 (AC138524) Homo sapiens chromosome 5 clone XXyac-4X104D9, WO... 78 9e-10 1 (AY579202) Tetrahymena thermophila DNA topoisomerase type 2 ... 60 1e-09 3 (X04326) Fission yeast TOP2 gene for DNA topoisomerase II. 76 4e-09 1 (CU329671) Schizosaccharomyces pombe chromosome II. 76 4e-09 1 (EA377335) Sequence 26158 from patent US 7314974. 76 4e-09 1 (AL399576) T7 end of clone AS0AA016A05 of library AS0AA from... 70 2e-07 1 (AB049139) Issatchenkia orientalis top2 gene for type II DNA... 70 2e-07 1 (AL397578) T3 end of clone AS0AA003H03 of library AS0AA from... 70 2e-07 1 (AL049183) Plasmodium falciparum DNA *** SEQUENCING IN PROGR... 66 4e-07 10 (AB049140) Candida tropicalis top2 gene for type II DNA topo... 68 9e-07 1 (X79345) Plasmodium falciparum TopoII gene. 66 1e-06 3 (EL496127) F11_PFBAMHI-L-T7-PLATE2A.AB1 Blood stage Plasmodi... 66 2e-06 2 (EL496258) G01_PFBAMHI-M-T7-PLATE20A.AB1 Blood stage Plasmod... 66 2e-06 2 (EL494324) C09_PFBAMHI-MEDIUM-T7-PLATE1A.AB1 Blood stage Pla... 66 2e-06 2 (CR382123) Kluyveromyces lactis strain NRRL Y-1140 chromosom... 66 4e-06 1 (BD001869) Method for identifying/detecting eucaryote with I... 66 4e-06 1 (AE014821) Plasmodium falciparum 3D7 chromosome 14 section 6... 66 4e-06 1 (EL496115) F10_PFBAMHI-S-T7-PLATE6A.AB1 Blood stage Plasmodi... 66 4e-06 1 (EK213930) 1095460110055 Global-Ocean-Sampling_GS-31-01-01-1... 44 8e-06 4 (AL437799) T3 end of clone BC0AA011F05 of library BC0AA from... 58 3e-05 2 (AF013277) Bombyx mori topoisomerase II (TOPOII) mRNA, compl... 62 6e-05 1 (DY888989) CeleSEQ6446 Cunninghamella elegans pBluescript (E... 62 6e-05 1 (AB049138) Kluyveromyces marxianus top2 gene for type II DNA... 60 7e-05 2 (CR382137) Debaryomyces hansenii chromosome E of strain CBS7... 58 9e-04 1 (AB049144) Candida parapsilosis top2 gene for type II DNA to... 58 9e-04 1 (Y14559) Pisum sativum mRNA for topoisomerase II. 56 0.002 3 (ER302871) 1092343718363 Global-Ocean-Sampling_GS-34-01-01-1... 52 0.005 2 (EL506748) B09_PF-SAU3A-T3-M-P1.AB1 Blood stage Plasmodium f... 50 0.009 2 (BA000026) Mycoplasma penetrans HF-2 DNA, complete genome. 38 0.011 21 (AB049145) Pichia guilliermondii top2 gene for type II DNA t... 46 0.013 2 (CR380956) Candida glabrata strain CBS138 chromosome J compl... 54 0.014 1 (AB010644) Candida glabrata Top2 gene for TopoisomeraseII, c... 54 0.014 1 (DE335024) Bombyx mori genomic DNA, BAC clone:BET_017_C12. 54 0.014 1 (AI649350) uk30g02.x1 Sugano mouse kidney mkia Mus musculus ... 54 0.014 1 (BJ351213) Dictyostelium discoideum cDNA clone:dda42n11, 3' ... 54 0.014 1 (EK484128) 1095469536250 Global-Ocean-Sampling_GS-32-01-01-1... 38 0.014 3 (AM631920) Entamoeba dispar GSS, clone dispar77d12.p1k. 28 0.040 5 (AE017308) Mycoplasma mobile 163K complete genome. 38 0.042 16 (AB096067) Microsporum canis top2 gene for DNA topoisomerase... 40 0.052 3 (AY169238) Nicotiana tabacum DNA topoisomerase II mRNA, comp... 52 0.054 1 (AF546127) Fusarium tricinctum isolate 7 topoisomerase II (T... 52 0.054 1 (AB049141) Candida tropicalis top2 gene for type II DNA topo... 52 0.054 1 (AL416492) T3 end of clone AX0AA014H10 of library AX0AA from... 52 0.054 1 (DA494189) Homo sapiens cDNA clone FCBBF3006391, 5' end, mRN... 52 0.054 1 (BP526968) Nicotiana tabacum cDNA, clone: BY11727, primer: M... 52 0.054 1 (AP009180) Candidatus Carsonella ruddii PV DNA, complete gen... 36 0.11 9 (AC116957) Dictyostelium discoideum chromosome 2 map 1685067... 34 0.13 15 (AM639204) Entamoeba dispar GSS, clone dispar60f03.q1k. 50 0.21 1 (AM627026) Entamoeba dispar GSS, clone dispar19b07.q1k. 50 0.21 1 (CU736099) Phaeodactylum tricornutum mRNA 5-prime sequence f... 50 0.21 1 (DQ088147) Mycoplasma hyopneumoniae F7.2C P146 adhesin like-... 42 0.23 3 (CJ451890) Macaca fascicularis mRNA, clone: QflA-17521, 5' e... 38 0.25 2 (AQ934959) CpG2341B CpIOWAgDNA1 Cryptosporidium parvum genom... 40 0.26 2 (CT030672) Platynereis dumerilii bac CH305_229K15, WORKING D... 40 0.44 5 (AL935257) Lactobacillus plantarum strain WCFS1 complete gen... 34 0.45 2 (AB172290) Macaca fascicularis brain cDNA, clone: QflA-17521. 38 0.50 2 (CU181911) Zebrafish DNA sequence from clone CH73-220M18 in ... 42 0.55 3 (AR549952) Sequence 5083 from patent US 6747137. 40 0.59 2 (EK381472) 1095469463331 Global-Ocean-Sampling_GS-31-01-01-1... 36 0.60 2 (AL354707) Human DNA sequence from clone RP11-390F4 on chrom... 38 0.75 4 (AE009951) Fusobacterium nucleatum subsp. nucleatum ATCC 255... 34 0.78 21 (DX582489) MUGQ_CH252P051G11T7_AV1024_090 CHORI-252 Vervet M... 36 0.78 2 (EK208071) 1095460086199 Global-Ocean-Sampling_GS-31-01-01-1... 32 0.79 4 (AC146664) Medicago truncatula chromosome 6 clone mth2-10e20... 38 0.82 6 (BH964377) odj09d11.b1 B.oleracea002 Brassica oleracea genom... 46 0.83 2 (AC215790) MACACA MULATTA BAC clone CH250-101F19 from chromo... 48 0.84 1 (AB024036) Arabidopsis thaliana genomic DNA, chromosome 3, P... 48 0.84 1 (AM910995) Plasmodium knowlesi strain H chromosome 13, compl... 48 0.84 1
>(D82024) Dictyostelium discoideum topA gene for DNA topoisomerase II, complete cds. Length = 5789
Score = 1168 bits (589), Expect = 0.0 Identities = 589/589 (100%) Strand = Plus / Plus
Query: 1 agtaaaatcattgaacgtgttgcaggttgggcattaatgaaacaaaaagcagatttaatt 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 2440 agtaaaatcattgaacgtgttgcaggttgggcattaatgaaacaaaaagcagatttaatt 2499
Query: 61 cattcaacaagtggtagacaatcaaaaaccacattgattaaatcgatttccaaattggat 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 2500 cattcaacaagtggtagacaatcaaaaaccacattgattaaatcgatttccaaattggat 2559
Query: 121 gatgcaaattgggcaggtggattaaaatcaaaggaatgtacattgattataactgaaggt 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 2560 gatgcaaattgggcaggtggattaaaatcaaaggaatgtacattgattataactgaaggt 2619
Query: 181 gattctgcaaaatcattagcattggcaggtttaagtgtagttggtcgtaattcatatggt 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 2620 gattctgcaaaatcattagcattggcaggtttaagtgtagttggtcgtaattcatatggt 2679
Query: 241 gttttcccattacgtggtaagctattgaatgtacgtgatgtcgcttcaaaacaattatta 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 2680 gttttcccattacgtggtaagctattgaatgtacgtgatgtcgcttcaaaacaattatta 2739
Query: 301 tccaatgaagaaattaataatcttaccaccattttgggtttatctcataaaaattcctat 360 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 2740 tccaatgaagaaattaataatcttaccaccattttgggtttatctcataaaaattcctat 2799
