| Contig-U12264-1 |
| Contig ID |
Contig-U12264-1 |
| Contig update |
2002.12.18 |
| Contig sequence |
 |
| Gap |
gap included |
| Contig length |
2616 |
| Chromosome number (1..6, M) |
6 |
| Chromosome length |
3595308 |
| Start point |
1335123 |
| End point |
1336671 |
| Strand (PLUS/MINUS) |
PLUS |
| Number of clones |
16 |
| Number of EST |
22 |
| Link to clone list |
U12264 |
| List of clone(s) |
|
| Translated Amino Acid sequence |
|
| Translated Amino Acid sequence (All Frames) |
|
| own update |
2004. 6.10 |
| Homology vs CSM-cDNA |
|
| dna update |
2008.11.30 |
| Homology vs DNA |
Query= Contig-U12264-1 (Contig-U12264-1Q) /CSM_Contig/Contig-U12264-1Q.Seq.d
(2626 letters)
Database: ddbj_A
92,845,959 sequences; 95,242,211,685 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value N
(BJ430083) Dictyostelium discoideum cDNA clone:ddv6c06, 3' e... 1100 0.0 1
(AU062103) Dictyostelium discoideum slug cDNA, clone SLH582. 1039 0.0 1
(BJ373817) Dictyostelium discoideum cDNA clone:ddc4k03, 3' e... 1005 0.0 4
(BJ400851) Dictyostelium discoideum cDNA clone:dds15i01, 3' ... 989 0.0 3
(AU039338) Dictyostelium discoideum slug cDNA, clone SLH582. 521 0.0 3
(BJ391106) Dictyostelium discoideum cDNA clone:dds15i01, 5' ... 908 0.0 2
(BJ429488) Dictyostelium discoideum cDNA clone:ddv3n13, 3' e... 438 0.0 8
(AU266042) Dictyostelium discoideum vegetative cDNA clone:VS... 438 0.0 6
(BJ434932) Dictyostelium discoideum cDNA clone:ddv25p12, 3' ... 438 0.0 6
(BJ431689) Dictyostelium discoideum cDNA clone:ddv15j01, 3' ... 438 0.0 6
(AU268224) Dictyostelium discoideum vegetative cDNA clone:VS... 438 0.0 4
(BJ411266) Dictyostelium discoideum cDNA clone:ddv3n13, 5' e... 601 0.0 3
(BJ416258) Dictyostelium discoideum cDNA clone:ddv25p12, 5' ... 601 0.0 3
(AU267413) Dictyostelium discoideum vegetative cDNA clone:VS... 613 0.0 2
(AU266041) Dictyostelium discoideum vegetative cDNA clone:VS... 601 0.0 2
(AU268223) Dictyostelium discoideum vegetative cDNA clone:VS... 601 0.0 2
(BJ413332) Dictyostelium discoideum cDNA clone:ddv15j01, 5' ... 601 0.0 2
(BJ411843) Dictyostelium discoideum cDNA clone:ddv6c06, 5' e... 529 e-162 3
(BJ360080) Dictyostelium discoideum cDNA clone:ddc4k03, 5' e... 529 e-158 2
(BJ327896) Dictyostelium discoideum cDNA clone:dda22l06, 5' ... 452 e-136 3
(BJ363152) Dictyostelium discoideum cDNA clone:ddc25h12, 5' ... 392 e-117 2
(BJ391370) Dictyostelium discoideum cDNA clone:dds13e14, 5' ... 315 e-109 3
(AU038600) Dictyostelium discoideum slug cDNA, clone SSL232. 232 2e-92 3
(AU072935) Dictyostelium discoideum slug cDNA, clone SSF458. 299 3e-76 1
(AU038602) Dictyostelium discoideum slug cDNA, clone SSL234. 117 2e-21 1
(FC813985) Sr_pASP6_016e09_SP6 S. ratti mixed stage pAMP Str... 74 2e-12 2
(EH645642) AU_Cv_EST_008B_F08 Oyster mixed tissue normalized... 68 2e-12 2
(FC813865) Sr_pASP6_015n03_SP6 S. ratti mixed stage pAMP Str... 74 2e-12 2
(CF451592) EST687937 normalized cDNA library of onion Allium... 76 2e-12 2
(CZ534486) SRAA-aac91e03.b1 Strongyloides ratti whole genome... 74 3e-12 2
(BC072247) Xenopus laevis hypothetical protein MGC82338, mRN... 54 2e-11 3
(BU204374) 604156378F1 CSEQCHN03 Gallus gallus cDNA clone Ch... 64 1e-10 2
(BX933748) Gallus gallus finished cDNA, clone ChEST1005k19. 64 1e-10 2
(BU471604) 603761773F1 CSEQRBN21 Gallus gallus cDNA clone Ch... 64 1e-10 2
(BX931284) Gallus gallus finished cDNA, clone ChEST681a20. 64 1e-10 2
(BG407309) dab17b07.y1 NICHD_XGC_Sp1 Xenopus laevis cDNA clo... 54 3e-10 2
(BI446587) de24d05.y3 Wellcome CRC pRN3 oocyte Xenopus laevi... 54 4e-10 2
(BG813126) daf71c10.y1 NICHD_XGC_Eye1 Xenopus laevis cDNA cl... 54 4e-10 2
(DT685854) s13dFA20F09FM075_158210 Tall fescue, Festuca arun... 44 4e-10 4
(BX853808) RZPD Xenopus laevis cDNA clone IMAGp998E0810936 =... 54 5e-10 2
(AR194172) Sequence 23 from patent US 6348339. 54 9e-10 2
(AR194171) Sequence 21 from patent US 6348339. 74 2e-09 3
(ER144381) 1095522117861 Global-Ocean-Sampling_GS-33-01-01-1... 52 1e-08 3
(FE616381) CBYX13351.b1 CBYX Panicum virgatum Kanlow callus ... 54 3e-08 2
(AC147363) Medicago truncatula clone mth2-17c13, complete se... 74 3e-08 1
(CZ546978) SRAA-aad71b08.g1 Strongyloides ratti whole genome... 74 3e-08 1
(DW061658) CLLY14089.b1_A20.ab1 CLL(XYZ) lettuce saligna Lac... 74 3e-08 1
(DR110475) RTS1_11_D02.b1_A029 Roots minus sulfur Pinus taed... 74 3e-08 1
(BQ138835) NF008C08PH1F1055 Phoma-infected Medicago truncatu... 74 3e-08 1
(BG586916) EST488685 MHAM Medicago truncatula/Glomus versifo... 74 3e-08 1
(BE323635) NF004C12PL1F1086 Phosphate starved leaf Medicago ... 74 3e-08 1
(BW964891) Sus scrofa mRNA, clone:OVR010059F01, 5' end, expr... 46 6e-08 3
(BP139637) Sus scrofa mRNA, clone:LVRM10032E08, 5' end, expr... 46 6e-08 3
(BP444164) Sus scrofa mRNA, clone:LVR010061D07, 5' end, expr... 46 6e-08 3
(CL978538) OsIFCC032053 Oryza sativa Express Library Oryza s... 48 1e-07 4
(AK235286) Sus scrofa mRNA, clone:OVRM10065C03, expressed in... 46 2e-07 3
(EX379947) GQ03301.B7_I24 GQ033 - Terminal leader (Normalize... 60 3e-07 3
(AK066940) Oryza sativa Japonica Group cDNA clone:J013090D23... 48 3e-07 4
(EW796832) G893P528RG3.T0 Ixodes scapularis Pooled Non-infec... 58 4e-07 2
(AU074539) Dictyostelium discoideum slug cDNA, clone SSL234. 70 5e-07 1
(AU074538) Dictyostelium discoideum slug cDNA, clone SSL232. 70 5e-07 1
(FE408839) CBTT710.fwd CBTT_Daphnia_pulex_Chosen_One_Library... 56 7e-07 2
(FE640019) CBYZ2604.g1 CBYZ Panicum virgatum Kanlow 4 day ol... 52 1e-06 2
(FE640018) CBYZ2604.b1 CBYZ Panicum virgatum Kanlow 4 day ol... 52 1e-06 2
(FE410027) CBTU1405.fwd CBTU_Daphnia_pulex_Chosen_One_Librar... 56 1e-06 2
(FE284194) CANH2298.fwd CANH_Daphnia_pulex_Log50_Library_21 ... 56 1e-06 2
(CR449188) Xenopus tropicalis EST, clone TTbA066p17 5'. 50 1e-06 2
(FE356096) CBNN14648.fwd CBNN_Daphnia_pulex_Chosen_One_Libra... 56 2e-06 2
(AC157502) Medicago truncatula chromosome 7 clone mte1-56e23... 66 2e-06 6
(FE373771) CBNP3903.fwd CBNP_Daphnia_pulex_Chosen_One_Librar... 56 2e-06 2
(CX843840) JGI_CAAK11287.fwd NIH_XGC_tropBrn3 Xenopus (Silur... 50 2e-06 2
(CX400592) JGI_XZT4541.fwd NIH_XGC_tropTad5 Xenopus (Siluran... 50 2e-06 2
(EL686600) OPVM00206 Elaeis guineensis shoot apex Elaeis gui... 68 2e-06 1
(EL608883) EoEST0898 Oil palm mesocarp-tissue cDNA Entry Lib... 68 2e-06 1
