| Contig-U12375-1 |
| Contig ID |
Contig-U12375-1 |
| Contig update |
2002.12.18 |
| Contig sequence |
 |
| Gap |
gap included |
| Contig length |
1421 |
| Chromosome number (1..6, M) |
5 |
| Chromosome length |
5062330 |
| Start point |
722931 |
| End point |
724335 |
| Strand (PLUS/MINUS) |
PLUS |
| Number of clones |
1 |
| Number of EST |
2 |
| Link to clone list |
U12375 |
| List of clone(s) |
|
| Translated Amino Acid sequence |
|
| Translated Amino Acid sequence (All Frames) |
|
| own update |
2004. 6.10 |
| Homology vs CSM-cDNA |
|
| dna update |
2008.11.30 |
| Homology vs DNA |
Query= Contig-U12375-1 (Contig-U12375-1Q) /CSM_Contig/Contig-U12375-1Q.Seq.d
(1431 letters)
Database: ddbj_A
92,845,959 sequences; 95,242,211,685 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value N
(BJ436603) Dictyostelium discoideum cDNA clone:ddv31m16, 3' ... 716 0.0 2
(BJ418106) Dictyostelium discoideum cDNA clone:ddv31m16, 5' ... 690 0.0 3
(CU469464) Candidatus Phytoplasma mali strain AT complete ch... 34 3e-04 19
(CP001078) Clostridium botulinum E3 str. Alaska E43, complet... 34 0.001 20
(CP000726) Clostridium botulinum A str. ATCC 19397, complete... 36 0.001 19
(AM412317) Clostridium botulinum A str. ATCC 3502 complete g... 36 0.002 20
(AE017308) Mycoplasma mobile 163K complete genome. 32 0.003 23
(CP000727) Clostridium botulinum A str. Hall, complete genome. 36 0.013 18
(CP001056) Clostridium botulinum B str. Eklund 17B, complete... 36 0.027 20
(BX293980) Mycoplasma mycoides subsp. mycoides SC str. PG1, ... 36 0.046 20
(EK083613) 1092961125048 Global-Ocean-Sampling_GS-31-01-01-1... 52 0.059 1
(EK039257) 1092959501960 Global-Ocean-Sampling_GS-31-01-01-1... 52 0.059 1
(AC116956) Dictyostelium discoideum chromosome 2 map 1418423... 38 0.17 12
(AC229685) Zea mays chromosome 10 clone CH201-8B23; ZMMBBc00... 50 0.23 1
(ER287527) 1092343580009 Global-Ocean-Sampling_GS-34-01-01-1... 50 0.23 1
(EJ985731) 1093023008346 Global-Ocean-Sampling_GS-30-02-01-1... 50 0.23 1
(CU264830) Equus caballus GSS, BAC clone CH241-415J16, T7 en... 50 0.23 1
(CU134261) Equus caballus GSS, BAC clone CH241-255F12, T7 en... 50 0.23 1
(CT940805) Equus caballus GSS, BAC clone CH241-21P7, SP6 end... 50 0.23 1
(BQ230187) AGENCOURT_7592705 NIH_MGC_72 Homo sapiens cDNA cl... 50 0.23 1
(FH481495) CHO_OF4358xc03f1.ab1 CHO_OF4 Nicotiana tabacum ge... 38 0.24 2
(X00929) Euglena gracilis chloroplast DNA for photosystem II... 36 0.57 5
(CR925811) Zebrafish DNA sequence *** SEQUENCING CANCELLED *... 34 0.60 6
(AE014845) Plasmodium falciparum 3D7 chromosome 12, section ... 32 0.65 14
(AC168618) Strongylocentrotus purpuratus clone R3-3046F23, W... 40 0.66 10
(AL929340) Zebrafish DNA sequence from clone CH211-248N16 in... 48 0.93 1
(AC091974) Homo sapiens chromosome 5 clone RP11-51P10, compl... 48 0.93 1
(CR385045) Zebrafish DNA sequence *** SEQUENCING IN PROGRESS... 48 0.93 1
(BX510952) Zebrafish DNA sequence *** SEQUENCING CANCELLED *... 48 0.93 1
(AC024317) Homo sapiens clone RP11-27I13, WORKING DRAFT SEQU... 48 0.93 1
(AC010278) Homo sapiens chromosome 5 clone CTC-527F11, WORKI... 48 0.93 1
(BH157181) ENTSB57TF Entamoeba histolytica Sheared DNA Entam... 48 0.93 1
(AZ548223) ENTGD43TR Entamoeba histolytica Sheared DNA Entam... 48 0.93 1
(EJ750135) 1092963028682 Global-Ocean-Sampling_GS-30-02-01-1... 48 0.93 1
(EJ270829) 1095353013374 Global-Ocean-Sampling_GS-27-01-01-1... 48 0.93 1
(DU082292) 271128 Tomato HindIII BAC Library Solanum lycoper... 48 0.93 1
(CT790928) Paramecium tetraurelia 5-PRIME EST from clone LK0... 48 0.93 1
(CT737849) Paramecium tetraurelia 5-PRIME EST from clone LK0... 48 0.93 1
(BJ532779) Oryzias latipes cDNA clone:MF01SSB014P03, 3' end ... 48 0.93 1
(BJ520194) Oryzias latipes cDNA clone:MF01SSB014P03, 5' end ... 48 0.93 1
(AL928797) Mouse DNA sequence from clone RP23-178B19 on chro... 42 1.0 7
(BX088565) Zebrafish DNA sequence *** SEQUENCING IN PROGRESS... 32 1.1 8
(BX119930) Zebrafish DNA sequence from clone DKEY-18G4 in li... 32 1.1 8
(CO120266) GR__Eb023K19.r GR__Eb Gossypium raimondii cDNA cl... 36 1.2 2