Query: 361 gataccgatgaaagtatggaagatttacgttatggtagagttatgattatggccgatcaa 420 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 2800 gataccgatgaaagtatggaagatttacgttatggtagagttatgattatggccgatcaa 2859
Query: 421 gatcatgatggttcacatattaaaggtttagttatgaatttcattcactacttttggcca 480 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 2860 gatcatgatggttcacatattaaaggtttagttatgaatttcattcactacttttggcca 2919
Query: 481 aatcttttgaaacgtggtttccttgtagaatttgttacaccaatcataaaagcaactaaa 540 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 2920 aatcttttgaaacgtggtttccttgtagaatttgttacaccaatcataaaagcaactaaa 2979
Query: 541 agttcaactcaaaagaaatctttctttaccattaaagactatgaaaaat 589 ||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 2980 agttcaactcaaaagaaatctttctttaccattaaagactatgaaaaat 3028
Score = 408 bits (206), Expect(5) = 0.0 Identities = 210/212 (99%) Strand = Plus / Plus
Query: 621 aagatttaactgaaaatgagttaataaagctantcaagttatcagcttctcttaatttcc 680 |||||||||||||||||||||||||||||||| ||||||||||||||||||||||||||| Sbjct: 4121 aagatttaactgaaaatgagttaataaagctattcaagttatcagcttctcttaatttcc 4180
Query: 681 atttaacatgtttcgatgaaaattcaaaaattcaaaaattagaatctgttgaagaaatca 740 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 4181 atttaacatgtttcgatgaaaattcaaaaattcaaaaattagaatctgttgaagaaatca 4240
Query: 741 ttgatcaattctataaagttcgtttacaattctatggaaaacgtagagaatncctcttga 800 ||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||| Sbjct: 4241 ttgatcaattctataaagttcgtttacaattctatggaaaacgtagagaatacctcttga 4300
Query: 801 aatcattggataatcaaattaaacgtttaaca 832 |||||||||||||||||||||||||||||||| Sbjct: 4301 aatcattggataatcaaattaaacgtttaaca 4332
Score = 377 bits (190), Expect(5) = 0.0 Identities = 192/193 (99%) Strand = Plus / Plus
Query: 841 atacaattccttgaagttattgcaagtggtaaattaaaaattcaaggtagatcaaaacaa 900 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 4339 atacaattccttgaagttattgcaagtggtaaattaaaaattcaaggtagatcaaaacaa 4398
Query: 901 gatttaatcaaagagttggaaagtggtgaaattgttggtttcgaaaattttggaactcat 960 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 4399 gatttaatcaaagagttggaaagtggtgaaattgttggtttcgaaaattttggaactcat 4458
Query: 961 ccaccagaggtttatcaacatcttttctntttatcaattttagatattacaaaagaaaga 1020 |||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||| Sbjct: 4459 ccaccagaggtttatcaacatcttttctctttatcaattttagatattacaaaagaaaga 4518
Query: 1021 attgataatttaa 1033 ||||||||||||| Sbjct: 4519 attgataatttaa 4531
Score = 236 bits (119), Expect(5) = 0.0 Identities = 121/122 (99%) Strand = Plus / Plus
Query: 1036 taatcaattaacaaaaagaaaatntgaacatcaatcaatttcatcttctgatccaaaatc 1095 ||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||| Sbjct: 4533 taatcaattaacaaaaagaaaatctgaacatcaatcaatttcatcttctgatccaaaatc 4592
Query: 1096 actttggactgctgatttacaacaattaaaagaatatttagaaaaaagtgataaagaatt 1155 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 4593 actttggactgctgatttacaacaattaaaagaatatttagaaaaaagtgataaagaatt 4652
Query: 1156 tc 1157 || Sbjct: 4653 tc 4654
Score = 131 bits (66), Expect(5) = 0.0 Identities = 66/66 (100%) Strand = Plus / Plus
Query: 1175 aacttcctcttcttcatcatttgatgtttcttcttcttctgaatctgcaaaattatcttc 1234 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 4671 aacttcctcttcttcatcatttgatgtttcttcttcttctgaatctgcaaaattatcttc 4730
Query: 1235 aactag 1240 |||||| Sbjct: 4731 aactag 4736
Score = 32.2 bits (16), Expect(5) = 0.0 Identities = 16/16 (100%) Strand = Plus / Plus
Query: 1280 ctattttaatatttaa 1295 |||||||||||||||| Sbjct: 4776 ctattttaatatttaa 4791
Lambda K H 1.37 0.711 1.31
Matrix: blastn matrix:1 -3 Number of Sequences: 92845959 Number of Hits to DB: 1,601,615,524 Number of extensions: 105092105 Number of successful extensions: 10520206 Number of sequences better than 10.0: 258 Length of query: 1295 Length of database: 95,242,211,685 Length adjustment: 24 Effective length of query: 1271 Effective length of database: 97,308,875,965 Effective search space: 123679581351515 Effective search space used: 123679581351515 X1: 11 (21.8 bits) S2: 22 (44.1 bits)
|
protein update |
2009. 7. 3 |
Homology vs Protein |
Query= Contig-U12414-1 (Contig-U12414-1Q) /CSM_Contig/Contig-U12414-1Q.Seq.d (1295 letters)
Database: nrp_B 3,236,559 sequences; 1,051,180,864 total letters
Searching..................................................done
Score E Sequences producing significant alignments: (bits) Value
AF087160_1(AF087160|pid:none) Homo sapiens DNA topoisomerase II ... 230 1e-58 (Q64511) RecName: Full=DNA topoisomerase 2-beta; EC=5.9... 230 1e-58 A39242(S26730;A39242;S10710;S33970;S30191;S41641;S30190)DNA topo... 230 1e-58 BC156330_1(BC156330|pid:none) Synthetic construct Homo sapiens c... 230 1e-58 (Q64399) RecName: Full=DNA topoisomerase 2-beta; EC=5.9... 230 1e-58 (Q02880) RecName: Full=DNA topoisomerase 2-beta; EC=5.9... 230 1e-58 AK296510_1(AK296510|pid:none) Homo sapiens cDNA FLJ55300 partial... 229 1e-58 BC121350_1(BC121350|pid:none) Xenopus tropicalis hypothetical pr... 229 2e-58 CR857392_1(CR857392|pid:none) Pongo abelii mRNA; cDNA DKFZp469C0... 228 5e-58 BC044276_1(BC044276|pid:none) Xenopus laevis hypothetical protei... 227 6e-58 AY319766_1(AY319766|pid:none) Physarum polycephalum DNA-topoisom... 226 2e-57 (Q23670) RecName: Full=Probable DNA topoisomerase 2; EC... 224 4e-57 (P15348) RecName: Full=DNA topoisomerase 2; EC=5.99.1.3... 224 7e-57 BT010240_1(BT010240|pid:none) Drosophila melanogaster RE49802 fu... 224 7e-57 CR954213_11(CR954213|pid:none) Ostreococcus tauri strain OTTH059... 223 9e-57 CP001326_108(CP001326|pid:none) Micromonas sp. RCC299 chromosome... 222 2e-56 (O46374) RecName: Full=DNA topoisomerase 2-alpha; EC=5.... 221 3e-56 J04088_1(J04088|pid:none) Human DNA topoisomerase II (top2) mRNA... 221 3e-56 AJ011741_1(AJ011741|pid:none) Homo sapiens TOP2 alpha gene, exon... 221 3e-56 A40493(A40493;A41278)DNA topoisomerase (ATP-hydrolyzing) (EC 5.9... 221 3e-56 (O16140) RecName: Full=DNA topoisomerase 2; EC=5.99.1.3... 220 8e-56 BC086970_1(BC086970|pid:none) Danio rerio topoisomerase (DNA) II... 220 1e-55 AL591067_8(AL591067|pid:none) Mouse DNA sequence from clone RP23... 220 1e-55 Y16594_1(Y16594|pid:none) Cricetulus longicaudatus mRNA for DNA ... 218 3e-55 JN0598(JN0598;S32012) DNA topoisomerase (ATP-hydrolyzing) (EC 5.... 218 4e-55 (P41516) RecName: Full=DNA topoisomerase 2-alpha; EC=5.... 218 4e-55 AF285155_1(AF285155|pid:none) Gallus gallus topoisomerase II alp... 218 4e-55 (Q55BP5) RecName: Full=Probable DNA topoisomerase 2; EC... 217 6e-55 FN357492_10(FN357492|pid:none) Schistosoma mansoni genome sequen... 