(DT685738) s13dFA19C02FM006_105202 Tall fescue, Festuca arun... 44 2e-06 2
(AP010514) Lotus japonicus genomic DNA, chromosome 1, clone:... 54 3e-06 3
(BG553238) dac23f06.y1 NICHD_XGC_He1 Xenopus laevis cDNA clo... 54 3e-06 2
(ER061123) 1095521747902 Global-Ocean-Sampling_GS-33-01-01-1... 44 4e-06 3
(EK892996) 1093018148313 Global-Ocean-Sampling_GS-33-01-01-1... 52 4e-06 3
(AP007611) Lotus japonicus genomic DNA, chromosome 1, clone:... 54 4e-06 6
(EK986829) 1095521150796 Global-Ocean-Sampling_GS-33-01-01-1... 52 4e-06 3
(EK800054) 1093017186397 Global-Ocean-Sampling_GS-33-01-01-1... 44 4e-06 3
(EK756364) 1093017058915 Global-Ocean-Sampling_GS-33-01-01-1... 52 4e-06 3
(AC135845) Gallus gallus clone TAM33-55P12, WORKING DRAFT SE... 66 7e-06 1
(CG925173) MBEGQ29TF mth2 Medicago truncatula genomic clone ... 66 7e-06 1
(DY972597) CLSM5989.b1_I10.ab1 CLS(LMS) lettuce sativa Lactu... 66 7e-06 1
(DW166478) CLVY4958.b1_L16.ab1 CLV(XYZ) lettuce virosa Lactu... 66 7e-06 1
(DW149411) CLVX14718.b1_L07.ab1 CLV(XYZ) lettuce virosa Lact... 66 7e-06 1
(DW141736) CLSY9800.b1_O02.ab1 CLS(XYZ) lettuce sativa Lactu... 66 7e-06 1
(DW137597) CLSY5058.b1_C17.ab1 CLS(XYZ) lettuce sativa Lactu... 66 7e-06 1
(DW069023) CLLY8816.b2_P20.ab1 CLL(XYZ) lettuce saligna Lact... 66 7e-06 1
(BG453418) NF093F01LF1F1011 Developing leaf Medicago truncat... 66 7e-06 1
(BB910242) Trifolium pratense cDNA clone:RCE09161. 66 7e-06 1
(CO904369) Mdfrt3062f10.y1 Mdfrt Malus x domestica cDNA clon... 42 9e-06 3
(AC229860) Allomyces macrogynus clone 4414275_A_5, *** SEQUE... 52 9e-06 3
(BX926224) Sus Scrofa library (scan) clone scan0022.i.18, 5p... 46 1e-05 3
(CV082165) Mdfrt3070a04.y1 Mdfrt Malus x domestica cDNA clon... 42 1e-05 3
(CO066121) Mdfw2062b03.y1 Mdfw Malus x domestica cDNA clone ... 42 2e-05 3
(FG074758) UI-FF-IF0-abj-j-15-0-UI.r1 Ceratitis capitata emb... 46 2e-05 2
(CW506457) OP__Ba0006C07.f OP__Ba Oryza punctata genomic clo... 56 3e-05 2
>(BJ430083) Dictyostelium discoideum cDNA clone:ddv6c06, 3' end,
single read.
Length = 720
Score = 1100 bits (555), Expect = 0.0
Identities = 555/555 (100%)
Strand = Plus / Minus
Query: 678 aaccattgaggagagtttggcacgttataaagatgtgtgtgacgcagccagagagaacgg 737
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 720 aaccattgaggagagtttggcacgttataaagatgtgtgtgacgcagccagagagaacgg 661
Query: 738 cattaaggtgcgtggctacgtatcatgtgtgctcggctgcccctacgagcagaacgtacc 797
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 660 cattaaggtgcgtggctacgtatcatgtgtgctcggctgcccctacgagcagaacgtacc 601
Query: 798 catttctaaggtggtctacgtctccaagaagctctacgaattcgggtgctatgaaatcag 857
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 600 catttctaaggtggtctacgtctccaagaagctctacgaattcgggtgctatgaaatcag 541
Query: 858 tctaggcgacaccattggcattggtacacccggtgcaacacacaaactattacaagcaat 917
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 540 tctaggcgacaccattggcattggtacacccggtgcaacacacaaactattacaagcaat 481
Query: 918 gtcacaagccattccaatgagcgcaatagccgttcatttccatgacacctacggccaagc 977
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 480 gtcacaagccattccaatgagcgcaatagccgttcatttccatgacacctacggccaagc 421
Query: 978 attggcaaacattctcacatcacttcaatttggtatttcaacagtagacagctcagtttc 1037
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 420 attggcaaacattctcacatcacttcaatttggtatttcaacagtagacagctcagtttc 361
Query: 1038 aggtttaggcggttgtccatatgcaaagggcgcaactggtaacgttgccactgaagatgt 1097
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 360 aggtttaggcggttgtccatatgcaaagggcgcaactggtaacgttgccactgaagatgt 301
Query: 1098 tttatatatgatgaaagatttaggtataaattgtaatgtcgacatgaataaattaatgga 1157
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 300 tttatatatgatgaaagatttaggtataaattgtaatgtcgacatgaataaattaatgga 241
Query: 1158 tgtcagtttatggatttctaaaaaattaaatcgttcaccaagttcaaaagtttcattagc 1217
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 240 tgtcagtttatggatttctaaaaaattaaatcgttcaccaagttcaaaagtttcattagc 181
Query: 1218 attatctcataaagc 1232
|||||||||||||||
Sbjct: 180 attatctcataaagc 166
Score = 101 bits (51), Expect(3) = 2e-25
Identities = 51/51 (100%)
Strand = Plus / Minus
Query: 1295 ctaataaatcatccgaaattccaattaattgcaatacaaatataaataaaa 1345
|||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 103 ctaataaatcatccgaaattccaattaattgcaatacaaatataaataaaa 53
Score = 34.2 bits (17), Expect(3) = 2e-25
Identities = 17/17 (100%)
Strand = Plus / Minus
Query: 1372 attttcatctcttcaaa 1388
|||||||||||||||||
Sbjct: 29 attttcatctcttcaaa 13
Score = 32.2 bits (16), Expect(3) = 2e-25
Identities = 16/16 (100%)
Strand = Plus / Minus
Query: 1355 aaaaagaaaaacaaca 1370
||||||||||||||||
Sbjct: 45 aaaaagaaaaacaaca 30
Lambda K H
1.37 0.711 1.31
Matrix: blastn matrix:1 -3
Number of Sequences: 92845959
Number of Hits to DB: 2,392,506,023
Number of extensions: 153252653
Number of successful extensions: 12491281
Number of sequences better than 10.0: 828
Length of query: 2626
Length of database: 95,242,211,685
Length adjustment: 25
Effective length of query: 2601
Effective length of database: 97,216,030,006
Effective search space: 252858894045606
Effective search space used: 252858894045606
X1: 11 (21.8 bits)
S2: 23 (46.1 bits)
|
| protein update |
2009. 7. 2 |
| Homology vs Protein |
Query= Contig-U12264-1 (Contig-U12264-1Q) /CSM_Contig/Contig-U12264-1Q.Seq.d
(2626 letters)
Database: nrp_B
3,236,559 sequences; 1,051,180,864 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AK066940_1(AK066940|pid:none) Oryza sativa Japonica Group cDNA c... 397 e-109
BT045922_1(BT045922|pid:none) Salmo salar clone ssal-rgf-536-305... 392 e-107
(Q8JZS7) RecName: Full=Probable 3-hydroxymethyl-3-methylglutaryl... 392 e-107
BC046023_1(BC046023|pid:none) Danio rerio 3-hydroxymethyl-3-meth... 392 e-107
EF677006_1(EF677006|pid:none) Picea sitchensis clone WS02760_A02... 392 e-107
(Q29448) RecName: Full=Hydroxymethylglutaryl-CoA lyase, mitochon... 391 e-107
AF411956_10(AF411956|pid:none) Takifugu rubripes lck gene locus,... 389 e-106
BT054411_1(BT054411|pid:none) Zea mays full-length cDNA clone ZM... 388 e-106
AP001073_7(AP001073|pid:none) Oryza sativa Japonica Group genomi... 387 e-105
(Q8TB92) RecName: Full=Probable 3-hydroxymethyl-3-methylglutaryl... 385 e-105
AX643745_1(AX643745|pid:none) Sequence 4 from Patent WO02099093. 385 e-105
BT036021_1(BT036021|pid:none) Zea mays full-length cDNA clone ZM... 385 e-105