(CU138534) Zebrafish DNA sequence *** SEQUENCING IN PROGRESS... 36 1.4 8
(CR925740) Zebrafish DNA sequence from clone CH211-238G24 in... 38 1.5 7
(AE017245) Mycoplasma synoviae 53, complete genome. 34 1.6 17
(AL929351) Plasmodium falciparum strain 3D7, chromosome 5, s... 36 1.7 14
(DX539893) GH_MBb0021L11r GH_MBb Gossypium hirsutum genomic ... 40 1.7 2
(AM454427) Vitis vinifera, whole genome shotgun sequence, co... 34 1.8 7
(AP009642) Lotus japonicus genomic DNA, clone: LjB06P23, BM1... 38 2.0 5
(AM430844) Vitis vinifera contig VV78X248545.10, whole genom... 38 2.0 5
(BX957330) Zebrafish DNA sequence *** SEQUENCING CANCELLED *... 38 2.1 10
(AC116957) Dictyostelium discoideum chromosome 2 map 1685067... 30 2.2 17
(AC002433) Homo sapiens BAC clone CTA-317M2 from 7, complete... 44 2.2 6
(AE017263) Mesoplasma florum L1 complete genome. 34 2.4 20
(EJ050671) 1095454146403 Global-Ocean-Sampling_GS-26-01-01-1... 36 2.4 3
(AX508804) Sequence 3499 from Patent WO0216655. 44 2.6 2
(FH373026) CHO_OF4530xi10f1.ab1 CHO_OF4 Nicotiana tabacum ge... 36 2.7 3
(X00735) Euglena gracilis chloroplast psbA locus with 32-kd ... 36 2.8 4
(EU275726) Polysphondylium pallidum strain PN500 mitochondri... 36 3.1 6
(AC160841) Medicago truncatula chromosome 8 clone mth2-139l1... 34 3.2 7
(FH663145) CHO_OF5004xh04r1.ab1 CHO_OF5 Nicotiana tabacum ge... 36 3.2 3
(AP010114) Lotus japonicus genomic DNA, chromosome 3, clone:... 42 3.3 4
(AL929355) Plasmodium falciparum strain 3D7, chromosome 9; s... 36 3.3 10
(CU550683) Pig DNA sequence *** SEQUENCING IN PROGRESS *** f... 34 3.5 9
(AF063866) Melanoplus sanguinipes entomopoxvirus, complete g... 38 3.6 12
(DQ220699) Sauteria alpina small ribosomal protein 4 (rps4) ... 32 3.6 3
(BX569800) Zebrafish DNA sequence from clone DKEY-106C24 in ... 46 3.7 1
(AC175606) Cavia porcellus clone CH234-500H3, complete seque... 46 3.7 1
(AC171368) Cavia porcellus clone CH234-176E17, complete sequ... 46 3.7 1
(AC093815) Homo sapiens BAC clone RP11-362M19 from 4, comple... 46 3.7 1
(AC019170) Homo sapiens BAC clone RP11-162G9 from 4, complet... 46 3.7 1
(AC007786) Homo sapiens chromosome 19, BAC 41855 (CIT-B-32o4... 46 3.7 1
(AC218460) Bos taurus clone CH240-314P13, WORKING DRAFT SEQU... 46 3.7 1
(AC178889) Strongylocentrotus purpuratus clone R3-1112H10, W... 46 3.7 1
(AC176981) Strongylocentrotus purpuratus clone R3-36F20, WOR... 46 3.7 1
(AC169050) Bos taurus clone CH240-225D11, WORKING DRAFT SEQU... 46 3.7 1
(CR698199) Tetraodon nigroviridis full-length cDNA. 46 3.7 1
(CR633961) Tetraodon nigroviridis full-length cDNA. 46 3.7 1
(BH137032) ENTOA72TF Entamoeba histolytica Sheared DNA Entam... 46 3.7 1
(AZ668648) ENTIH15TF Entamoeba histolytica Sheared DNA Entam... 46 3.7 1
(AZ547554) ENTCX91TR Entamoeba histolytica Sheared DNA Entam... 46 3.7 1
(AZ530136) ENTBH60TR Entamoeba histolytica Sheared DNA Entam... 46 3.7 1
(FI168073) MUGQ_CH252P074M21Sp6_CH0282_054 CHORI-252 Vervet ... 46 3.7 1
(FI026083) CHO_OF6936xl09r1.ab1 CHO_OF6 Nicotiana tabacum ge... 46 3.7 1
(ER626355) 1093018204773 Global-Ocean-Sampling_GS-36-01-01-2... 46 3.7 1
(ED971783) OA_CBa0190N12.f OA_CBa Oryza australiensis genomi... 46 3.7 1
(ED945811) OA_CBa0127E17.f OA_CBa Oryza australiensis genomi... 46 3.7 1
(DC198007) Plasmodium berghei cDNA clone:LV006612, liver sta... 46 3.7 1
(FE113784) LV_HC_RA059F11f Litopenaeus vannamei hemocyte cDN... 46 3.7 1
(FD467108) EST00437 Daphnia magna cDNA library Daphnia magna... 46 3.7 1
(EJ046267) 1095454119110 Global-Ocean-Sampling_GS-26-01-01-1... 44 3.9 2
(AC120219) Rattus norvegicus clone CH230-7G23, WORKING DRAFT... 36 3.9 8
(CP000361) Arcobacter butzleri RM4018, complete genome. 36 3.9 20
(AE009951) Fusobacterium nucleatum subsp. nucleatum ATCC 255... 36 3.9 20
(AL034560) Plasmodium falciparum MAL3P8. 40 3.9 7
(AC116979) Dictyostelium discoideum chromosome 2 map 6445720... 32 4.2 17
(AC213826) Medicago truncatula chromosome 2 clone mth2-96h16... 40 4.2 5
(AC117176) Dictyostelium discoideum chromosome 2 map 5018074... 34 4.3 11
>(BJ436603) Dictyostelium discoideum cDNA clone:ddv31m16, 3' end,
single read.