217 6e-55 AY169238_1(AY169238|pid:none) Nicotiana tabacum DNA topoisomeras... 215 2e-54 AB205137_1(AB205137|pid:none) Scutellaria baicalensis TopII mRNA... 214 4e-54 EU430630_1(EU430630|pid:none) Pleurotus tuber-regium topoisomera... 214 5e-54 AL590444_34(AL590444|pid:none) chromosome IV of strain GB-M1 of ... 214 5e-54 EU430639_1(EU430639|pid:none) Pleurotus flabellatus topoisomeras... 214 5e-54 AP004778_25(AP004778|pid:none) Oryza sativa Japonica Group genom... 213 9e-54 DQ679485_1(DQ679485|pid:none) Pleurotus ostreatus DNA topoisomer... 211 4e-53 EU430626_1(EU430626|pid:none) Pleurotus pulmonarius topoisomeras... 211 5e-53 (P30182) RecName: Full=DNA topoisomerase 2; EC=5.99.1.3... 210 8e-53 EU430634_1(EU430634|pid:none) Pleurotus salmoneostramineus topoi... 210 1e-52 EU430625_1(EU430625|pid:none) Pleurotus abalonus topoisomerase I... 209 1e-52 EU430629_1(EU430629|pid:none) Pleurotus eryngii var. ferulae top... 209 2e-52 EU430636_1(EU430636|pid:none) Pleurotus nebrodensis topoisomeras... 207 5e-52 AE017341_358(AE017341|pid:none) Cryptococcus neoformans var. neo... 205 3e-51 AE014187_314(AE014187|pid:none) Plasmodium falciparum 3D7 chromo... 205 3e-51 (P41001) RecName: Full=DNA topoisomerase 2; EC=5.99.1.3... 205 3e-51 AM910995_159(AM910995|pid:none) Plasmodium knowlesi strain H chr... 205 3e-51 AB113358_1(AB113358|pid:none) Coprinopsis cinerea topII mRNA for... 203 1e-50 EU430627_1(EU430627|pid:none) Sarcomyxa serotina topoisomerase I... 203 1e-50 EU430635_1(EU430635|pid:none) Pleurotus cornucopiae topoisomeras... 202 2e-50 EU430628_1(EU430628|pid:none) Pleurotus citrinopileatus topoisom... 198 3e-49 AY504965_1(AY504965|pid:none) Entamoeba histolytica topoisomeras... 196 2e-48 X04326_1(X04326|pid:none) Fission yeast TOP2 gene for DNA topois... 196 2e-48 AE016818_749(AE016818|pid:none) Ashbya gossypii (= Eremothecium ... 186 2e-45 (O93794) RecName: Full=DNA topoisomerase 2; EC=5.99.1.3... 185 4e-45 S44861(S44861)DNA topoisomerase II - Caenorhabditis elegans 184 8e-45 (P34534) RecName: Full=Putative DNA topoisomerase 2, mitochondri... 184 8e-45 FN392321_327(FN392321|pid:none) Pichia pastoris GS115 chromosome... 183 1e-44 CR382123_598(CR382123|pid:none) Kluyveromyces lactis strain NRRL... 182 2e-44 DQ887563_1(DQ887563|pid:none) Trypanosoma congolense topoisomera... 182 2e-44 AM502246_239(AM502246|pid:none) Leishmania infantum chromosome 28. 182 2e-44 AF458973_3(AF458973|pid:none) Saccharomyces cerevisiae strain YJ... 181 7e-44 AF458978_3(AF458978|pid:none) Saccharomyces cerevisiae strain YJ... 181 7e-44 AF458970_3(AF458970|pid:none) Saccharomyces cerevisiae strain YJ... 181 7e-44 AB049138_1(AB049138|pid:none) Kluyveromyces marxianus top2 gene ... 181 7e-44 AF458981_3(AF458981|pid:none) Saccharomyces cerevisiae strain YJ... 181 7e-44 AF458975_3(AF458975|pid:none) Saccharomyces cerevisiae strain YJ... 181 7e-44 AB110277_1(AB110277|pid:none) Arthroderma persicolor top2 gene f... 180 9e-44 AB110276_1(AB110276|pid:none) Arthroderma fulvum top2 gene for D... 180 9e-44 AB110284_1(AB110284|pid:none) Arthroderma benhamiae top2 gene fo... 180 9e-44 AB110273_1(AB110273|pid:none) Arthroderma obtusum top2 gene for ... 180 9e-44 AB110279_1(AB110279|pid:none) Trichophyton quinckeanum top2 gene... 180 9e-44 AB078352_1(AB078352|pid:none) Aspergillus niger TOP 2 gene for D... 180 9e-44 AB110285_1(AB110285|pid:none) Arthroderma benhamiae top2 gene fo... 180 9e-44 AB110275_1(AB110275|pid:none) Arthroderma gypseum top2 gene for ... 180 9e-44 AB096067_1(AB096067|pid:none) Microsporum canis top2 gene for DN... 180 9e-44 AB110274_1(AB110274|pid:none) Arthroderma incurvatum top2 gene f... 180 9e-44 CR382130_963(CR382130|pid:none) Yarrowia lipolytica strain CLIB1... 180 1e-43 AB110280_1(AB110280|pid:none) Arthroderma simii top2 gene for DN... 179 1e-43 AB110282_1(AB110282|pid:none) Trichophyton tonsurans top2 gene f... 179 2e-43 AB096065_1(AB096065|pid:none) Trichophyton interdigitale top2 ge... 179 2e-43 (Q9Y8G8) RecName: Full=DNA topoisomerase 2; EC=5.99.1.3... 178 3e-43 AB078349_1(AB078349|pid:none) Aspergillus candidus TOP 2 gene fo... 178 4e-43 AB078354_1(AB078354|pid:none) Penicillium citrinum TOP 2 gene fo... 177 6e-43 AP007174_298(AP007174|pid:none) Aspergillus oryzae RIB40 genomic... 177 6e-43 CU928175_641(CU928175|pid:none) Zygosaccharomyces rouxii strain ... 177 1e-42 PDBN(1BJT) MOL_ID: 1;MOL_ID: 1; MOLECULE: TOPOISOMERASE II; MOLE... 177 1e-42 M13814_1(M13814|pid:none) Saccharomyces cerevisiae topoisomerase... 177 1e-42 AB096064_1(AB096064|pid:none) Trichophyton rubrum top2 gene for ... 177 1e-42 AB014886_1(AB014886|pid:none) Emericella nidulans TOP2 gene for ... 175 4e-42 AB049142_1(AB049142|pid:none) Candida dubliniensis top2 gene for... 174 8e-42 AB049146_1(AB049146|pid:none) Clavispora lusitaniae top2 gene fo... 173 1e-41 DQ491002_781(DQ491002|pid:none) Paramecium bursaria Chlorella vi... 173 1e-41 DQ491003_706(DQ491003|pid:none) Paramecium bursaria Chlorella vi... 173 1e-41 AB049140_1(AB049140|pid:none) Candida tropicalis top2 gene for t... 172 2e-41 (Q5UQE6) RecName: Full=DNA topoisomerase 2; EC=5.99.1.3... 172 3e-41 AB049141_1(AB049141|pid:none) Candida tropicalis top2 gene for t... 171 4e-41 AB049143_1(AB049143|pid:none) Candida parapsilosis top2 gene for... 171 5e-41 AY278365_1(AY278365|pid:none) Giardia intestinalis topoisomerase... 171 7e-41 EF101928_551(EF101928|pid:none) Acanthocystis turfacea Chlorella... 169 2e-40 AB049144_1(AB049144|pid:none) Candida parapsilosis top2 gene for... 168 3e-40 AF546127_1(AF546127|pid:none) Fusarium tricinctum isolate 7 topo... 168 4e-40 CU633897_142(CU633897|pid:none) Podospora anserina genomic DNA c... 167 1e-39 AM167520_1(AM167520|pid:none) Malus x domestica transposon gene ... 167 1e-39 AF546128_1(AF546128|pid:none) Gibberella zeae isolate 9 topoisom... 164 5e-39 DQ491001_546(DQ491001|pid:none) Paramecium bursaria chlorella vi... 163 1e-38 AY751524_1(AY751524|pid:none) Chlorella virus Marburg 1 topoisom... 163 1e-38 DQ890022_549(DQ890022|pid:none) Paramecium bursaria Chlorella vi... 161 4e-38 AJ577091_1(AJ577091|pid:none) Leishmania panamensis partial top2... 150 7e-35 (P30190) RecName: Full=DNA topoisomerase 2; EC=5.99.1.3... 139 2e-31 AY083347_1(AY083347|pid:none) Bodo saltans kinetoplast and nucle... 135 3e-30 AY185495_1(AY185495|pid:none) Blastocrithidia culicis type II to... 133 1e-29 (P27570) RecName: Full=DNA topoisomerase 2; EC=5.99.1.3... 