AC005168_16(AC005168|pid:none) Arabidopsis thaliana chromosome 2... 384 e-105
AB236744_1(AB236744|pid:none) Trifolium pratense RNA for putativ... 384 e-104
AC157502_3(AC157502|pid:none) Medicago truncatula chromosome 7 c... 378 e-103
BC072247_1(BC072247|pid:none) Xenopus laevis hypothetical protei... 378 e-103
(Q5R9E1) RecName: Full=Hydroxymethylglutaryl-CoA lyase, mitochon... 375 e-102
(Q8HXZ6) RecName: Full=Hydroxymethylglutaryl-CoA lyase, mitochon... 372 e-101
U49719_1(U49719|pid:none) Human hydroxymethylglutaryl-CoA lyase ... 371 e-101
U49878_1(U49878|pid:none) Mus musculus 3-hydroxy-3-methylglutary... 369 e-100
AB171185_1(AB171185|pid:none) Macaca fascicularis brain cDNA clo... 368 e-100
AE014134_1256(AE014134|pid:none) Drosophila melanogaster chromos... 361 7e-98
CR555306_2639(CR555306|pid:none) Azoarcus sp. EbN1 complete geno... 361 9e-98
CP000388_2904(CP000388|pid:none) Pseudoalteromonas atlantica T6c... 353 2e-95
CP000472_3298(CP000472|pid:none) Shewanella piezotolerans WP3, c... 352 3e-95
AM270418_2(AM270418|pid:none) Uncultured organism cosmid clone 1... 351 7e-95
CP000083_1559(CP000083|pid:none) Colwellia psychrerythraea 34H, ... 351 7e-95
AP009384_1996(AP009384|pid:none) Azorhizobium caulinodans ORS 57... 350 2e-94
CP001111_1799(CP001111|pid:none) Stenotrophomonas maltophilia R5... 349 3e-94
CP000507_1353(CP000507|pid:none) Shewanella amazonensis SB2B, co... 347 1e-93
CP000744_3242(CP000744|pid:none) Pseudomonas aeruginosa PA7, com... 346 3e-93
CP000931_2880(CP000931|pid:none) Shewanella halifaxensis HAW-EB4... 345 5e-93
CP001281_721(CP001281|pid:none) Thauera sp. MZ1T, complete genome. 344 8e-93
CP000949_1940(CP000949|pid:none) Pseudomonas putida W619, comple... 343 1e-92
AM039952_1897(AM039952|pid:none) Xanthomonas campestris pv. vesi... 343 2e-92
AE004091_2013(AE004091|pid:none) Pseudomonas aeruginosa PAO1, co... 342 3e-92
AY658923_1(AY658923|pid:none) Synthetic construct Peudomonas aer... 342 3e-92
CP001103_2392(CP001103|pid:none) Alteromonas macleodii 'Deep eco... 342 4e-92
CP000712_2196(CP000712|pid:none) Pseudomonas putida F1, complete... 342 4e-92
AE008923_1821(AE008923|pid:none) Xanthomonas axonopodis pv. citr... 342 4e-92
AE016828_448(AE016828|pid:none) Coxiella burnetii RSA 493, compl... 342 5e-92
AP008229_2753(AP008229|pid:none) Xanthomonas oryzae pv. oryzae M... 342 5e-92
CP000680_2015(CP000680|pid:none) Pseudomonas mendocina ymp, comp... 340 2e-91
CP000733_1399(CP000733|pid:none) Coxiella burnetii Dugway 5J108-... 340 2e-91
CP000514_2097(CP000514|pid:none) Marinobacter aquaeolei VT8, com... 340 2e-91
AE015451_3507(AE015451|pid:none) Pseudomonas putida KT2440 compl... 340 2e-91
AE008922_1802(AE008922|pid:none) Xanthomonas campestris pv. camp... 339 3e-91
AM920689_2145(AM920689|pid:none) Xanthomonas campestris pv. camp... 339 3e-91
CP000891_2961(CP000891|pid:none) Shewanella baltica OS195, compl... 339 3e-91
CP000926_2367(CP000926|pid:none) Pseudomonas putida GB-1, comple... 338 8e-91
CP000606_2567(CP000606|pid:none) Shewanella loihica PV-4, comple... 337 2e-90
CR954246_1409(CR954246|pid:none) Pseudoalteromonas haloplanktis ... 335 4e-90
CP000090_153(CP000090|pid:none) Ralstonia eutropha JMP134 chromo... 335 5e-90
CP000447_2709(CP000447|pid:none) Shewanella frigidimarina NCIMB ... 333 2e-89
CP000444_2378(CP000444|pid:none) Shewanella sp. MR-7, complete g... 332 6e-89
CP000681_1704(CP000681|pid:none) Shewanella putrefaciens CN-32, ... 332 6e-89
AE014299_1858(AE014299|pid:none) Shewanella oneidensis MR-1, com... 332 6e-89
AK293856_1(AK293856|pid:none) Homo sapiens cDNA FLJ57911 complet... 332 6e-89
CP000270_191(CP000270|pid:none) Burkholderia xenovorans LB400 ch... 331 9e-89
AE016853_2689(AE016853|pid:none) Pseudomonas syringae pv. tomato... 331 9e-89
CP000469_1656(CP000469|pid:none) Shewanella sp. ANA-3, complete ... 330 1e-88
CP000446_2315(CP000446|pid:none) Shewanella sp. MR-4, complete g... 330 1e-88
CP000503_2281(CP000503|pid:none) Shewanella sp. W3-18-1, complet... 330 1e-88
AE016825_1759(AE016825|pid:none) Chromobacterium violaceum ATCC ... 330 2e-88
AM260479_186(AM260479|pid:none) Ralstonia eutropha H16 chromosom... 330 2e-88
AM902716_4750(AM902716|pid:none) Bordetella petrii strain DSM 12... 330 2e-88
CP000613_361(CP000613|pid:none) Rhodospirillum centenum SW, comp... 328 8e-88
AE013598_2842(AE013598|pid:none) Xanthomonas oryzae pv. oryzae K... 327 1e-87
CP000058_2508(CP000058|pid:none) Pseudomonas syringae pv. phaseo... 326 2e-87
CR628337_1803(CR628337|pid:none) Legionella pneumophila str. Len... 326 3e-87
CP000127_1800(CP000127|pid:none) Nitrosococcus oceani ATCC 19707... 325 4e-87
CP000440_2997(CP000440|pid:none) Burkholderia ambifaria AMMD chr... 325 7e-87
BX571965_339(BX571965|pid:none) Burkholderia pseudomallei strain... 324 9e-87
CP001025_2843(CP001025|pid:none) Burkholderia ambifaria MC40-6 c... 324 9e-87
CP000614_3011(CP000614|pid:none) Burkholderia vietnamiensis G4 c... 323 2e-86
CP000086_311(CP000086|pid:none) Burkholderia thailandensis E264 ... 323 2e-86
CP000155_3747(CP000155|pid:none) Hahella chejuensis KCTC 2396, c... 323 2e-86
CP000090_1450(CP000090|pid:none) Ralstonia eutropha JMP134 chrom... 323 3e-86
AE017354_1801(AE017354|pid:none) Legionella pneumophila subsp. p... 323 3e-86
CP000958_2957(CP000958|pid:none) Burkholderia cenocepacia MC0-3 ... 323 3e-86
AM167904_197(AM167904|pid:none) Bordetella avium 197N complete g... 323 3e-86
AL646052_261(AL646052|pid:none) Ralstonia solanacearum GMI1000 c... 322 3e-86
BX640412_208(BX640412|pid:none) Bordetella pertussis strain Toha... 320 1e-85
CU207211_99(CU207211|pid:none) Herminiimonas arsenicoxydans chro... 320 2e-85
CP000790_750(CP000790|pid:none) Vibrio harveyi ATCC BAA-1116 chr... 319 4e-85
CP000269_124(CP000269|pid:none) Janthinobacterium sp. Marseille,... 318 8e-85
CP000494_3810(CP000494|pid:none) Bradyrhizobium sp. BTAi1, compl... 317 1e-84
CP001503_3111(CP001503|pid:none) Burkholderia glumae BGR1 chromo... 317 2e-84
CR378678_218(CR378678|pid:none) Photobacterium profundum SS9 chr... 316 2e-84
CP000250_2922(CP000250|pid:none) Rhodopseudomonas palustris HaA2... 315 4e-84
CP001096_2756(CP001096|pid:none) Rhodopseudomonas palustris TIE-... 315 4e-84
DQ311187_1(DQ311187|pid:none) Bombyx mori hydroxymethylglutaryl-... 315 5e-84
CP000283_2526(CP000283|pid:none) Rhodopseudomonas palustris BisB... 314 9e-84