Length = 758
Score = 716 bits (361), Expect(2) = 0.0
Identities = 361/361 (100%)
Strand = Plus / Minus
Query: 1071 ctacaattgatgaaaaacatttcctcaagattggtatgggtgcattaaaatattatgatt 1130
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 362 ctacaattgatgaaaaacatttcctcaagattggtatgggtgcattaaaatattatgatt 303
Query: 1131 tagcacacagaaacaatccatatgttttttcttatgatagtattttatcatttaaaggta 1190
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 302 tagcacacagaaacaatccatatgttttttcttatgatagtattttatcatttaaaggta 243
Query: 1191 atacaagtatttatattttatattgttatactcgtatttcaactttattaagaagagcta 1250
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 242 atacaagtatttatattttatattgttatactcgtatttcaactttattaagaagagcta 183
Query: 1251 attttgatggtttaaatttaaatccaaatttgattgaatttaaagaatttacagaaaaag 1310
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 182 attttgatggtttaaatttaaatccaaatttgattgaatttaaagaatttacagaaaaag 123
Query: 1311 aaagaaatttagtatttattatgtctagatttagtgatgtaatgaaaggtacagaacaat 1370
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 122 aaagaaatttagtatttattatgtctagatttagtgatgtaatgaaaggtacagaacaat 63
Query: 1371 cattaaaaccggatttatttggattacctttgggatctcgcaaatagtttccatcaattt 1430
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 62 cattaaaaccggatttatttggattacctttgggatctcgcaaatagtttccatcaattt 3
Query: 1431 t 1431
|
Sbjct: 2 t 2
Score = 636 bits (321), Expect(2) = 0.0
Identities = 321/321 (100%)
Strand = Plus / Minus
Query: 679 gatatcgccgcaattaaaccatcgtgttgaaaatggtaaagaatgggtcattgtcatcac 738
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 754 gatatcgccgcaattaaaccatcgtgttgaaaatggtaaagaatgggtcattgtcatcac 695
Query: 739 tgatgattcacaaagtgatcatttccaacaagtgtttaaaattgctgaagatgcaaattg 798
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 694 tgatgattcacaaagtgatcatttccaacaagtgtttaaaattgctgaagatgcaaattg 635
Query: 799 gttaaatcgtaagcaaactcgtgttgatcatttatcatttggtgttgttcgtggtcccaa 858
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 634 gttaaatcgtaagcaaactcgtgttgatcatttatcatttggtgttgttcgtggtcccaa 575
Query: 859 tggtcaaaaattatcatctcgtgatggtaatccaattgctttaatcgatctattacaaga 918
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 574 tggtcaaaaattatcatctcgtgatggtaatccaattgctttaatcgatctattacaaga 515
Query: 919 atcaattgaacgttcaaaacaagctacatcactttcaaaatcttttacacgttctgaaaa 978
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 514 atcaattgaacgttcaaaacaagctacatcactttcaaaatcttttacacgttctgaaaa 455
Query: 979 attagatattactcaaaatgc 999
|||||||||||||||||||||
Sbjct: 454 attagatattactcaaaatgc 434
Lambda K H
1.37 0.711 1.31
Matrix: blastn matrix:1 -3
Number of Sequences: 92845959
Number of Hits to DB: 1,650,195,698
Number of extensions: 110243896
Number of successful extensions: 10234812
Number of sequences better than 10.0: 152
Length of query: 1431
Length of database: 95,242,211,685
Length adjustment: 24
Effective length of query: 1407
Effective length of database: 97,308,875,965
Effective search space: 136913588482755
Effective search space used: 136913588482755
X1: 11 (21.8 bits)
S2: 22 (44.1 bits)
|
| protein update |
2009. 7. 2 |
| Homology vs Protein |
Query= Contig-U12375-1 (Contig-U12375-1Q) /CSM_Contig/Contig-U12375-1Q.Seq.d
(1431 letters)
Database: nrp_B
3,236,559 sequences; 1,051,180,864 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
(Q8DKN4) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 118 6e-25
AJ269505_2(AJ269505|pid:none) Anabaena sp. ORF4 (partial), ORF3,... 117 8e-25
CP000806_3572(CP000806|pid:none) Cyanothece sp. ATCC 51142 circu... 114 9e-24
CP000100_1575(CP000100|pid:none) Synechococcus elongatus PCC 794... 112 3e-23
CR926065_1(CR926065|pid:none) Pongo abelii mRNA; cDNA DKFZp459D2... 107 8e-22
AK302161_1(AK302161|pid:none) Homo sapiens cDNA FLJ50285 complet... 107 8e-22
CP000552_217(CP000552|pid:none) Prochlorococcus marinus str. MIT... 107 1e-21
(Q5RA20) RecName: Full=Arginyl-tRNA synthetase, cytoplasmic; ... 106 2e-21
(B7JVP5) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 105 3e-21
BT045912_1(BT045912|pid:none) Salmo salar clone ssal-rgf-536-207... 105 3e-21
CP001614_2591(CP001614|pid:none) Teredinibacter turnerae T7901, ... 105 3e-21
(Q7VE03) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 105 4e-21
AK314795_1(AK314795|pid:none) Homo sapiens cDNA, FLJ95667, highl... 105 4e-21
BC161929_1(BC161929|pid:none) Rattus norvegicus arginyl-tRNA syn... 105 4e-21
AK222797_1(AK222797|pid:none) Homo sapiens mRNA for arginyl-tRNA... 105 4e-21
CP000951_588(CP000951|pid:none) Synechococcus sp. PCC 7002, comp... 104 5e-21