133 1e-29 AY004225_1(AY004225|pid:none) Leishmania infantum DNA Topoisomer... 132 4e-29 AM502233_123(AM502233|pid:none) Leishmania infantum chromosome 15. 132 4e-29 AF150876_1(AF150876|pid:none) Leishmania donovani DNA topoisomer... 132 4e-29 AB034765_1(AB034765|pid:none) Bangia atropurpurea TOP2 gene for ... 121 6e-26 AK033321_1(AK033321|pid:none) Mus musculus 15 days embryo male t... 120 8e-26 AB034764_1(AB034764|pid:none) Porphyra tenera TOP2 gene for type... 120 1e-25 AY188913_1(AY188913|pid:none) Fusarium lateritium topoisomerase ... 112 3e-23 EU214574_1(EU214574|pid:none) Fusarium chlamydosporum NBAIM:236 ... 110 8e-23 EU214572_1(EU214572|pid:none) Gibberella moniliformis NBAIM:110 ... 108 4e-22 EU214581_1(EU214581|pid:none) Fusarium proliferatum NBAIM:344 to... 108 6e-22 AB050101_1(AB050101|pid:none) Porphyra dentata TOP2 gene for typ... 108 6e-22 EU214580_1(EU214580|pid:none) Fusarium udum NBAIM:138 topoisomer... 107 7e-22 AF546133_1(AF546133|pid:none) Fusarium oxysporum f. sp. melonis ... 107 7e-22 AB048184_1(AB048184|pid:none) Porphyra tenera TOP2 gene for type... 107 9e-22 AB048182_1(AB048182|pid:none) Porphyra suborbiculata TOP2 gene f... 107 9e-22 AB050102_1(AB050102|pid:none) Porphyra haitanensis TOP2 gene for... 107 1e-21 AJ890364_448(AJ890364|pid:none) Emiliania huxleyi virus 86 isola... 107 1e-21 AF546131_1(AF546131|pid:none) Gibberella fujikuroi topoisomerase... 106 2e-21 AF285158_1(AF285158|pid:none) Homo sapiens topoisomerase II alph... 104 6e-21 AF285159_1(AF285159|pid:none) Homo sapiens topoisomerase II alph... 104 6e-21 AF285157_1(AF285157|pid:none) Homo sapiens topoisomerase II alph... 104 6e-21 AK041054_1(AK041054|pid:none) Mus musculus adult male aorta and ... 101 7e-20 (P0C9C2) RecName: Full=DNA topoisomerase 2; EC=5.99.1.3... 96 2e-18 (P34203) RecName: Full=DNA topoisomerase 2; EC=5.99.1.3... 95 5e-18 AM712239_112(AM712239|pid:none) African swine fever virus Benin ... 94 1e-17 (Q00942) RecName: Full=DNA topoisomerase 2; EC=5.99.1.3... 94 1e-17 (P0C9C0) RecName: Full=DNA topoisomerase 2; EC=5.99.1.3... 93 2e-17 AB034238_1(AB034238|pid:none) Microscilla marina gyrB gene for D... 90 2e-16 AE008691_10(AE008691|pid:none) Thermoanaerobacter tengcongensis ... 90 2e-16 AB034214_1(AB034214|pid:none) Cellulophaga lytica gyrB gene for ... 90 2e-16 AB047163_1(AB047163|pid:none) Marine CFB-group bacterium MBIC444... 90 2e-16 CP000924_10(CP000924|pid:none) Thermoanaerobacter pseudethanolic... 89 3e-16 CP001107_2208(CP001107|pid:none) Eubacterium rectale ATCC 33656,... 89 3e-16 AM398681_632(AM398681|pid:none) Flavobacterium psychrophilum JIP... 89 5e-16 AB034217_1(AB034217|pid:none) Cellulophaga lytica gyrB gene for ... 89 5e-16 AB034213_1(AB034213|pid:none) Cellulophaga lytica gyrB gene for ... 89 5e-16 AM494475_1419(AM494475|pid:none) Orientia tsutsugamushi Boryong ... 89 5e-16 AB034216_1(AB034216|pid:none) Cellulophaga lytica gyrB gene for ... 89 5e-16 AB506793_1(AB506793|pid:none) Candidatus Amoebophilus asiaticus ... 88 6e-16 (Q89B37) RecName: Full=DNA gyrase subunit B; EC=5.99.1.... 88 6e-16 AE007869_12(AE007869|pid:none) Agrobacterium tumefaciens str. C5... 88 8e-16 CP001349_5630(CP001349|pid:none) Methylobacterium nodulans ORS 2... 88 8e-16 AE008917_1822(AE008917|pid:none) Brucella melitensis 16M chromos... 87 1e-15 AE014291_123(AE014291|pid:none) Brucella suis 1330 chromosome I,... 87 1e-15 AB047160_1(AB047160|pid:none) Marine CFB-group bacterium MBIC444... 87 1e-15 CP000908_2541(CP000908|pid:none) Methylobacterium extorquens PA1... 87 1e-15 CP000872_122(CP000872|pid:none) Brucella canis ATCC 23365 chromo... 87 1e-15 AB047175_1(AB047175|pid:none) Marine CFB-group bacterium MBIC446... 87 1e-15 CP000911_123(CP000911|pid:none) Brucella suis ATCC 23445 chromos... 87 1e-15 AE015928_3428(AE015928|pid:none) Bacteroides thetaiotaomicron VP... 87 1e-15 CP000943_5063(CP000943|pid:none) Methylobacterium sp. 4-46, comp... 87 1e-15 CP001001_316(CP001001|pid:none) Methylobacterium radiotolerans J... 87 1e-15 CP001612_687(CP001612|pid:none) Rickettsia africae ESF-5, comple... 87 1e-15 AB047172_1(AB047172|pid:none) Marine CFB-group bacterium MBIC445... 87 1e-15 CP000394_684(CP000394|pid:none) Granulibacter bethesdensis CGDNI... 87 1e-15 (Q92H87) RecName: Full=DNA gyrase subunit B; EC=5.99.1.... 87 1e-15 CP000633_12(CP000633|pid:none) Agrobacterium vitis S4 chromosome... 87 1e-15 AB047182_1(AB047182|pid:none) Marine CFB-group bacterium MBIC447... 87 2e-15 CP001029_2474(CP001029|pid:none) Methylobacterium populi BJ001, ... 87 2e-15 AB047174_1(AB047174|pid:none) Marine CFB-group bacterium MBIC446... 87 2e-15 CP001104_1171(CP001104|pid:none) Eubacterium eligens ATCC 27750,... 86 2e-15 CP000766_921(CP000766|pid:none) Rickettsia rickettsii str. Iowa,... 86 2e-15 AB015031_1(AB015031|pid:none) Cytophaga fermentans gyrB gene for... 86 2e-15 CP000927_156(CP000927|pid:none) Caulobacter sp. K31, complete ge... 86 2e-15 CP000679_5(CP000679|pid:none) Caldicellulosiruptor saccharolytic... 86 2e-15 CP000721_6(CP000721|pid:none) Clostridium beijerinckii NCIMB 805... 86 2e-15 AM180355_5(AM180355|pid:none) Clostridium difficile 630 complete... 86 3e-15 BX897699_41(BX897699|pid:none) Bartonella henselae strain Housto... 86 3e-15 CU459003_1332(CU459003|pid:none) Magnetospirillum gryphiswaldens... 86 3e-15 AB047191_1(AB047191|pid:none) Marine CFB-group bacterium MBIC148... 86 3e-15 (Q9ZCX2) RecName: Full=DNA gyrase subunit B; EC=5.99.1.... 86 3e-15 CP000248_3296(CP000248|pid:none) Novosphingobium aromaticivorans... 86 3e-15 CU179680_740(CU179680|pid:none) Mycoplasma agalactiae PG2 chromo... 86 3e-15 CP000524_1254(CP000524|pid:none) Bartonella bacilliformis KC583,... 86 4e-15 CP000264_4(CP000264|pid:none) Jannaschia sp. CCS1, complete geno... 86 4e-15 AB047185_1(AB047185|pid:none) Marine CFB-group bacterium MBIC447... 86 4e-15 CP000758_138(CP000758|pid:none) Ochrobactrum anthropi ATCC 49188... 86 4e-15 AB047184_1(AB047184|pid:none) Marine CFB-group bacterium MBIC447... 86 4e-15 CP001189_2129(CP001189|pid:none) Gluconacetobacter diazotrophicu... 86 4e-15 CU207366_2712(CU207366|pid:none) Gramella forsetii KT0803 comple... 86 4e-15 AB017713_1(AB017713|pid:none) Bacteroides fragilis gyrB gene for... 86 4e-15 AB048185_1(AB048185|pid:none) Bacteroides fragilis gyrB gene for... 86 4e-15 AB047155_1(AB047155|pid:none) Marine CFB-group bacterium MBIC520... 