CP001154_2046(CP001154|pid:none) Laribacter hongkongensis HLHK9,... 314 9e-84
CU234118_3482(CU234118|pid:none) Bradyrhizobium sp. ORS278,compl... 313 2e-83
CP001392_2982(CP001392|pid:none) Diaphorobacter sp. TPSY, comple... 312 3e-83
AC025726_21(AC025726|pid:none) Caenorhabditis elegans cosmid Y71... 312 3e-83
CR382128_904(CR382128|pid:none) Yarrowia lipolytica strain CLIB1... 312 3e-83
CP000529_472(CP000529|pid:none) Polaromonas naphthalenivorans CJ... 312 3e-83
CP000713_2043(CP000713|pid:none) Psychrobacter sp. PRwf-1, compl... 311 6e-83
CP000301_2749(CP000301|pid:none) Rhodopseudomonas palustris BisB... 311 8e-83
AE007870_471(AE007870|pid:none) Agrobacterium tumefaciens str. C... 311 8e-83
(P13703) RecName: Full=Hydroxymethylglutaryl-CoA lyase; ... 310 2e-82
BA000038_1049(BA000038|pid:none) Vibrio vulnificus YJ016 DNA, ch... 310 2e-82
CP000884_5945(CP000884|pid:none) Delftia acidovorans SPH-1, comp... 308 9e-82
CP000463_2886(CP000463|pid:none) Rhodopseudomonas palustris BisA... 304 1e-80
CP001638_1636(CP001638|pid:none) Geobacillus sp. WCH70, complete... 301 6e-80
BA000030_5283(BA000030|pid:none) Streptomyces avermitilis MA-468... 301 1e-79
CP000521_1480(CP000521|pid:none) Acinetobacter baumannii ATCC 17... 300 2e-79
CP000922_183(CP000922|pid:none) Anoxybacillus flavithermus WK1, ... 300 2e-79
AM420293_6313(AM420293|pid:none) Saccharopolyspora erythraea NRR... 298 5e-79
CP000863_1407(CP000863|pid:none) Acinetobacter baumannii ACICU, ... 298 9e-79
AL939113_253(AL939113|pid:none) Streptomyces coelicolor A3(2) co... 297 1e-78
AK055075_1(AK055075|pid:none) Homo sapiens cDNA FLJ30513 fis, cl... 296 3e-78
CP000817_869(CP000817|pid:none) Lysinibacillus sphaericus C3-41,... 295 6e-78
CP000555_3345(CP000555|pid:none) Methylibium petroleiphilum PM1,... 295 8e-78
FJ618544_5(FJ618544|pid:none) Streptomyces toxytricini strain NR... 295 8e-78
CP000644_1765(CP000644|pid:none) Aeromonas salmonicida subsp. sa... 291 8e-77
AE010300_845(AE010300|pid:none) Leptospira interrogans serovar l... 290 1e-76
CP000031_2722(CP000031|pid:none) Ruegeria pomeroyi DSS-3, comple... 290 1e-76
CP000462_2022(CP000462|pid:none) Aeromonas hydrophila subsp. hyd... 290 2e-76
AP009493_4757(AP009493|pid:none) Streptomyces griseus subsp. gri... 288 5e-76
AF218939_7(AF218939|pid:none) Bacillus subtilis FenH (fenH), Fen... 287 1e-75
CP000113_3649(CP000113|pid:none) Myxococcus xanthus DK 1622, com... 286 3e-75
CP000557_1433(CP000557|pid:none) Geobacillus thermodenitrificans... 286 3e-75
AE017223_16(AE017223|pid:none) Brucella abortus biovar 1 str. 9-... 285 8e-75
CP000708_14(CP000708|pid:none) Brucella ovis ATCC 25840 chromoso... 285 8e-75
BA000043_1601(BA000043|pid:none) Geobacillus kaustophilus HTA426... 284 1e-74
CP000348_2435(CP000348|pid:none) Leptospira borgpetersenii serov... 283 2e-74
CP001488_16(CP001488|pid:none) Brucella melitensis ATCC 23457 ch... 283 2e-74
AE017333_2037(AE017333|pid:none) Bacillus licheniformis DSM 13, ... 283 2e-74
CP000903_2304(CP000903|pid:none) Bacillus weihenstephanensis KBA... 281 7e-74
AE016877_2336(AE016877|pid:none) Bacillus cereus ATCC 14579, com... 280 1e-73
CP001176_2370(CP001176|pid:none) Bacillus cereus B4264, complete... 280 1e-73
AP008955_3857(AP008955|pid:none) Brevibacillus brevis NBRC 10059... 280 1e-73
CP001186_2359(CP001186|pid:none) Bacillus cereus G9842, complete... 280 2e-73
AK127587_1(AK127587|pid:none) Homo sapiens cDNA FLJ45682 fis, cl... 279 3e-73
CP000227_2327(CP000227|pid:none) Bacillus cereus Q1, complete ge... 279 3e-73
AE017194_2531(AE017194|pid:none) Bacillus cereus ATCC 10987, com... 279 3e-73
CP000739_947(CP000739|pid:none) Sinorhizobium medicae WSM419 pla... 278 6e-73
AP007169_449(AP007169|pid:none) Aspergillus oryzae RIB40 genomic... 278 7e-73
AE016879_2346(AE016879|pid:none) Bacillus anthracis str. Ames, c... 278 1e-72
CP000874_1141(CP000874|pid:none) Rhizobium sp. NGR234 plasmid pN... 277 2e-72
AM746676_4328(AM746676|pid:none) Sorangium cellulosum 'So ce 56'... 276 2e-72
CP000830_1296(CP000830|pid:none) Dinoroseobacter shibae DFL 12, ... 276 4e-72
CP000264_1149(CP000264|pid:none) Jannaschia sp. CCS1, complete g... 275 6e-72
AJ576102_37(AJ576102|pid:none) Bacillus amyloliquefaciens partia... 275 8e-72
CP000490_792(CP000490|pid:none) Paracoccus denitrificans PD1222 ... 274 1e-71
CU638743_809(CU638743|pid:none) Podospora anserina genomic DNA c... 274 1e-71
AM920436_948(AM920436|pid:none) Penicillium chrysogenum Wisconsi... 273 2e-71
BX842656_2(BX842656|pid:none) Bdellovibrio bacteriovorus complet... 266 4e-69
CP001131_2198(CP001131|pid:none) Anaeromyxobacter sp. K, complet... 265 6e-69
AM270008_4(AM270008|pid:none) Aspergillus niger contig An02c0130... 265 8e-69
AY484417_1(AY484417|pid:none) Emericella nidulans 3-hydroxy-3-me... 262 5e-68
CP000661_1988(CP000661|pid:none) Rhodobacter sphaeroides ATCC 17... 260 2e-67
AP007159_351(AP007159|pid:none) Aspergillus oryzae RIB40 genomic... 259 3e-67
CP000143_1103(CP000143|pid:none) Rhodobacter sphaeroides 2.4.1 c... 256 3e-66
CP000577_1162(CP000577|pid:none) Rhodobacter sphaeroides ATCC 17... 255 5e-66
CP001087_2109(CP001087|pid:none) Desulfobacterium autotrophicum ... 254 1e-65
AM920435_1467(AM920435|pid:none) Penicillium chrysogenum Wiscons... 254 1e-65
CP000686_4063(CP000686|pid:none) Roseiflexus sp. RS-1, complete ... 249 5e-64
CP001276_543(CP001276|pid:none) Thermomicrobium roseum DSM 5159 ... 249 5e-64
AC135795_22(AC135795|pid:none) Medicago truncatula clone mth2-28... 242 6e-62
CP000813_1754(CP000813|pid:none) Bacillus pumilus SAFR-032, comp... 240 2e-61
CP000875_758(CP000875|pid:none) Herpetosiphon aurantiacus ATCC 2... 240 2e-61
CP000491_360(CP000491|pid:none) Paracoccus denitrificans PD1222 ... 238 1e-60
CP000909_363(CP000909|pid:none) Chloroflexus aurantiacus J-10-fl... 229 3e-58
CP000667_26(CP000667|pid:none) Salinispora tropica CNB-440, comp... 227 1e-57
CP000264_3783(CP000264|pid:none) Jannaschia sp. CCS1, complete g... 226 4e-57
BA000028_3230(BA000028|pid:none) Oceanobacillus iheyensis HTE831... 222 5e-56
EF648214_4(EF648214|pid:none) Pseudomonas stutzeri strain ATCC 1... 222 6e-56
CP000304_1688(CP000304|pid:none) Pseudomonas stutzeri A1501, com... 222 6e-56
CP000820_3647(CP000820|pid:none) Frankia sp. EAN1pec, complete g... 221 8e-56
AM902716_2794(AM902716|pid:none) Bordetella petrii strain DSM 12... 221 1e-55