(Q6MEP4) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 104 9e-21
BC134468_1(BC134468|pid:none) Bos taurus arginyl-tRNA synthetase... 104 9e-21
AB170531_1(AB170531|pid:none) Macaca fascicularis brain cDNA clo... 103 1e-20
(B7KCT7) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 103 1e-20
AB171071_1(AB171071|pid:none) Macaca fascicularis brain cDNA clo... 103 1e-20
(Q7U3V8) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 103 2e-20
BC083505_1(BC083505|pid:none) Danio rerio arginyl-tRNA synthetas... 103 2e-20
(Q31CZ4) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 103 2e-20
FN357329_61(FN357329|pid:none) Schistosoma mansoni genome sequen... 101 2e-20
AK011383_1(AK011383|pid:none) Mus musculus 10 days embryo whole ... 102 3e-20
AK152108_1(AK152108|pid:none) Mus musculus bone marrow macrophag... 102 3e-20
BC097633_1(BC097633|pid:none) Xenopus laevis hypothetical protei... 102 3e-20
(P37880) RecName: Full=Arginyl-tRNA synthetase, cytoplasmic; ... 102 3e-20
(Q46HI6) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 102 3e-20
CP000825_206(CP000825|pid:none) Prochlorococcus marinus str. MIT... 102 3e-20
CP000551_206(CP000551|pid:none) Prochlorococcus marinus str. AS9... 102 5e-20
AK168194_1(AK168194|pid:none) Mus musculus TIB-55 BB88 cDNA, RIK... 102 5e-20
(Q0VMA8) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 102 5e-20
AB171354_1(AB171354|pid:none) Macaca fascicularis brain cDNA clo... 101 8e-20
CP000079_136(CP000079|pid:none) Leishmania major strain Friedlin... 100 1e-19
(Q15W53) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 100 1e-19
(Q10XL4) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 100 1e-19
AM778958_121(AM778958|pid:none) Microcystis aeruginosa PCC 7806 ... 100 2e-19
CR940353_353(CR940353|pid:none) Theileria annulata strain Ankara... 100 2e-19
CP001037_3582(CP001037|pid:none) Nostoc punctiforme PCC 73102, c... 100 2e-19
AP009179_2208(AP009179|pid:none) Sulfurovum sp. NBC37-1 genomic ... 100 2e-19
AX366207_1(AX366207|pid:none) Sequence 1 from Patent WO0200696. ... 100 2e-19
AK228310_1(AK228310|pid:none) Arabidopsis thaliana mRNA for argi... 100 2e-19
AL049171_11(AL049171|pid:none) Arabidopsis thaliana DNA chromoso... 100 2e-19
(Q5ZM11) RecName: Full=Arginyl-tRNA synthetase, cytoplasmic; ... 99 3e-19
CP000576_208(CP000576|pid:none) Prochlorococcus marinus str. MIT... 99 3e-19
AE014188_179(AE014188|pid:none) Plasmodium falciparum 3D7 chromo... 99 4e-19
(B8CI29) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 99 5e-19
(Q8YQU9) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 99 5e-19
AP008207_346(AP008207|pid:none) Oryza sativa (japonica cultivar-... 98 8e-19
AP002539_12(AP002539|pid:none) Oryza sativa Japonica Group genom... 98 8e-19
CP001103_2762(CP001103|pid:none) Alteromonas macleodii 'Deep eco... 97 1e-18
(A1S2P7) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 97 1e-18
CP000644_179(CP000644|pid:none) Aeromonas salmonicida subsp. sal... 97 2e-18
CP000934_2349(CP000934|pid:none) Cellvibrio japonicus Ueda107, c... 97 2e-18
U12964_14(U12964|pid:none) Caenorhabditis elegans cosmid F26F4, ... 97 2e-18
(Q19825) RecName: Full=Probable arginyl-tRNA synthetase, cytopla... 97 2e-18
(A5GP97) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 97 2e-18
T16176(T16176)hypothetical protein F26F4.10 - Caenorhabditis ele... 97 2e-18
(A4Y2U9) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 96 4e-18
CP001091_39(CP001091|pid:none) Actinobacillus pleuropneumoniae s... 96 4e-18
(A1RP36) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 96 4e-18
BT038399_1(BT038399|pid:none) Zea mays full-length cDNA clone ZM... 95 6e-18
(A0L1H3) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 95 6e-18
CP000878_206(CP000878|pid:none) Prochlorococcus marinus str. MIT... 95 6e-18
AM950325_1(AM950325|pid:none) Canavalia ensiformis mRNA for argi... 94 9e-18
(A3D9A3) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 94 9e-18
AC146940_28(AC146940|pid:none) Medicago truncatula clone mth2-13... 94 1e-17
AC138017_2(AC138017|pid:none) Medicago truncatula clone mth2-6i3... 94 1e-17
(Q7V493) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 93 2e-17
CP000961_4378(CP000961|pid:none) Shewanella woodyi ATCC 51908, c... 93 2e-17
(A2CDB7) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 93 2e-17
A96691(A96691) arginyl-tRNA synthetase [imported] - Arabidopsis ... 93 2e-17
Z98759_1(Z98759|pid:none) Arabidopsis thaliana gene encoding arg... 93 2e-17
(A6WIK3) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 93 3e-17
(Q12IU3) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 93 3e-17