86 4e-15 AB034224_1(AB034224|pid:none) Flavobacterium uglinosum gyrB gene... 85 5e-15 AL591688_12(AL591688|pid:none) Sinorhizobium meliloti 1021 compl... 85 5e-15 (Q1RHT8) RecName: Full=DNA gyrase subunit B; EC=5.99.1.... 85 5e-15 CP001503_3(CP001503|pid:none) Burkholderia glumae BGR1 chromosom... 85 5e-15 CP001393_6(CP001393|pid:none) Anaerocellum thermophilum DSM 6725... 85 5e-15 CP001349_3178(CP001349|pid:none) Methylobacterium nodulans ORS 2... 85 5e-15 CP000553_2081(CP000553|pid:none) Prochlorococcus marinus str. NA... 85 5e-15 AB047186_1(AB047186|pid:none) Marine CFB-group bacterium MBIC447... 85 5e-15 CP000685_2244(CP000685|pid:none) Flavobacterium johnsoniae UW101... 85 7e-15 AB506783_1(AB506783|pid:none) Cardinium endosymbiont of Oligonyc... 85 7e-15 CP000628_1847(CP000628|pid:none) Agrobacterium radiobacter K84 c... 85 7e-15 AB032578_1(AB032578|pid:none) Flexibacter flexilis gyrB gene for... 85 7e-15 BA000040_4355(BA000040|pid:none) Bradyrhizobium japonicum USDA 1... 85 7e-15 AB047179_1(AB047179|pid:none) Marine CFB-group bacterium MBIC447... 85 7e-15 CP001230_1509(CP001230|pid:none) Persephonella marina EX-H1, com... 85 7e-15 CP000777_8(CP000777|pid:none) Leptospira biflexa serovar Patoc s... 85 7e-15 AB034229_1(AB034229|pid:none) Tenacibaculum maritimum gyrB gene ... 85 7e-15 AB034228_1(AB034228|pid:none) Tenacibaculum maritimum gyrB gene ... 85 7e-15 CP001104_5(CP001104|pid:none) Eubacterium eligens ATCC 27750, co... 84 9e-15 AY996880_1(AY996880|pid:none) Burkholderia cenocepacia strain FC... 84 9e-15 AY996881_1(AY996881|pid:none) Burkholderia cenocepacia strain FC... 84 9e-15 (Q4UKX5) RecName: Full=DNA gyrase subunit B; EC=5.99.1.... 84 9e-15 CP000709_492(CP000709|pid:none) Brucella ovis ATCC 25840 chromos... 84 9e-15 AC3594(AC3594) DNA topoisomerase (ATP-hydrolysing) (EC 5.99.1.3)... 84 9e-15 CP000158_967(CP000158|pid:none) Hyphomonas neptunium ATCC 15444,... 84 9e-15 AB047165_1(AB047165|pid:none) Marine CFB-group bacterium MBIC445... 84 9e-15 AY996909_1(AY996909|pid:none) Burkholderia cenocepacia strain FC... 84 9e-15 AB032585_1(AB032585|pid:none) Tenacibaculum mesophilum gyrB gene... 84 9e-15 AB015029_1(AB015029|pid:none) Bacteroides vulgatus gyrB gene for... 84 9e-15 AY996878_1(AY996878|pid:none) Burkholderia cenocepacia strain FC... 84 9e-15 AY996884_1(AY996884|pid:none) Burkholderia cenocepacia strain LM... 84 9e-15 AB071141_1(AB071141|pid:none) Cellulophaga baltica gyrB gene for... 84 9e-15 AY996904_1(AY996904|pid:none) Burkholderia cenocepacia strain Cr... 84 9e-15 AY996879_1(AY996879|pid:none) Burkholderia cenocepacia strain FC... 84 9e-15 AM398681_514(AM398681|pid:none) Flavobacterium psychrophilum JIP... 84 9e-15 CP000409_385(CP000409|pid:none) Rickettsia canadensis str. McKie... 84 9e-15 AY996911_1(AY996911|pid:none) Burkholderia stabilis strain FCF40... 84 1e-14 EU240565_1(EU240565|pid:none) Burkholderia stabilis strain LMG 1... 84 1e-14 AE009442_5(AE009442|pid:none) Xylella fastidiosa Temecula1, comp... 84 1e-14 DQ124428_1(DQ124428|pid:none) Burkholderia stabilis strain LMG14... 84 1e-14 AL954747_3(AL954747|pid:none) Nitrosomonas europaea ATCC 19718, ... 84 1e-14 AB047189_1(AB047189|pid:none) Marine CFB-group bacterium MBIC148... 84 1e-14 AB047188_1(AB047188|pid:none) Marine CFB-group bacterium MBIC148... 84 1e-14 CP000509_2910(CP000509|pid:none) Nocardioides sp. JS614, complet... 84 1e-14 CP000697_29(CP000697|pid:none) Acidiphilium cryptum JF-5, comple... 84 1e-14 AY996890_1(AY996890|pid:none) Burkholderia cenocepacia strain FC... 84 1e-14 AY987933_1(AY987933|pid:none) Burkholderia pyrrocinia strain ATC... 84 1e-14 AB015028_1(AB015028|pid:none) Empedobacter brevis gyrB gene for ... 84 1e-14 EU240568_1(EU240568|pid:none) Burkholderia ambifaria strain LMG ... 84 1e-14 AY987927_1(AY987927|pid:none) Burkholderia anthina strain LMG 16... 84 1e-14 AB047162_1(AB047162|pid:none) Marine CFB-group bacterium MBIC444... 84 1e-14 CP000885_292(CP000885|pid:none) Clostridium phytofermentans ISDg... 84 1e-14 AE003849_5(AE003849|pid:none) Xylella fastidiosa 9a5c, complete ... 84 1e-14 EU240559_1(EU240559|pid:none) Burkholderia cenocepacia strain LM... 84 1e-14 AY996886_1(AY996886|pid:none) Burkholderia cenocepacia strain MV... 84 1e-14 AY996891_1(AY996891|pid:none) Burkholderia cenocepacia strain FC... 84 1e-14 AY996887_1(AY996887|pid:none) Burkholderia cenocepacia strain FC... 84 1e-14 CP000151_3(CP000151|pid:none) Burkholderia sp. 383 chromosome 1,... 84 1e-14 CP000958_3(CP000958|pid:none) Burkholderia cenocepacia MC0-3 chr... 84 1e-14 CP000494_8(CP000494|pid:none) Bradyrhizobium sp. BTAi1, complete... 84 1e-14 AB034219_1(AB034219|pid:none) Persicobacter diffluens gyrB gene ... 84 1e-14 AY996889_1(AY996889|pid:none) Burkholderia cenocepacia strain FC... 84 1e-14 CP000378_2538(CP000378|pid:none) Burkholderia cenocepacia AU 105... 84 1e-14 AY996866_1(AY996866|pid:none) Burkholderia cepacia strain FCF1 G... 84 1e-14 EU240570_1(EU240570|pid:none) Burkholderia anthina strain LMG 20... 84 1e-14 EU240561_1(EU240561|pid:none) Burkholderia cenocepacia strain LM... 84 1e-14 AB015036_1(AB015036|pid:none) Sphingobacterium spiritivorum gyrB... 84 1e-14 AY996864_1(AY996864|pid:none) Burkholderia cepacia strain Vr46 G... 84 1e-14 AY996901_1(AY996901|pid:none) Burkholderia cenocepacia strain LM... 84 1e-14 AY996867_1(AY996867|pid:none) Burkholderia cepacia strain LMG122... 84 1e-14 CP001101_15(CP001101|pid:none) Chlorobium phaeobacteroides BS1, ... 84 1e-14 AE009951_590(AE009951|pid:none) Fusobacterium nucleatum subsp. n... 84 1e-14 AY996894_1(AY996894|pid:none) Burkholderia cenocepacia strain FC... 84 1e-14 AY996895_1(AY996895|pid:none) Burkholderia cenocepacia strain FC... 84 1e-14 AM260525_39(AM260525|pid:none) Bartonella tribocorum CIP 105476 ... 84 1e-14 EU240566_1(EU240566|pid:none) Burkholderia stabilis strain LMG 1... 84 1e-14 EU240560_1(EU240560|pid:none) Burkholderia cenocepacia strain LM... 84 1e-14 AP006840_6(AP006840|pid:none) Symbiobacterium thermophilum IAM 1... 84 1e-14 AY996888_1(AY996888|pid:none) Burkholderia cenocepacia strain FC... 84 1e-14 AB034232_1(AB034232|pid:none) Tenacibaculum ovolyticum gyrB gene... 83 2e-14 AB047158_1(AB047158|pid:none) Marine CFB-group bacterium MBIC444... 