BX640431_221(BX640431|pid:none) Bordetella parapertussis strain ... 218 1e-54
CP000267_4125(CP000267|pid:none) Rhodoferax ferrireducens T118, ... 216 3e-54
AM902716_4336(AM902716|pid:none) Bordetella petrii strain DSM 12... 213 2e-53
CP000712_4967(CP000712|pid:none) Pseudomonas putida F1, complete... 213 2e-53
CP000248_177(CP000248|pid:none) Novosphingobium aromaticivorans ... 213 4e-53
CP000853_796(CP000853|pid:none) Alkaliphilus oremlandii OhILAs, ... 211 8e-53
CP001068_1353(CP001068|pid:none) Ralstonia pickettii 12J chromos... 211 8e-53
CP001635_2732(CP001635|pid:none) Variovorax paradoxus S110 chrom... 211 1e-52
CP000449_2386(CP000449|pid:none) Maricaulis maris MCS10, complet... 209 5e-52
BX640422_84(BX640422|pid:none) Bordetella pertussis strain Toham... 208 7e-52
AM747720_1744(AM747720|pid:none) Burkholderia cenocepacia J2315 ... 206 4e-51
CP000686_49(CP000686|pid:none) Roseiflexus sp. RS-1, complete ge... 206 5e-51
AL031295_21(AL031295|pid:none) Human DNA sequence from clone RP5... 205 8e-51
AM260479_2328(AM260479|pid:none) Ralstonia eutropha H16 chromoso... 204 1e-50
CP000378_1204(CP000378|pid:none) Burkholderia cenocepacia AU 105... 204 1e-50
CP000958_1656(CP000958|pid:none) Burkholderia cenocepacia MC0-3 ... 204 2e-50
CP000270_1697(CP000270|pid:none) Burkholderia xenovorans LB400 c... 203 2e-50
AP011115_4585(AP011115|pid:none) Rhodococcus opacus B4 DNA, comp... 203 2e-50
CP000884_2866(CP000884|pid:none) Delftia acidovorans SPH-1, comp... 203 3e-50
CP000151_1665(CP000151|pid:none) Burkholderia sp. 383 chromosome... 202 4e-50
BX640439_55(BX640439|pid:none) Bordetella bronchiseptica strain ... 201 9e-50
AM260480_606(AM260480|pid:none) Ralstonia eutropha H16 chromosom... 201 1e-49
AM181176_1382(AM181176|pid:none) Pseudomonas fluorescens SBW25 c... 200 2e-49
CU633749_1880(CU633749|pid:none) Cupriavidus taiwanensis str. LM... 199 3e-49
CP001025_1606(CP001025|pid:none) Burkholderia ambifaria MC40-6 c... 199 4e-49
CP001349_4710(CP001349|pid:none) Methylobacterium nodulans ORS 2... 199 4e-49
CP000386_1676(CP000386|pid:none) Rubrobacter xylanophilus DSM 99... 197 1e-48
CP000943_4830(CP000943|pid:none) Methylobacterium sp. 4-46, comp... 196 5e-48
CP001635_3222(CP001635|pid:none) Variovorax paradoxus S110 chrom... 194 2e-47
CP000512_1621(CP000512|pid:none) Acidovorax citrulli AAC00-1, co... 193 2e-47
CP001392_2306(CP001392|pid:none) Diaphorobacter sp. TPSY, comple... 193 2e-47
CP000542_291(CP000542|pid:none) Verminephrobacter eiseniae EF01-... 192 5e-47
CP000159_1212(CP000159|pid:none) Salinibacter ruber DSM 13855, c... 192 5e-47
CP000158_1067(CP000158|pid:none) Hyphomonas neptunium ATCC 15444... 192 5e-47
CP000316_4433(CP000316|pid:none) Polaromonas sp. JS666, complete... 191 2e-46
CP000529_3476(CP000529|pid:none) Polaromonas naphthalenivorans C... 190 2e-46
CP000539_2756(CP000539|pid:none) Acidovorax sp. JS42, complete g... 189 3e-46
CP001600_2082(CP001600|pid:none) Edwardsiella ictaluri 93-146, c... 188 8e-46
CP000459_2285(CP000459|pid:none) Burkholderia cenocepacia HI2424... 186 3e-45
CP000949_2547(CP000949|pid:none) Pseudomonas putida W619, comple... 185 8e-45
CP000580_1543(CP000580|pid:none) Mycobacterium sp. JLS, complete... 185 8e-45
CP000959_1593(CP000959|pid:none) Burkholderia cenocepacia MC0-3 ... 184 1e-44
CP001635_455(CP001635|pid:none) Variovorax paradoxus S110 chromo... 184 1e-44
AM747721_2672(AM747721|pid:none) Burkholderia cenocepacia J2315 ... 184 2e-44
CP001013_444(CP001013|pid:none) Leptothrix cholodnii SP-6, compl... 183 2e-44
CP001365_1090(CP001365|pid:none) Halorubrum lacusprofundi ATCC 4... 182 4e-44
CP000655_867(CP000655|pid:none) Polynucleobacter necessarius sub... 180 2e-43
CP001337_2997(CP001337|pid:none) Chloroflexus aggregans DSM 9485... 179 4e-43
CU458896_4616(CU458896|pid:none) Mycobacterium abscessus chromos... 179 6e-43
CP000529_3654(CP000529|pid:none) Polaromonas naphthalenivorans C... 178 8e-43
CP000884_2958(CP000884|pid:none) Delftia acidovorans SPH-1, comp... 177 1e-42
CP000529_1112(CP000529|pid:none) Polaromonas naphthalenivorans C... 176 3e-42
AP006627_544(AP006627|pid:none) Bacillus clausii KSM-K16 DNA, co... 176 5e-42
CP000699_2303(CP000699|pid:none) Sphingomonas wittichii RW1, com... 175 7e-42
U41409_1(U41409|pid:none) Bos taurus hydroxymethylglutaryl-CoA l... 175 7e-42
CP001322_3772(CP001322|pid:none) Desulfatibacillum alkenivorans ... 175 9e-42
AK300733_1(AK300733|pid:none) Homo sapiens cDNA FLJ53101 complet... 174 2e-41
CP000480_2010(CP000480|pid:none) Mycobacterium smegmatis str. MC... 174 2e-41
CP001027_461(CP001027|pid:none) Burkholderia ambifaria MC40-6 ch... 172 4e-41
CP000854_1473(CP000854|pid:none) Mycobacterium marinum M, comple... 172 7e-41
CP001013_437(CP001013|pid:none) Leptothrix cholodnii SP-6, compl... 172 7e-41
DQ311188_1(DQ311188|pid:none) Bombyx mori hydroxymethylglutaryl-... 171 1e-40
CP001349_2676(CP001349|pid:none) Methylobacterium nodulans ORS 2... 169 4e-40
CP001052_775(CP001052|pid:none) Burkholderia phytofirmans PsJN c... 167 1e-39
AM260480_2470(AM260480|pid:none) Ralstonia eutropha H16 chromoso... 167 2e-39
CP000539_3012(CP000539|pid:none) Acidovorax sp. JS42, complete g... 166 3e-39
CP000511_1864(CP000511|pid:none) Mycobacterium vanbaalenii PYR-1... 166 3e-39
AE016958_3194(AE016958|pid:none) Mycobacterium avium subsp. para... 166 4e-39
AM420293_2964(AM420293|pid:none) Saccharopolyspora erythraea NRR... 166 5e-39
BT023390_1(BT023390|pid:none) Drosophila melanogaster IP10408 fu... 165 9e-39
CP000943_1804(CP000943|pid:none) Methylobacterium sp. 4-46, comp... 164 2e-38
BX640422_234(BX640422|pid:none) Bordetella pertussis strain Toha... 164 2e-38
CP000479_3875(CP000479|pid:none) Mycobacterium avium 104, comple... 163 3e-38
CP000316_2307(CP000316|pid:none) Polaromonas sp. JS666, complete... 163 3e-38
AL031295_20(AL031295|pid:none) Human DNA sequence from clone RP5... 162 6e-38
CP000542_3172(CP000542|pid:none) Verminephrobacter eiseniae EF01... 160 3e-37
CP000318_18(CP000318|pid:none) Polaromonas sp. JS666 plasmid 2, ... 159 5e-37
AE016796_471(AE016796|pid:none) Vibrio vulnificus CMCP6 chromoso... 158 8e-37
CP001635_1743(CP001635|pid:none) Variovorax paradoxus S110 chrom... 158 1e-36
CP000092_326(CP000092|pid:none) Ralstonia eutropha JMP134 megapl... 155 9e-36
CP000884_3128(CP000884|pid:none) Delftia acidovorans SPH-1, comp... 152 6e-35