(Q7NWM1) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 92 5e-17
(Q9Z7Y3) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 92 6e-17
(Q0I3B0) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 92 6e-17
(Q07WM5) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 92 6e-17
(P59483) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 92 6e-17
CP000667_146(CP000667|pid:none) Salinispora tropica CNB-440, com... 92 6e-17
(A6VNB3) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 91 8e-17
(A8FQM2) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 91 8e-17
(Q5UQ59) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 91 1e-16
(Q21I40) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 91 1e-16
CP001277_600(CP001277|pid:none) Candidatus Hamiltonella defensa ... 91 1e-16
(Q824H4) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 91 1e-16
(A3Q9V2) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 91 1e-16
CP000850_152(CP000850|pid:none) Salinispora arenicola CNS-205, c... 91 1e-16
AM181176_391(AM181176|pid:none) Pseudomonas fluorescens SBW25 co... 91 1e-16
AY140910_5(AY140910|pid:none) Candidatus Fritschea bemisiae stra... 90 2e-16
(A1SQW6) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 90 2e-16
CP001157_4382(CP001157|pid:none) Azotobacter vinelandii DJ, comp... 90 2e-16
(Q0AMI8) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 90 2e-16
(Q4ZZF5) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 89 3e-16
(Q48PI2) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 89 4e-16
(Q1IGB8) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 89 4e-16
(Q7VP38) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 89 4e-16
AM746676_7673(AM746676|pid:none) Sorangium cellulosum 'So ce 56'... 89 5e-16
CP000462_3954(CP000462|pid:none) Aeromonas hydrophila subsp. hyd... 89 5e-16
(A5GW85) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 88 7e-16
(Q5E6L2) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 87 1e-15
(B1J2I3) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 87 1e-15
(Q87V03) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 87 1e-15
CP001032_2556(CP001032|pid:none) Opitutus terrae PB90-1, complet... 87 1e-15
(Q88CU1) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 87 1e-15
(B0KN43) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 87 1e-15
(A5WAC2) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 87 1e-15
AY810979_1(AY810979|pid:none) Schistosoma japonicum SJCHGC06108 ... 86 2e-15
CP000627_1626(CP000627|pid:none) Vibrio cholerae O395 chromosome... 87 2e-15
(Q9JYM8) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 87 2e-15
AE003852_2042(AE003852|pid:none) Vibrio cholerae O1 biovar eltor... 87 2e-15
CP001050_832(CP001050|pid:none) Neisseria gonorrhoeae NCCP11945,... 86 3e-15
(A8GFK2) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 86 3e-15
(A4WBN1) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 85 6e-15
(A4XPN9) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 85 6e-15
(Q6LTA1) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 85 6e-15
(Q4KJK0) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 85 7e-15
(Q9PJT8) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 85 7e-15
(Q8DFR1) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 84 1e-14
(Q7MMM3) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 84 1e-14
(A7MT26) Arginyl-tRNA synthetase (EC 6.1.1.19) (Arginine--tRNA l... 84 1e-14
(Q02EW6) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 84 1e-14
(Q9HUC8) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 84 1e-14
(A6VDH2) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 84 1e-14
(Q32H69) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 84 1e-14
(Q44683) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 84 2e-14
(A8AFG5) Arginyl-tRNA synthetase (EC 6.1.1.19) (Arginine--tRNA l... 83 2e-14
(B6EI57) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 83 2e-14
(B7NBM7) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 83 3e-14
(A1AC37) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 83 3e-14
(B1XHE4) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 83 3e-14
(Q87RD6) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 83 3e-14
(A1KUU4) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 82 4e-14
(Q3KLP4) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 82 5e-14
FM872308_465(FM872308|pid:none) Chlamydia trachomatis JALI20 ser... 82 5e-14
AE005174_2632(AE005174|pid:none) Escherichia coli O157:H7 EDL933... 82 6e-14
(A9MUA9) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 82 6e-14