83 2e-14 AY996897_1(AY996897|pid:none) Burkholderia cenocepacia strain FC... 83 2e-14 AB048186_1(AB048186|pid:none) Chitinophaga pinensis gyrB gene fo... 83 2e-14 CP001087_2(CP001087|pid:none) Desulfobacterium autotrophicum HRM... 83 2e-14 AB034230_1(AB034230|pid:none) Tenacibaculum ovolyticum gyrB gene... 83 2e-14 AB032581_1(AB032581|pid:none) Flexibacter filiformis gyrB gene f... 83 2e-14 CP000738_3184(CP000738|pid:none) Sinorhizobium medicae WSM419, c... 83 2e-14 AB047178_1(AB047178|pid:none) Marine CFB-group bacterium MBIC447... 83 2e-14 AB034212_1(AB034212|pid:none) Marine bacterium MBIC1357 gyrB gen... 83 2e-14 AB034234_1(AB034234|pid:none) Flectobacillus major gyrB gene for... 83 2e-14 CP000449_14(CP000449|pid:none) Maricaulis maris MCS10, complete ... 83 2e-14 AB032586_1(AB032586|pid:none) Tenacibaculum amylolyticum gyrB ge... 83 2e-14 CP001097_15(CP001097|pid:none) Chlorobium limicola DSM 245, comp... 83 2e-14 AF008210_11(AF008210|pid:none) Buchnera aphidicola genomic fragm... 83 2e-14 AB034225_1(AB034225|pid:none) Flavobacterium aquatile gyrB gene ... 83 2e-14 AB034233_1(AB034233|pid:none) Flexibacter litoralis gyrB gene fo... 83 2e-14 AB032584_1(AB032584|pid:none) Flexibacter canadensis gyrB gene f... 83 2e-14 CP000141_2615(CP000141|pid:none) Carboxydothermus hydrogenoforma... 83 2e-14 (P29435) RecName: Full=DNA gyrase subunit B; EC=5.99.1.... 83 2e-14 AE010300_4191(AE010300|pid:none) Leptospira interrogans serovar ... 83 2e-14 CP000463_5(CP000463|pid:none) Rhodopseudomonas palustris BisA53,... 83 2e-14 CP001196_525(CP001196|pid:none) Oligotropha carboxidovorans OM5 ... 83 2e-14 (P94604) RecName: Full=DNA gyrase subunit B; EC=5.99.1.... 83 2e-14 CP000492_29(CP000492|pid:none) Chlorobium phaeobacteroides DSM 2... 83 2e-14 AY231457_1(AY231457|pid:none) Mesoplasma syrphidae DNA gyrase su... 83 2e-14 CP001132_1654(CP001132|pid:none) Acidithiobacillus ferrooxidans ... 83 2e-14 CP000356_2951(CP000356|pid:none) Sphingopyxis alaskensis RB2256,... 83 2e-14 AB048188_1(AB048188|pid:none) Flavobacterium ferrugineum gyrB ge... 83 2e-14 T46555(T46555) DNA topoisomerase (ATP-hydrolyzing) (EC 5.99.1.3)... 83 2e-14 AY987923_1(AY987923|pid:none) Burkholderia dolosa strain LMG 189... 82 3e-14 EU240564_1(EU240564|pid:none) Burkholderia vietnamiensis strain ... 82 3e-14 AY996914_1(AY996914|pid:none) Burkholderia vietnamiensis strain ... 82 3e-14 CP000158_547(CP000158|pid:none) Hyphomonas neptunium ATCC 15444,... 82 3e-14 CP000825_1903(CP000825|pid:none) Prochlorococcus marinus str. MI... 82 3e-14 AY996898_1(AY996898|pid:none) Burkholderia cenocepacia strain FC... 82 3e-14 AY996913_1(AY996913|pid:none) Burkholderia vietnamiensis strain ... 82 3e-14 CP001096_4(CP001096|pid:none) Rhodopseudomonas palustris TIE-1, ... 82 3e-14 CP001191_3905(CP001191|pid:none) Rhizobium leguminosarum bv. tri... 82 3e-14 CP000096_10(CP000096|pid:none) Pelodictyon luteolum DSM 273, com... 82 3e-14 CP001184_496(CP001184|pid:none) Ureaplasma urealyticum serovar 1... 82 3e-14 CP000614_3(CP000614|pid:none) Burkholderia vietnamiensis G4 chro... 82 3e-14 BX572593_4(BX572593|pid:none) Rhodopseudomonas palustris CGA009 ... 82 3e-14 EU240563_1(EU240563|pid:none) Burkholderia vietnamiensis strain ... 82 3e-14 AB032577_1(AB032577|pid:none) Capnocytophaga ochracea gyrB gene ... 82 3e-14 CP000853_6(CP000853|pid:none) Alkaliphilus oremlandii OhILAs, co... 82 4e-14 CP000089_3(CP000089|pid:none) Dechloromonas aromatica RCB, compl... 82 4e-14 AP008229_4(AP008229|pid:none) Xanthomonas oryzae pv. oryzae MAFF... 82 4e-14 AF010496_49(AF010496|pid:none) Rhodobacter capsulatus strain SB1... 82 4e-14 CP000139_1195(CP000139|pid:none) Bacteroides vulgatus ATCC 8482,... 82 4e-14 CP000020_12(CP000020|pid:none) Vibrio fischeri ES114 chromosome ... 82 4e-14 DQ143923_1(DQ143923|pid:none) Psychrobacter submarinus strain KM... 82 4e-14 AB047166_1(AB047166|pid:none) Marine CFB-group bacterium MBIC445... 82 4e-14 CP001132_4(CP001132|pid:none) Acidithiobacillus ferrooxidans ATC... 82 4e-14 AE008923_4(AE008923|pid:none) Xanthomonas axonopodis pv. citri s... 82 4e-14 AY996900_1(AY996900|pid:none) Burkholderia cenocepacia strain FC... 82 4e-14 BA000012_3999(BA000012|pid:none) Mesorhizobium loti MAFF303099 D... 82 4e-14 CP001139_12(CP001139|pid:none) Vibrio fischeri MJ11 chromosome I... 82 4e-14 CP000319_4(CP000319|pid:none) Nitrobacter hamburgensis X14, comp... 82 4e-14 CP000908_3078(CP000908|pid:none) Methylobacterium extorquens PA1... 82 4e-14 CP000780_1627(CP000780|pid:none) Candidatus Methanoregula boonei... 82 4e-14 AY360319_1(AY360319|pid:none) Mesoplasma seiffertii DNA gyrase s... 82 4e-14 CP000016_16(CP000016|pid:none) Candidatus Blochmannia pennsylvan... 82 4e-14 AM039952_4(AM039952|pid:none) Xanthomonas campestris pv. vesicat... 82 4e-14 AE008922_4(AE008922|pid:none) Xanthomonas campestris pv. campest... 82 4e-14 CP000967_4(CP000967|pid:none) Xanthomonas oryzae pv. oryzae PXO9... 82 4e-14 DQ143921_1(DQ143921|pid:none) Psychrobacter faecalis strain Iso-... 82 6e-14 CP001099_14(CP001099|pid:none) Chlorobaculum parvum NCIB 8327, c... 82 6e-14 AB047164_1(AB047164|pid:none) Marine CFB-group bacterium MBIC444... 82 6e-14 AB071142_1(AB071142|pid:none) Cyclobacterium marinum gyrB gene f... 82 6e-14 BA000012_708(BA000012|pid:none) Mesorhizobium loti MAFF303099 DN... 82 6e-14 BA000040_823(BA000040|pid:none) Bradyrhizobium japonicum USDA 11... 82 6e-14 CP001020_4(CP001020|pid:none) Coxiella burnetii CbuK_Q154, compl... 82 6e-14 DQ228439_3(DQ228439|pid:none) Nitrosomonas sp. OZK11 DNA replica... 82 6e-14 CP000733_4(CP000733|pid:none) Coxiella burnetii Dugway 5J108-111... 82 6e-14 AE016828_5(AE016828|pid:none) Coxiella burnetii RSA 493, complet... 82 6e-14 AB015035_1(AB015035|pid:none) Pedobacter heparinus gyrB gene for... 82 6e-14 (Q9KVX3) RecName: Full=DNA gyrase subunit B; EC=5.99.1.... 82 6e-14 DQ228435_3(DQ228435|pid:none) Nitrosovibrio sp. FJI82 DNA replic... 82 6e-14 CP000115_4(CP000115|pid:none) Nitrobacter winogradskyi Nb-255, c... 82 6e-14 AB458223_1(AB458223|pid:none) Psychrobacter pulmonis gyrB gene f... 82 6e-14 CP000890_5(CP000890|pid:none) Coxiella burnetii RSA 331, complet... 82 6e-14 CP000555_3(CP000555|pid:none) Methylibium petroleiphilum PM1, co... 82 6e-14 CP000878_1762(CP000878|pid:none) Prochlorococcus marinus str. MI... 82 6e-14 CP001074_13(CP001074|pid:none) Rhizobium etli CIAT 652, complete... 81 7e-14 AL591688_1438(AL591688|pid:none) Sinorhizobium meliloti 1021 com... 81 7e-14 CP000672_1001(CP000672|pid:none) Haemophilus influenzae PittGG, ... 81 7e-14 (O87545) RecName: Full=DNA gyrase subunit B; EC=5.99.1.... 