AE016796_470(AE016796|pid:none) Vibrio vulnificus CMCP6 chromoso... 152 8e-35
BA000040_698(BA000040|pid:none) Bradyrhizobium japonicum USDA 11... 146 3e-33
CP000431_5023(CP000431|pid:none) Rhodococcus jostii RHA1, comple... 145 1e-32
CP000431_4869(CP000431|pid:none) Rhodococcus jostii RHA1, comple... 139 4e-31
AP011115_5139(AP011115|pid:none) Rhodococcus opacus B4 DNA, comp... 139 7e-31
CP000474_3982(CP000474|pid:none) Arthrobacter aurescens TC1, com... 136 3e-30
FJ472654_1(FJ472654|pid:none) Homo sapiens 3-hydroxy-3-methylglu... 135 1e-29
BX640438_300(BX640438|pid:none) Bordetella bronchiseptica strain... 133 3e-29
BX640424_301(BX640424|pid:none) Bordetella parapertussis strain ... 133 3e-29
CP001341_191(CP001341|pid:none) Arthrobacter chlorophenolicus A6... 132 6e-29
AP006618_4688(AP006618|pid:none) Nocardia farcinica IFM 10152 DN... 130 2e-28
AM420293_4274(AM420293|pid:none) Saccharopolyspora erythraea NRR... 129 4e-28
CP000480_1963(CP000480|pid:none) Mycobacterium smegmatis str. MC... 128 9e-28
AC079933_59(AC079933|pid:none) Trypanosoma brucei chromosome 4 c... 124 1e-26
EF648211_4(EF648211|pid:none) Pseudomonas stutzeri strain ATCC 1... 121 1e-25
DQ394580_7(DQ394580|pid:none) Pseudomonas alcaligenes strain NCI... 116 4e-24
CP000383_1413(CP000383|pid:none) Cytophaga hutchinsonii ATCC 334... 111 1e-22
EF648215_6(EF648215|pid:none) Pseudomonas stutzeri strain ATCC 1... 100 3e-19
DQ011346_1(DQ011346|pid:none) Bacillus subtilis strain 2.4a YngG... 99 6e-19
DQ011347_1(DQ011347|pid:none) Bacillus subtilis strain 2.4d YngG... 99 1e-18
DQ011351_1(DQ011351|pid:none) Bacillus subtilis strain QST713 Yn... 99 1e-18
AK297191_1(AK297191|pid:none) Homo sapiens cDNA FLJ57397 complet... 97 4e-18
CP001087_986(CP001087|pid:none) Desulfobacterium autotrophicum H... 95 1e-17
(Q8TKQ6) RecName: Full=2-isopropylmalate synthase 1; EC... 92 7e-17
CP000660_1992(CP000660|pid:none) Pyrobaculum arsenaticum DSM 135... 92 1e-16
CP000561_1581(CP000561|pid:none) Pyrobaculum calidifontis JCM 11... 91 3e-16
CP000099_2126(CP000099|pid:none) Methanosarcina barkeri str. Fus... 89 6e-16
(Q58595) RecName: Full=2-isopropylmalate synthase 2; EC... 86 7e-15
(Q8ZW35) RecName: Full=2-isopropylmalate synthase; EC=2... 81 2e-13
CP001400_1108(CP001400|pid:none) Sulfolobus islandicus M.14.25, ... 81 2e-13
CP000077_1212(CP000077|pid:none) Sulfolobus acidocaldarius DSM 6... 80 3e-13
(Q8TYM1) RecName: Full=2-isopropylmalate synthase 2; EC... 80 4e-13
(Q97ZE0) RecName: Full=2-isopropylmalate synthase 1; EC... 80 5e-13
CP000816_979(CP000816|pid:none) Ignicoccus hospitalis KIN4/I, co... 80 5e-13
CP000477_1502(CP000477|pid:none) Methanosaeta thermophila PT, co... 79 8e-13
CP001251_1561(CP001251|pid:none) Dictyoglomus turgidum DSM 6724,... 77 2e-12
(Q8TYB1) RecName: Full=(R)-citramalate synthase; EC=2.3... 77 2e-12
AE017261_913(AE017261|pid:none) Picrophilus torridus DSM 9790, c... 77 3e-12
CP001336_1504(CP001336|pid:none) Desulfitobacterium hafniense DC... 77 3e-12
CP000682_1743(CP000682|pid:none) Metallosphaera sedula DSM 5348,... 76 5e-12
CP000304_1339(CP000304|pid:none) Pseudomonas stutzeri A1501, com... 75 9e-12
(O29305) RecName: Full=2-isopropylmalate synthase 1; EC... 75 9e-12
(Q974X3) RecName: Full=2-isopropylmalate synthase 1; EC... 75 9e-12
FM209186_4092(FM209186|pid:none) Pseudomonas aeruginosa LESB58 c... 75 2e-11
AE004091_1219(AE004091|pid:none) Pseudomonas aeruginosa PAO1, co... 74 2e-11
(O27667) RecName: Full=2-isopropylmalate synthase 1; EC... 74 2e-11
CP000562_631(CP000562|pid:none) Methanoculleus marisnigri JR1, c... 74 2e-11
CP000816_1241(CP000816|pid:none) Ignicoccus hospitalis KIN4/I, c... 74 3e-11
CP000724_1280(CP000724|pid:none) Alkaliphilus metalliredigens QY... 74 3e-11
AP009389_2520(AP009389|pid:none) Pelotomaculum thermopropionicum... 74 4e-11
AJ621335_1(AJ621335|pid:none) Thermoproteus tenax leuA gene for ... 73 5e-11
CP001089_413(CP001089|pid:none) Geobacter lovleyi SZ, complete g... 73 6e-11
(Q971S5) RecName: Full=2-isopropylmalate synthase 2; EC... 72 1e-10
BX950229_1063(BX950229|pid:none) Methanococcus maripaludis strai... 71 2e-10
CP000852_1144(CP000852|pid:none) Caldivirga maquilingensis IC-16... 71 2e-10
CP000300_781(CP000300|pid:none) Methanococcoides burtonii DSM 62... 71 2e-10
AY714829_3(AY714829|pid:none) Uncultured archaeon GZfos19A5 clon... 71 2e-10
CP000240_418(CP000240|pid:none) Synechococcus sp. JA-2-3B'a(2-13... 71 2e-10
CP000254_2283(CP000254|pid:none) Methanospirillum hungatei JF-1,... 71 2e-10
AE009441_1371(AE009441|pid:none) Pyrobaculum aerophilum str. IM2... 71 2e-10
CP000609_528(CP000609|pid:none) Methanococcus maripaludis C5, co... 71 2e-10
CP000820_3989(CP000820|pid:none) Frankia sp. EAN1pec, complete g... 70 3e-10
(Q8RCF9) RecName: Full=2-isopropylmalate synthase 2; EC... 70 3e-10
CP000679_1088(CP000679|pid:none) Caldicellulosiruptor saccharoly... 70 4e-10
CP000678_350(CP000678|pid:none) Methanobrevibacter smithii ATCC ... 70 4e-10
CP001348_3334(CP001348|pid:none) Clostridium cellulolyticum H10,... 70 5e-10
(Q66EM1) RecName: Full=2-isopropylmalate synthase; EC=2... 70 5e-10
CP000020_287(CP000020|pid:none) Vibrio fischeri ES114 chromosome... 70 5e-10
CP000609_1502(CP000609|pid:none) Methanococcus maripaludis C5, c... 70 5e-10
CP000743_979(CP000743|pid:none) Methanococcus aeolicus Nankai-3,... 69 7e-10
CP000232_1895(CP000232|pid:none) Moorella thermoacetica ATCC 390... 69 7e-10
(O26819) RecName: Full=(R)-citramalate synthase; EC=2.3... 69 7e-10
(Q9EVE3) 2-isopropylmalate synthase (EC 2.3.3.13) (Alpha-isoprop... 69 9e-10
CP000742_341(CP000742|pid:none) Methanococcus vannielii SB, comp... 69 9e-10
CP000673_1712(CP000673|pid:none) Clostridium kluyveri DSM 555, c... 69 9e-10
(Q7N129) RecName: Full=2-isopropylmalate synthase; EC=2... 69 9e-10
AP009049_1630(AP009049|pid:none) Clostridium kluyveri NBRC 12016... 69 9e-10
CP000909_321(CP000909|pid:none) Chloroflexus aurantiacus J-10-fl... 69 1e-09
CP001338_2044(CP001338|pid:none) Candidatus Methanosphaerula pal... 69 1e-09
CP000812_259(CP000812|pid:none) Thermotoga lettingae TMO, comple... 68 1e-09
EU686620_16(EU686620|pid:none) Uncultured marine crenarchaeote A... 68 1e-09
CP001124_2053(CP001124|pid:none) Geobacter bemidjiensis Bem, com... 68 2e-09
CP000482_3417(CP000482|pid:none) Pelobacter propionicus DSM 2379... 68 2e-09