(A8A178) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 82 6e-14
(Q5PMZ2) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 82 6e-14
CP001144_1220(CP001144|pid:none) Salmonella enterica subsp. ente... 82 6e-14
AM933173_1114(AM933173|pid:none) Salmonella enterica subsp. ente... 82 6e-14
CP001138_1133(CP001138|pid:none) Salmonella enterica subsp. ente... 81 8e-14
(Q57N89) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 81 8e-14
CP001113_1947(CP001113|pid:none) Salmonella enterica subsp. ente... 81 8e-14
(Q5QV46) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 81 8e-14
(Q322J5) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 81 1e-13
(Q83KQ3) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 81 1e-13
(B1J0L2) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 81 1e-13
(Q3Z2Q4) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 81 1e-13
(B7M2G7) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 81 1e-13
CU928162_2099(CU928162|pid:none) Escherichia coli ED1a chromosom... 81 1e-13
CP000975_1441(CP000975|pid:none) Methylacidiphilum infernorum V4... 80 1e-13
CP001616_471(CP001616|pid:none) Tolumonas auensis DSM 9187, comp... 80 1e-13
(B7LPH0) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 80 2e-13
(Q1CJH7) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 80 2e-13
(A4TJL3) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 80 2e-13
CP000454_3128(CP000454|pid:none) Arthrobacter sp. FB24, complete... 80 2e-13
AM942759_1088(AM942759|pid:none) Proteus mirabilis strain HI4320... 79 4e-13
(Q66AV1) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 79 5e-13
(Q2SMY0) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 79 5e-13
CP001048_2052(CP001048|pid:none) Yersinia pseudotuberculosis PB1... 79 5e-13
EF552206_10(EF552206|pid:none) Micromonospora chersina strain M9... 79 5e-13
(A1JRM9) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 78 7e-13
(Q2NTK2) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 78 7e-13
CP000582_260(CP000582|pid:none) Ostreococcus lucimarinus CCE9901... 76 3e-12
CU468135_1475(CU468135|pid:none) Erwinia tasmaniensis strain ET1... 76 3e-12
BT034275_1(BT034275|pid:none) Zea mays full-length cDNA clone ZM... 75 5e-12
(A7MEC0) Arginyl-tRNA synthetase (EC 6.1.1.19) (Arginine--tRNA l... 75 5e-12
FP236842_1550(FP236842|pid:none) Erwinia pyrifoliae strain Ep1/9... 75 5e-12
(Q0BYP8) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 75 8e-12
(Q8DRW2) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 74 1e-11
CP000725_1984(CP000725|pid:none) Streptococcus gordonii str. Cha... 74 2e-11
(Q47TB0) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 72 4e-11
(Q7VQX7) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 72 7e-11
CP000246_1873(CP000246|pid:none) Clostridium perfringens ATCC 13... 70 1e-10
(Q03MY7) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 70 1e-10
AM236080_1068(AM236080|pid:none) Rhizobium leguminosarum bv. vic... 70 2e-10
CP000387_2154(CP000387|pid:none) Streptococcus sanguinis SK36, c... 70 2e-10
(Q8XJU2) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 70 2e-10
(B2IMZ8) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 70 2e-10
(B1I9E7) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 69 3e-10
(Q04I94) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 69 3e-10
CP001104_493(CP001104|pid:none) Eubacterium eligens ATCC 27750, ... 69 3e-10
(Q54869) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 69 3e-10
(Q3JYM1) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 69 6e-10
(Q8E2R1) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 69 6e-10
(Q9CE12) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 68 9e-10
(A4VYA3) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 68 9e-10
(A2RNI8) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 67 1e-09
CU207366_2761(CU207366|pid:none) Gramella forsetii KT0803 comple... 67 1e-09
(Q8A3X5) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 67 1e-09
(A0Q5D7) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 66 4e-09
(Q6A5X8) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 66 4e-09
CP001337_2522(CP001337|pid:none) Chloroflexus aggregans DSM 9485... 65 5e-09
(Q04B18) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 65 5e-09
(Q1GAN1) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 65 6e-09
(Q8U149) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 65 8e-09
(Q1JEG8) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 64 1e-08
AP010656_2(AP010656|pid:none) Candidatus Azobacteroides pseudotr... 64 1e-08