81 7e-14 DQ143915_1(DQ143915|pid:none) Psychrobacter proteolyticus strain... 81 7e-14 CP000246_6(CP000246|pid:none) Clostridium perfringens ATCC 13124... 81 7e-14 CP000774_3232(CP000774|pid:none) Parvibaculum lavamentivorans DS... 81 7e-14 DQ143918_1(DQ143918|pid:none) Psychrobacter jeotgali strain YKJ-... 81 7e-14 CP000477_1365(CP000477|pid:none) Methanosaeta thermophila PT, co... 81 7e-14 CP001185_887(CP001185|pid:none) Thermosipho africanus TCF52B, co... 81 7e-14 CP000283_4(CP000283|pid:none) Rhodopseudomonas palustris BisB5, ... 81 7e-14 AB201278_1(AB201278|pid:none) Listonella anguillarum gyrB gene ... 81 7e-14 DQ143928_1(DQ143928|pid:none) Psychrobacter arcticus DNA gyrase ... 81 7e-14 BA000016_6(BA000016|pid:none) Clostridium perfringens str. 13 DN... 81 7e-14 DQ143916_1(DQ143916|pid:none) Psychrobacter fozii strain LMG 212... 81 7e-14 CP000671_21(CP000671|pid:none) Haemophilus influenzae PittEE, co... 81 7e-14 CP000157_2346(CP000157|pid:none) Erythrobacter litoralis HTCC259... 81 7e-14 EU680781_1(EU680781|pid:none) Vibrio alginolyticus strain ATCC 1... 81 7e-14 AP009384_1009(AP009384|pid:none) Azorhizobium caulinodans ORS 57... 81 7e-14 DQ863261_1(DQ863261|pid:none) Spiroplasma alleghenense strain PL... 81 7e-14 CP000323_6(CP000323|pid:none) Psychrobacter cryohalolentis K5, c... 81 7e-14 AB506782_1(AB506782|pid:none) Cardinium endosymbiont of Eotetran... 81 7e-14 CP000082_4(CP000082|pid:none) Psychrobacter arcticus 273-4, comp... 81 7e-14 CP000312_6(CP000312|pid:none) Clostridium perfringens SM101, com... 81 7e-14 DQ143926_1(DQ143926|pid:none) Psychrobacter glacincola strain AC... 81 7e-14 CP000301_5(CP000301|pid:none) Rhodopseudomonas palustris BisB18,... 81 9e-14 CP001391_116(CP001391|pid:none) Wolbachia sp. wRi, complete geno... 81 9e-14 AJ938182_5(AJ938182|pid:none) Staphylococcus aureus RF122 comple... 81 9e-14 (Q9FAX2) RecName: Full=DNA gyrase subunit B; EC=5.99.1.... 81 9e-14 CP000738_1055(CP000738|pid:none) Sinorhizobium medicae WSM419, c... 81 9e-14 CP000830_745(CP000830|pid:none) Dinoroseobacter shibae DFL 12, c... 81 9e-14 EU680782_1(EU680782|pid:none) Vibrio campbellii strain ATCC 3386... 81 9e-14 AE017196_98(AE017196|pid:none) Wolbachia endosymbiont of Drosoph... 81 9e-14 CP001108_15(CP001108|pid:none) Prosthecochloris aestuarii DSM 27... 81 9e-14 AE016795_940(AE016795|pid:none) Vibrio vulnificus CMCP6 chromoso... 81 9e-14 AB047176_1(AB047176|pid:none) Marine CFB-group bacterium MBIC446... 81 9e-14 AM286690_4(AM286690|pid:none) Alcanivorax borkumensis SK2, compl... 81 9e-14 DQ143927_1(DQ143927|pid:none) Psychrobacter immobilis strain ATC... 81 9e-14 AB047192_1(AB047192|pid:none) Marine CFB-group bacterium MBIC448... 81 9e-14 AB047177_1(AB047177|pid:none) Marine CFB-group bacterium MBIC446... 81 9e-14 DQ514610_1(DQ514610|pid:none) Spiroplasma phoeniceum strain P198... 81 9e-14 EU672845_1(EU672845|pid:none) Vibrio harveyi strain ATCC 33842 D... 81 9e-14 AJ965256_4(AJ965256|pid:none) Dehalococcoides sp. CBDB1 complete... 81 9e-14 DQ514609_1(DQ514609|pid:none) Spiroplasma phoeniceum strain P40 ... 81 9e-14 CP000449_1324(CP000449|pid:none) Maricaulis maris MCS10, complet... 81 9e-14 AM902716_3(AM902716|pid:none) Bordetella petrii strain DSM 12804... 80 1e-13 EU014292_1(EU014292|pid:none) Spiroplasma sp. CRAYFISH DNA topoi... 80 1e-13 CP000108_29(CP000108|pid:none) Chlorobium chlorochromatii CaD3, ... 80 1e-13 BX571857_5(BX571857|pid:none) Staphylococcus aureus strain MSSA4... 80 1e-13 CP001279_3(CP001279|pid:none) Nautilia profundicola AmH, complet... 80 1e-13 CP000111_1879(CP000111|pid:none) Prochlorococcus marinus str. MI... 80 1e-13 CP001103_6(CP001103|pid:none) Alteromonas macleodii 'Deep ecotyp... 80 1e-13 CP001173_448(CP001173|pid:none) Helicobacter pylori G27, complet... 80 1e-13 CP001096_2711(CP001096|pid:none) Rhodopseudomonas palustris TIE-... 80 1e-13 CP000746_130(CP000746|pid:none) Actinobacillus succinogenes 130Z... 80 1e-13 AE017261_1414(AE017261|pid:none) Picrophilus torridus DSM 9790, ... 80 1e-13 AY345991_1(AY345991|pid:none) Entomoplasma melaleucae DNA gyrase... 80 1e-13 AB015025_1(AB015025|pid:none) Chryseobacterium indologenes gyrB ... 80 1e-13 (Q6GKU0) RecName: Full=DNA gyrase subunit B; EC=5.99.1.3; 80 1e-13 CP000113_259(CP000113|pid:none) Myxococcus xanthus DK 1622, comp... 80 1e-13 DQ094158_1(DQ094158|pid:none) Acholeplasma multilocale strain AT... 80 1e-13 (P0A0K7) RecName: Full=DNA gyrase subunit B; EC=5.99.1.... 80 1e-13 AE015927_29(AE015927|pid:none) Clostridium tetani E88, complete ... 80 1e-13 CP000703_5(CP000703|pid:none) Staphylococcus aureus subsp. aureu... 80 1e-13 CP001001_985(CP001001|pid:none) Methylobacterium radiotolerans J... 80 1e-13 CP000241_478(CP000241|pid:none) Helicobacter pylori HPAG1, compl... 80 1e-13 EU014291_1(EU014291|pid:none) Spiroplasma sp. CRAB DNA topoisome... 80 1e-13 BX572601_30(BX572601|pid:none) Rhodopseudomonas palustris CGA009... 80 1e-13 (Q5HJZ1) RecName: Full=DNA gyrase subunit B; EC=5.99.1.... 80 1e-13 CP001217_504(CP001217|pid:none) Helicobacter pylori P12, complet... 80 1e-13 AE016827_2249(AE016827|pid:none) Mannheimia succiniciproducens M... 80 1e-13 BX571856_5(BX571856|pid:none) Staphylococcus aureus subsp. aureu... 80 1e-13 DQ143920_1(DQ143920|pid:none) Psychrobacter okhotskensis strain ... 80 2e-13 AE015924_1455(AE015924|pid:none) Porphyromonas gingivalis W83, c... 80 2e-13 AY142800_1(AY142800|pid:none) Heliobacillus mobilis DNA gyrase s... 80 2e-13 CP000103_3(CP000103|pid:none) Nitrosospira multiformis ATCC 2519... 80 2e-13 DQ124425_1(DQ124425|pid:none) Burkholderia multivorans strain LM... 80 2e-13 (O67137) RecName: Full=DNA gyrase subunit B; EC=5.99.1.... 80 2e-13 CP001634_347(CP001634|pid:none) Kosmotoga olearia TBF 19.5.1, co... 80 2e-13 BX908798_1075(BX908798|pid:none) Parachlamydia-related symbiont ... 80 2e-13 AP009385_67(AP009385|pid:none) Burkholderia multivorans ATCC 176... 80 2e-13 AY996869_1(AY996869|pid:none) Burkholderia multivorans strain FC... 80 2e-13 CP000489_413(CP000489|pid:none) Paracoccus denitrificans PD1222 ... 80 2e-13 AB490498_1(AB490498|pid:none) Psychrobacter sp. JCM 15603 gyrB g... 80 2e-13 DQ124426_1(DQ124426|pid:none) Burkholderia multivorans strain LM... 80 2e-13 BA000021_16(BA000021|pid:none) Wigglesworthia glossinidia endosy... 