CP001393_465(CP001393|pid:none) Anaerocellum thermophilum DSM 67... 68 2e-09
CP001098_799(CP001098|pid:none) Halothermothrix orenii H 168, co... 68 2e-09
CP000743_666(CP000743|pid:none) Methanococcus aeolicus Nankai-3,... 67 3e-09
CP000745_313(CP000745|pid:none) Methanococcus maripaludis C7, co... 67 3e-09
CP000780_592(CP000780|pid:none) Candidatus Methanoregula boonei ... 67 3e-09
AE017261_1466(AE017261|pid:none) Picrophilus torridus DSM 9790, ... 67 3e-09
BX950229_1018(BX950229|pid:none) Methanococcus maripaludis strai... 67 3e-09
CP000568_1381(CP000568|pid:none) Clostridium thermocellum ATCC 2... 67 4e-09
CP000390_961(CP000390|pid:none) Mesorhizobium sp. BNC1, complete... 67 4e-09
CP000102_1275(CP000102|pid:none) Methanosphaera stadtmanae DSM 3... 66 6e-09
CP001337_3488(CP001337|pid:none) Chloroflexus aggregans DSM 9485... 66 6e-09
AE008692_1835(AE008692|pid:none) Zymomonas mobilis subsp. mobili... 66 6e-09
CP000724_3399(CP000724|pid:none) Alkaliphilus metalliredigens QY... 66 6e-09
CP000099_920(CP000099|pid:none) Methanosarcina barkeri str. Fusa... 66 6e-09
CP000826_741(CP000826|pid:none) Serratia proteamaculans 568, com... 66 6e-09
CP000139_1941(CP000139|pid:none) Bacteroides vulgatus ATCC 8482,... 66 6e-09
(Q8THA5) RecName: Full=2-isopropylmalate synthase 2; EC... 66 6e-09
(Q9EVH0) 2-isopropylmalate synthase (EC 2.3.3.13) (Alpha-isoprop... 66 7e-09
(P48571) 2-isopropylmalate synthase (EC 2.3.3.13) (Alpha-isoprop... 66 7e-09
CP000561_1573(CP000561|pid:none) Pyrobaculum calidifontis JCM 11... 65 1e-08
(P58968) RecName: Full=2-isopropylmalate synthase 2; EC... 65 1e-08
FB784041_1(FB784041|pid:none) Sequence 3314 from Patent WO200803... 65 1e-08
(Q9RUA9) RecName: Full=2-isopropylmalate synthase; EC=2... 65 1e-08
(Q9EVH6) 2-isopropylmalate synthase (EC 2.3.3.13) (Alpha-isoprop... 65 1e-08
FB783955_1(FB783955|pid:none) Sequence 3228 from Patent WO200803... 65 1e-08
CP000867_1582(CP000867|pid:none) Methanococcus maripaludis C6, c... 65 1e-08
CP000875_4426(CP000875|pid:none) Herpetosiphon aurantiacus ATCC ... 65 1e-08
CP001287_1715(CP001287|pid:none) Cyanothece sp. PCC 8801, comple... 65 1e-08
CP001600_679(CP001600|pid:none) Edwardsiella ictaluri 93-146, co... 65 2e-08
AY438024_1(AY438024|pid:none) Buchnera aphidicola (Cinara tujafi... 65 2e-08
(P58898) 2-isopropylmalate synthase (EC 2.3.3.13) (Alpha-isoprop... 65 2e-08
AY596297_293(AY596297|pid:none) Haloarcula marismortui ATCC 4304... 65 2e-08
AP009389_531(AP009389|pid:none) Pelotomaculum thermopropionicum ... 65 2e-08
CP001078_101(CP001078|pid:none) Clostridium botulinum E3 str. Al... 65 2e-08
AF197455_1(AF197455|pid:none) Buchnera aphidicola plasmid pLeu i... 65 2e-08
AE000657_1439(AE000657|pid:none) Aquifex aeolicus VF5, complete ... 64 2e-08
(O67862) RecName: Full=2-isopropylmalate synthase; EC=2... 64 2e-08
CP000448_355(CP000448|pid:none) Syntrophomonas wolfei subsp. wol... 64 2e-08
CP000780_1807(CP000780|pid:none) Candidatus Methanoregula boonei... 64 2e-08
(Q57926) RecName: Full=2-isopropylmalate synthase 1; EC... 64 2e-08
(Q8DJ32) RecName: Full=2-isopropylmalate synthase; EC=2... 64 3e-08
(Q9KP83) RecName: Full=2-isopropylmalate synthase; EC=2... 64 3e-08
AY091786_2(AY091786|pid:none) Frankia sp. EuIK1 homocitrate synt... 64 3e-08
AJ965256_678(AJ965256|pid:none) Dehalococcoides sp. CBDB1 comple... 64 3e-08
CU234118_4453(CU234118|pid:none) Bradyrhizobium sp. ORS278,compl... 64 3e-08
EU016580_9(EU016580|pid:none) Uncultured marine microorganism HF... 64 4e-08
CP001056_117(CP001056|pid:none) Clostridium botulinum B str. Ekl... 64 4e-08
CP000678_1246(CP000678|pid:none) Methanobrevibacter smithii ATCC... 63 5e-08
CP000386_3055(CP000386|pid:none) Rubrobacter xylanophilus DSM 99... 63 5e-08
CP000866_1066(CP000866|pid:none) Nitrosopumilus maritimus SCM1, ... 63 5e-08
AJ006878_4(AJ006878|pid:none) Buchnera aphidicola plasmid pBAp1,... 63 5e-08
CP001638_2346(CP001638|pid:none) Geobacillus sp. WCH70, complete... 63 5e-08
CR937011_17(CR937011|pid:none) uncultured archaeon fos0625e3. 63 5e-08
CP000477_1273(CP000477|pid:none) Methanosaeta thermophila PT, co... 63 5e-08
CP001016_479(CP001016|pid:none) Beijerinckia indica subsp. indic... 63 5e-08
AY714856_14(AY714856|pid:none) Uncultured archaeon GZfos32G12 cl... 63 6e-08
CP000975_1871(CP000975|pid:none) Methylacidiphilum infernorum V4... 63 6e-08
CP000789_757(CP000789|pid:none) Vibrio harveyi ATCC BAA-1116 chr... 63 6e-08
CP000742_378(CP000742|pid:none) Methanococcus vannielii SB, comp... 63 6e-08
CP000628_1221(CP000628|pid:none) Agrobacterium radiobacter K84 c... 63 6e-08
CR378664_64(CR378664|pid:none) Photobacterium profundum SS9; seg... 63 6e-08
AB018379_2(AB018379|pid:none) Thermus thermophilus gene for homo... 62 8e-08
(Q9K8E8) RecName: Full=2-isopropylmalate synthase; EC=2... 62 8e-08
CP000724_3343(CP000724|pid:none) Alkaliphilus metalliredigens QY... 62 8e-08
CP000686_1909(CP000686|pid:none) Roseiflexus sp. RS-1, complete ... 62 8e-08
CP000140_2000(CP000140|pid:none) Parabacteroides distasonis ATCC... 62 1e-07
CP000962_422(CP000962|pid:none) Clostridium botulinum A3 str. Lo... 62 1e-07
CP000393_236(CP000393|pid:none) Trichodesmium erythraeum IMS101,... 62 1e-07
AF197453_1(AF197453|pid:none) Buchnera aphidicola plasmid pLeu i... 62 1e-07
CP000560_2446(CP000560|pid:none) Bacillus amyloliquefaciens FZB4... 62 1e-07
CP001365_584(CP001365|pid:none) Halorubrum lacusprofundi ATCC 49... 62 1e-07
FB783959_1(FB783959|pid:none) Sequence 3232 from Patent WO200803... 62 1e-07
(Q8U2A2) RecName: Full=2-isopropylmalate synthase; EC=2... 62 1e-07
E64106(E64106;F57256) 2-isopropylmalate synthase (EC 4.1.3.12) -... 62 1e-07
CP001407_1994(CP001407|pid:none) Bacillus cereus 03BB102, comple... 62 1e-07
CP000880_2782(CP000880|pid:none) Salmonella enterica subsp. ariz... 62 1e-07
CP000141_1242(CP000141|pid:none) Carboxydothermus hydrogenoforma... 62 1e-07
(P43861) RecName: Full=2-isopropylmalate synthase; EC=2... 62 1e-07
AP009179_1956(AP009179|pid:none) Sulfurovum sp. NBC37-1 genomic ... 62 1e-07
(Q8EN67) RecName: Full=2-isopropylmalate synthase; EC=2... 62 1e-07
CP000348_1329(CP000348|pid:none) Leptospira borgpetersenii serov... 62 1e-07
(Q9EVG4) 2-isopropylmalate synthase (EC 2.3.3.13) (Alpha-isoprop... 62 1e-07
CP000027_802(CP000027|pid:none) Dehalococcoides ethenogenes 195,... 62 1e-07
CP000612_282(CP000612|pid:none) Desulfotomaculum reducens MI-1, ... 62 1e-07