(A5N8F9) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 64 1e-08
CP001034_1235(CP001034|pid:none) Natranaerobius thermophilus JW/... 64 1e-08
(Q1J486) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 64 1e-08
(Q8K5J2) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 64 2e-08
(Q64MX8) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 64 2e-08
(Q5X9F1) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 64 2e-08
(B5XJ77) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 64 2e-08
(A2RGX5) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 64 2e-08
(Q5L7Q8) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 64 2e-08
(A6KZA8) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 63 3e-08
(Q7MXD5) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 63 3e-08
AP009380_365(AP009380|pid:none) Porphyromonas gingivalis ATCC 33... 63 3e-08
FM204883_2067(FM204883|pid:none) Streptococcus equi subsp. equi ... 62 4e-08
CP001098_815(CP001098|pid:none) Halothermothrix orenii H 168, co... 62 5e-08
AF073777_1(AF073777|pid:none) Neisseria meningitidis arginyl-tRN... 62 7e-08
AP008955_2197(AP008955|pid:none) Brevibacillus brevis NBRC 10059... 61 9e-08
CP000855_509(CP000855|pid:none) Thermococcus onnurineus NA1, com... 61 1e-07
(Q896N5) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 61 1e-07
(A6GZP8) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 60 2e-07
CP001615_2023(CP001615|pid:none) Exiguobacterium sp. AT1b, compl... 60 2e-07
(B1YFI1) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 60 3e-07
CP000048_572(CP000048|pid:none) Borrelia hermsii DAH, complete g... 59 4e-07
(Q831N1) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 59 6e-07
CP000049_572(CP000049|pid:none) Borrelia turicatae 91E135, compl... 58 1e-06
(B1IIE6) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 58 1e-06
(A7GCB9) Arginyl-tRNA synthetase (EC 6.1.1.19) (Arginine--tRNA l... 58 1e-06
FM177140_1895(FM177140|pid:none) Lactobacillus casei BL23 comple... 58 1e-06
CR380947_66(CR380947|pid:none) Candida glabrata strain CBS138 ch... 58 1e-06
CP001581_1128(CP001581|pid:none) Clostridium botulinum A2 str. K... 58 1e-06
(A5I0R5) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 57 1e-06
(Q189Q7) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 57 2e-06
(Q04FF6) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 57 2e-06
CP000686_1270(CP000686|pid:none) Roseiflexus sp. RS-1, complete ... 57 2e-06
AM920427_1272(AM920427|pid:none) Penicillium chrysogenum Wiscons... 56 3e-06
CP000962_1130(CP000962|pid:none) Clostridium botulinum A3 str. L... 56 3e-06
(Q0P5H7) RecName: Full=Probable arginyl-tRNA synthetase, mitocho... 55 5e-06
CP000976_572(CP000976|pid:none) Borrelia duttonii Ly, complete g... 55 5e-06
CU633900_63(CU633900|pid:none) Podospora anserina genomic DNA ch... 55 8e-06
CP001205_568(CP001205|pid:none) Borrelia burgdorferi ZS7, comple... 54 1e-05
BC056803_1(BC056803|pid:none) Danio rerio arginyl-tRNA synthetas... 54 2e-05
CT573058_1(CT573058|pid:none) Zebrafish DNA sequence from clone ... 54 2e-05
S46723(S46723;S56044) arginine-tRNA ligase (EC 6.1.1.19), mitoch... 54 2e-05
(Q6GQJ7) RecName: Full=Probable arginyl-tRNA synthetase, mitocho... 53 2e-05
(Q03GE2) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 53 2e-05
CP001114_1193(CP001114|pid:none) Deinococcus deserti VCD115, com... 53 2e-05
(Q3IUQ6) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 53 2e-05
CP000413_447(CP000413|pid:none) Lactobacillus gasseri ATCC 33323... 53 3e-05
(Q74KR5) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 53 3e-05
(P38714) RecName: Full=Arginyl-tRNA synthetase, mitochondrial; ... 52 4e-05
AE017199_205(AE017199|pid:none) Nanoarchaeum equitans Kin4-M, co... 50 2e-04
T49760(T49760)probable cytosolic arginine-tRNA ligase [imported]... 50 2e-04
CP000383_1554(CP000383|pid:none) Cytophaga hutchinsonii ATCC 334... 50 3e-04
CP000493_1131(CP000493|pid:none) Hyperthermus butylicus DSM 5456... 49 3e-04
AE016819_30(AE016819|pid:none) Ashbya gossypii (= Eremothecium g... 49 3e-04
AE017261_603(AE017261|pid:none) Picrophilus torridus DSM 9790, c... 49 5e-04
AK023550_1(AK023550|pid:none) Homo sapiens cDNA FLJ13488 fis, cl... 49 5e-04
(Q38VQ9) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 49 6e-04
BC158744_1(BC158744|pid:none) Rattus norvegicus arginyl-tRNA syn... 48 8e-04
CP001402_1308(CP001402|pid:none) Sulfolobus islandicus M.16.4, c... 48 0.001
CP001400_1219(CP001400|pid:none) Sulfolobus islandicus M.14.25, ... 48 0.001
(Q3U186) RecName: Full=Probable arginyl-tRNA synthetase, mitocho... 47 0.002