80 2e-13 CP001189_4(CP001189|pid:none) Gluconacetobacter diazotrophicus P... 80 2e-13 CP000140_3456(CP000140|pid:none) Parabacteroides distasonis ATCC... 80 2e-13 AB197124_6(AB197124|pid:none) Burkholderia multivorans genes for... 80 2e-13 AY217008_1(AY217008|pid:none) Sphingomonas elodea strain ATCC 31... 80 2e-13 DQ372711_23(DQ372711|pid:none) Azoarcus communis strain MUL2G9 h... 80 2e-13 AY996875_1(AY996875|pid:none) Burkholderia multivorans strain FC... 80 2e-13 AP010904_3(AP010904|pid:none) Desulfovibrio magneticus RS-1 DNA,... 80 2e-13 AM889285_1774(AM889285|pid:none) Gluconacetobacter diazotrophicu... 80 2e-13 CU207366_1461(CU207366|pid:none) Gramella forsetii KT0803 comple... 80 2e-13 CP000448_5(CP000448|pid:none) Syntrophomonas wolfei subsp. wolfe... 80 2e-13 AM743169_5(AM743169|pid:none) Stenotrophomonas maltophilia K279a... 80 2e-13 CP000435_90(CP000435|pid:none) Synechococcus sp. CC9311, complet... 80 2e-13 BX248583_17(BX248583|pid:none) Blochmannia floridanus complete g... 80 2e-13 AP006628_496(AP006628|pid:none) Onion yellows phytoplasma OY-M D... 80 2e-13 AJ508044_1(AJ508044|pid:none) Haemophilus influenzae partial gyr... 80 2e-13 AC122169_15(AC122169|pid:none) Medicago truncatula clone mth2-9m... 80 2e-13 BX571965_73(BX571965|pid:none) Burkholderia pseudomallei strain ... 80 2e-13 CP000250_5(CP000250|pid:none) Rhodopseudomonas palustris HaA2, c... 80 2e-13 AB032582_1(AB032582|pid:none) Flexibacter sancti gyrB gene for D... 80 2e-13 CP000557_1624(CP000557|pid:none) Geobacillus thermodenitrificans... 80 2e-13 CP001052_3(CP001052|pid:none) Burkholderia phytofirmans PsJN chr... 80 2e-13 CP000133_2151(CP000133|pid:none) Rhizobium etli CFN 42, complete... 80 2e-13 AE017243_108(AE017243|pid:none) Mycoplasma hyopneumoniae J, comp... 80 2e-13 L35044_2(L35044|pid:none) Mycoplasma gallisepticum topoisomerase... 80 2e-13 AP006841_4533(AP006841|pid:none) Bacteroides fragilis YCH46 DNA,... 80 2e-13 CP001016_1198(CP001016|pid:none) Beijerinckia indica subsp. indi... 80 2e-13 AE017332_268(AE017332|pid:none) Mycoplasma hyopneumoniae 232, co... 80 2e-13 CP000301_2796(CP000301|pid:none) Rhodopseudomonas palustris BisB... 80 2e-13 CP000270_3(CP000270|pid:none) Burkholderia xenovorans LB400 chro... 80 2e-13 AE017126_1793(AE017126|pid:none) Prochlorococcus marinus subsp. ... 79 3e-13 CP000383_1390(CP000383|pid:none) Cytophaga hutchinsonii ATCC 334... 79 3e-13 DQ493642_1(DQ493642|pid:none) Spiroplasma mirum strain CT-48 DNA... 79 3e-13 EF613024_1(EF613024|pid:none) Uncultured bacterium clone YSK-G1 ... 79 3e-13 AY729883_1(AY729883|pid:none) Candidatus Regiella insecticola gy... 79 3e-13 AE006470_2233(AE006470|pid:none) Chlorobium tepidum TLS, complet... 79 3e-13 AB047167_1(AB047167|pid:none) Marine CFB-group bacterium MBIC445... 79 3e-13 AI2463(AI2463) DNA gyrase B chain [imported] - Nostoc sp. (strai... 79 3e-13 (P50028) RecName: Full=DNA gyrase subunit B; EC=5.99.1.... 79 3e-13 (Q9I7C2) RecName: Full=DNA gyrase subunit B; EC=5.99.1.... 79 3e-13 (Q9LCK1) RecName: Full=DNA gyrase subunit B; EC=5.99.1.... 79 3e-13 AE008692_1583(AE008692|pid:none) Zymomonas mobilis subsp. mobili... 79 3e-13 CP000644_4(CP000644|pid:none) Aeromonas salmonicida subsp. salmo... 79 3e-13 AB015026_1(AB015026|pid:none) Bergeyella zoohelcum gyrB gene for... 79 3e-13 AE017340_4(AE017340|pid:none) Idiomarina loihiensis L2TR, comple... 79 3e-13 AE017244_112(AE017244|pid:none) Mycoplasma hyopneumoniae 7448, c... 79 3e-13 CP001157_4(CP001157|pid:none) Azotobacter vinelandii DJ, complet... 79 4e-13 CP000352_3(CP000352|pid:none) Ralstonia metallidurans CH34, comp... 79 4e-13 CP001339_4(CP001339|pid:none) Thioalkalivibrio sp. HL-EbGR7, com... 79 4e-13 EF619606_1(EF619606|pid:none) Streptococcus dysgalactiae subsp. ... 79 4e-13 AE009949_772(AE009949|pid:none) Streptococcus pyogenes MGAS8232,... 79 4e-13 AB015024_1(AB015024|pid:none) Elizabethkingia meningoseptica gyr... 79 4e-13 AM295250_2458(AM295250|pid:none) Staphylococcus carnosus subsp. ... 79 4e-13 CP000230_4(CP000230|pid:none) Rhodospirillum rubrum ATCC 11170, ... 79 4e-13 CP000633_1631(CP000633|pid:none) Agrobacterium vitis S4 chromoso... 79 4e-13 CP000687_780(CP000687|pid:none) Actinobacillus pleuropneumoniae ... 79 4e-13 CP000302_4(CP000302|pid:none) Shewanella denitrificans OS217, co... 79 4e-13
>AF087160_1(AF087160|pid:none) Homo sapiens DNA topoisomerase II beta (TOP2B) gene, exons 35 and 36 and partial cds. Length = 1598
Score = 230 bits (586), Expect = 1e-58 Identities = 112/195 (57%), Positives = 148/195 (75%) Frame = +1
Query: 7 IIERVAGWALMKQKADLIHSTSGRQSKTTLIKSISKLDDANWAGGLKSKECTLIITEGDS 186 I+E + W K + L S K + IK I KLDDAN AGG S ECTLI+TEGDS Sbjct: 400 IVESILNWVKFKAQTQLNKKCSS--VKYSKIKGIPKLDDANDAGGKHSLECTLILTEGDS 457
Query: 187 AKSLALAGLSVVGRNSYGVFPLRGKLLNVRDVASKQLLSNEEINNLTTILGLSHKNSYDT 366 AKSLA++GL V+GR+ YGVFPLRGK+LNVR+ + KQ++ N EINN+ I+GL +K SYD Sbjct: 458 AKSLAVSGLGVIGRDRYGVFPLRGKILNVREASHKQIMENAEINNIIKIVGLQYKKSYDD 517
Query: 367 DESMEDLRYGRVMIMADQDHDGSHIKGLVMNFIHYFWPNLLKRGFLVEFVTPIIKATKSS 546 ES++ LRYG++MIM DQD DGSHIKGL++NFIH+ WP+LLK GFL EF+TPI+KA+K+ Sbjct: 518 AESLKTLRYGKIMIMTDQDQDGSHIKGLLINFIHHNWPSLLKHGFLEEFITPIVKASKNK 577
Query: 547 TQKKSFFTIKDYEKW 591 Q+ SF++I ++++W Sbjct: 578 -QELSFYSIPEFDEW 591
Score = 41.6 bits (96), Expect = 0.063 Identities = 23/76 (30%), Positives = 44/76 (57%), Gaps = 1/76 (1%) Frame = +2
Query: 641 LIKLXKLSASLNFH-LTCFDENSKIQKLESVEEIIDQFYKVRLQFYGKRREXLLKSLDNQ 817 L K+ KL +L + + FD ++K E+V++I+ +F+ +RL +YG R+E L+ L + Sbjct: 978 LHKVFKLQTTLTCNSMVLFDHMGCLKKYETVQDILKEFFDLRLSYYGLRKEWLVGMLGAE 1037
Query: 818 IKRLTDYRYNSLKLLQ 865 +L + L+ +Q Sbjct: 1038 STKLNNQARFILEKIQ 1053
Lambda K H 0.318 0.134 0.401
Gapped Lambda K H 0.267 0.0410 0.140
Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 3236559 Number of Hits to DB: 1,706,968,312 Number of extensions: 35121351 Number of successful extensions: 90348 Number of sequences better than 10.0: 2977 Number of HSP's gapped: 88326 Number of HSP's successfully gapped: 3071 Length of query: 431 Length of database: 1,051,180,864 Length adjustment: 131 Effective length of query: 300 Effective length of database: 627,191,635 Effective search space: 188157490500 Effective search space used: 188157490500 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 32 (16.9 bits)
|
PSORT |
|
VS (DIR, S) |
0 |
VH (FL, L) |
1 |
VF (FL, S) |
0 |
AH (FL, L) |
0 |
AF (FL, S) |
0 |
SL (DIR, L) |
0 |
SS (DIR, S) |
0 |
SH (FL, L) |
0 |
SF (FL, S) |
0 |
CH (FL, L) |
0 |
CF (FL, S) |
0 |
FCL (DIR, L) |
0 |
FC (DIR, S) |
0 |
FC-IC (SUB) |
0 |