CR380947_83(CR380947|pid:none) Candida glabrata strain CBS138 ch... 47 0.002
BC024878_1(BC024878|pid:none) Mus musculus arginyl-tRNA syntheta... 47 0.002
AB171116_1(AB171116|pid:none) Macaca fascicularis brain cDNA clo... 47 0.002
BA000011_1343(BA000011|pid:none) Thermoplasma volcanium GSS1 DNA... 46 0.004
(Q05506) RecName: Full=Arginyl-tRNA synthetase, cytoplasmic; ... 46 0.004
CR858907_1(CR858907|pid:none) Pongo abelii mRNA; cDNA DKFZp468H1... 46 0.004
AP006627_2280(AP006627|pid:none) Bacillus clausii KSM-K16 DNA, c... 45 0.009
(Q971X1) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 44 0.011
(B1L3E4) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 44 0.019
CU928173_278(CU928173|pid:none) Zygosaccharomyces rouxii strain ... 43 0.025
(O83803) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 42 0.072
CP000852_994(CP000852|pid:none) Caldivirga maquilingensis IC-167... 41 0.094
AX887679_1(AX887679|pid:none) Sequence 3542 from Patent EP1033401. 39 0.61
AM910989_111(AM910989|pid:none) Plasmodium knowlesi strain H chr... 38 0.80
CP001348_2335(CP001348|pid:none) Clostridium cellulolyticum H10,... 38 1.0
AE014187_556(AE014187|pid:none) Plasmodium falciparum 3D7 chromo... 37 1.4
(O51063) RecName: Full=Uncharacterized protein BB_0032; &AE0007... 37 1.8
AF466932_2(AF466932|pid:none) Zea mays clone BAC 206C17, complet... 37 2.3
AF466931_4(AF466931|pid:none) Zea mays clone BAC 163K15, complet... 37 2.3
BT068960_1(BT068960|pid:none) Zea mays full-length cDNA clone ZM... 37 2.3
AM295250_257(AM295250|pid:none) Staphylococcus carnosus subsp. c... 36 3.0
CU928168_77(CU928168|pid:none) Kluyveromyces thermotolerans stra... 36 3.0
CR626927_3143(CR626927|pid:none) Bacteroides fragilis NCTC 9343,... 36 4.0
AP006841_3397(AP006841|pid:none) Bacteroides fragilis YCH46 DNA,... 36 4.0
(Q9YB39) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.... 36 4.0
AP009510_728(AP009510|pid:none) Uncultured Termite group 1 bacte... 35 5.2
CP001557_30(CP001557|pid:none) Borrelia burgdorferi 29805 plasmi... 35 5.2
(P57336) RecName: Full=Hydroxyacylglutathione hydrolase; ... 35 5.2
CP001465_25(CP001465|pid:none) Borrelia spielmanii A14S plasmid ... 35 5.2
AJ628149_49(AJ628149|pid:none) Micromonospora echinospora genomi... 35 6.8
AM910986_140(AM910986|pid:none) Plasmodium knowlesi strain H chr... 35 6.8
BX538352_117(BX538352|pid:none) Cryptosporidium parvum chromosom... 35 6.8
AE014296_77(AE014296|pid:none) Drosophila melanogaster chromosom... 35 6.8
AY380826_238(AY380826|pid:none) Lymphocystis disease virus - iso... 35 6.8
EU016583_9(EU016583|pid:none) Uncultured marine microorganism HF... 35 8.8
AE002129_2(AE002129|pid:none) Ureaplasma parvum serovar 3 str. A... 35 8.8
>(Q8DKN4) RecName: Full=Arginyl-tRNA synthetase; EC=6.1.1.19;
AltName: Full=Arginine--tRNA ligase;
Short=ArgRS; &BA000039_824(BA000039|pid:none)
Length = 584
Score = 118 bits (295), Expect = 6e-25
Identities = 72/198 (36%), Positives = 107/198 (54%), Gaps = 2/198 (1%)
Frame = +2
Query: 692 LNHRVENGK-EWVIVITDDSQSDHFQQVFKIAEDANWLNRKQTRVDHLSFGVVRGPNGQK 868
L +R++ + +W+I +TD QS HF QVF++A+ A W+ T + H+ FG+V G +G++
Sbjct: 324 LRYRIDKDQADWIIYVTDVGQSTHFAQVFQVAQRAGWVPPHVT-LTHVPFGLVLGEDGKR 382
Query: 869 LSSRDGNPIALIDLLQESIERSKQATSLSKSFTRSEKLDITQNANNVEINRMLDTFEXXX 1048
L +R G I LIDLL E+I RS R++ E +DT
Sbjct: 383 LKTRSGETIRLIDLLTEAIARS-----------RADLEQRLATEGRTESPEFIDTVAR-- 429
Query: 1049 XXXXXXETTIDEKHFLKIGMGALKYYDLA-HRNNPYVFSYDSILSFKGNTSIYILYCYTR 1225
IG+GA+KY DL+ +RN+ YVFSYD +LS +GNT+ Y+LY Y R
Sbjct: 430 ----------------AIGIGAVKYADLSQNRNSNYVFSYDKMLSLQGNTAPYLLYAYVR 473
Query: 1226 ISTLLRRANFDGLNLNPN 1279
+ L RR + D L+P+
Sbjct: 474 VQGLTRRGDIDWCTLSPD 491
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3236559
Number of Hits to DB: 1,687,918,264
Number of extensions: 32315352
Number of successful extensions: 89248
Number of sequences better than 10.0: 299
Number of HSP's gapped: 88957
Number of HSP's successfully gapped: 471
Length of query: 477
Length of database: 1,051,180,864
Length adjustment: 132
Effective length of query: 345
Effective length of database: 623,955,076
Effective search space: 215264501220
Effective search space used: 215264501220
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 32 (16.9 bits)
|
| PSORT |
|
| VS (DIR, S) |
0 |
| VH (FL, L) |
1 |
| VF (FL, S) |
0 |
| AH (FL, L) |
0 |
| AF (FL, S) |
0 |
| SL (DIR, L) |
0 |
| SS (DIR, S) |
0 |
| SH (FL, L) |
0 |
| SF (FL, S) |
0 |
| CH (FL, L) |
0 |
| CF (FL, S) |
0 |
| FCL (DIR, L) |
0 |
| FC (DIR, S) |
0 |
| FC-IC (SUB) |
0 |