FB784035_1(FB784035|pid:none) Sequence 3308 from Patent WO200803... 62 1e-07
CP000057_1022(CP000057|pid:none) Haemophilus influenzae 86-028NP... 62 1e-07
CP000436_398(CP000436|pid:none) Haemophilus somnus 129PT, comple... 62 1e-07
CP000931_437(CP000931|pid:none) Shewanella halifaxensis HAW-EB4,... 62 1e-07
CP000783_3177(CP000783|pid:none) Enterobacter sakazakii ATCC BAA... 62 1e-07
AP009049_1895(AP009049|pid:none) Clostridium kluyveri NBRC 12016... 61 2e-07
CP000922_591(CP000922|pid:none) Anoxybacillus flavithermus WK1, ... 61 2e-07
FP236842_729(FP236842|pid:none) Erwinia pyrifoliae strain Ep1/96... 61 2e-07
(Q9CJN5) RecName: Full=2-isopropylmalate synthase; EC=2... 61 2e-07
AP006841_3442(AP006841|pid:none) Bacteroides fragilis YCH46 DNA,... 61 2e-07
AP009493_1979(AP009493|pid:none) Streptomyces griseus subsp. gri... 61 2e-07
AP008226_1210(AP008226|pid:none) Thermus thermophilus HB8 genomi... 61 2e-07
AM412317_416(AM412317|pid:none) Clostridium botulinum A str. ATC... 61 2e-07
CP000728_419(CP000728|pid:none) Clostridium botulinum F str. Lan... 61 2e-07
CP000142_2258(CP000142|pid:none) Pelobacter carbinolicus DSM 238... 61 2e-07
CP000510_208(CP000510|pid:none) Psychromonas ingrahamii 37, comp... 61 2e-07
CP000726_391(CP000726|pid:none) Clostridium botulinum A str. ATC... 61 2e-07
CP000027_797(CP000027|pid:none) Dehalococcoides ethenogenes 195,... 61 2e-07
CP001083_421(CP001083|pid:none) Clostridium botulinum Ba4 str. 6... 61 2e-07
CP000435_950(CP000435|pid:none) Synechococcus sp. CC9311, comple... 61 2e-07
FJ170277_20(FJ170277|pid:none) Uncultured cyanobacterium group A... 61 2e-07
AY714835_25(AY714835|pid:none) Uncultured archaeon GZfos22D9 clo... 61 2e-07
CP001130_1176(CP001130|pid:none) Hydrogenobaculum sp. Y04AAS1, c... 61 2e-07
CP000682_621(CP000682|pid:none) Metallosphaera sedula DSM 5348, ... 61 2e-07
(Q9WZ23) RecName: Full=2-isopropylmalate synthase; EC=2... 60 3e-07
AF197457_1(AF197457|pid:none) Buchnera aphidicola plasmid pLeu i... 60 3e-07
AE017221_845(AE017221|pid:none) Thermus thermophilus HB27, compl... 60 3e-07
BA000040_3792(BA000040|pid:none) Bradyrhizobium japonicum USDA 1... 60 3e-07
AM942759_2062(AM942759|pid:none) Proteus mirabilis strain HI4320... 60 3e-07
CP001291_1103(CP001291|pid:none) Cyanothece sp. PCC 7424, comple... 60 3e-07
CP001359_1962(CP001359|pid:none) Anaeromyxobacter dehalogenans 2... 60 4e-07
CU468135_742(CU468135|pid:none) Erwinia tasmaniensis strain ET1/... 60 4e-07
CP001581_431(CP001581|pid:none) Clostridium botulinum A2 str. Ky... 60 4e-07
(Q89A49) RecName: Full=Putative 2-isopropylmalate synthase; ... 60 4e-07
AM180575_1(AM180575|pid:none) Arabidopsis lyrata subsp. petraea ... 60 4e-07
CP000678_722(CP000678|pid:none) Methanobrevibacter smithii ATCC ... 60 4e-07
CP001291_2080(CP001291|pid:none) Cyanothece sp. PCC 7424, comple... 60 4e-07
CP001103_3059(CP001103|pid:none) Alteromonas macleodii 'Deep eco... 60 4e-07
(Q9Y823) RecName: Full=Homocitrate synthase, mitochondrial; ... 60 4e-07
CP000239_2117(CP000239|pid:none) Synechococcus sp. JA-3-3Ab, com... 60 4e-07
CP000251_1974(CP000251|pid:none) Anaeromyxobacter dehalogenans 2... 60 5e-07
FB784043_1(FB784043|pid:none) Sequence 3316 from Patent WO200803... 60 5e-07
(Q9PLV9) RecName: Full=2-isopropylmalate synthase; EC=2... 60 5e-07
(Q5HMF9) RecName: Full=2-isopropylmalate synthase; EC=2... 60 5e-07
(Q9EVI8) 2-isopropylmalate synthase (EC 2.3.3.13) (Alpha-isoprop... 60 5e-07
CP000781_4675(CP000781|pid:none) Xanthobacter autotrophicus Py2,... 60 5e-07
CP000387_924(CP000387|pid:none) Streptococcus sanguinis SK36, co... 59 7e-07
BA000012_6150(BA000012|pid:none) Mesorhizobium loti MAFF303099 D... 59 7e-07
CP000814_1621(CP000814|pid:none) Campylobacter jejuni subsp. jej... 59 7e-07
CP001614_1406(CP001614|pid:none) Teredinibacter turnerae T7901, ... 59 7e-07
CP001114_1863(CP001114|pid:none) Deinococcus deserti VCD115, com... 59 9e-07
CP000472_2114(CP000472|pid:none) Shewanella piezotolerans WP3, c... 59 9e-07
AE016827_599(AE016827|pid:none) Mannheimia succiniciproducens MB... 59 9e-07
FN392319_1209(FN392319|pid:none) Pichia pastoris GS115 chromosom... 59 9e-07
AE015928_1861(AE015928|pid:none) Bacteroides thetaiotaomicron VP... 59 9e-07
(Q7VQJ6) RecName: Full=2-isopropylmalate synthase; EC=2... 59 9e-07
AM180088_298(AM180088|pid:none) Haloquadratum walsbyi DSM 16790 ... 59 9e-07
AY599747_11(AY599747|pid:none) Pseudomonas sp. ST41 xyl lower (m... 59 9e-07
CP001037_406(CP001037|pid:none) Nostoc punctiforme PCC 73102, co... 59 9e-07
CP001365_868(CP001365|pid:none) Halorubrum lacusprofundi ATCC 49... 59 9e-07
AE017220_109(AE017220|pid:none) Salmonella enterica subsp. enter... 59 1e-06
CP000852_1782(CP000852|pid:none) Caldivirga maquilingensis IC-16... 59 1e-06
CP001147_638(CP001147|pid:none) Thermodesulfovibrio yellowstonii... 59 1e-06
(P15875) RecName: Full=2-isopropylmalate synthase; EC=2... 59 1e-06
(Q9V1J1) RecName: Full=2-isopropylmalate synthase 2; EC... 59 1e-06
(Q8Z9I0) RecName: Full=2-isopropylmalate synthase; EC=2... 59 1e-06
CP001113_118(CP001113|pid:none) Salmonella enterica subsp. enter... 59 1e-06
CP000462_848(CP000462|pid:none) Aeromonas hydrophila subsp. hydr... 59 1e-06
CP000552_1155(CP000552|pid:none) Prochlorococcus marinus str. MI... 59 1e-06
CP000423_1748(CP000423|pid:none) Lactobacillus casei ATCC 334, c... 58 2e-06
CP001111_3326(CP001111|pid:none) Stenotrophomonas maltophilia R5... 58 2e-06
CT971583_1586(CT971583|pid:none) Synechococcus WH7803 complete g... 58 2e-06
AJ486947_1(AJ486947|pid:none) Arabidopsis thaliana mRNA for meth... 58 2e-06
DQ146476_10(DQ146476|pid:none) Geobacillus stearothermophilus st... 58 2e-06
AJ486943_1(AJ486943|pid:none) Arabidopsis thaliana mRNA for meth... 58 2e-06
AJ486939_1(AJ486939|pid:none) Arabidopsis thaliana mRNA for meth... 58 2e-06
CP000647_79(CP000647|pid:none) Klebsiella pneumoniae subsp. pneu... 58 2e-06
(Q9FN52) RecName: Full=Methylthioalkylmalate synthase 3, chlorop... 58 2e-06
>AK066940_1(AK066940|pid:none) Oryza sativa Japonica Group cDNA
clone:J013090D23, full insert sequence.
&AP008218_184(AP008218|pid:none)
Length = 377
Score = 397 bits (1021), Expect = e-109
Identities = 196/293 (66%), Positives = 238/293 (81%)
Frame = +1
Query: 343 PEYVKIVEVGPRDGLQNEKIIVPTVDKIQLINRLAQTGLSVVEATSFVSPKWVPQMADNK 522
P +VKIVEVGPRDGLQNEK VPT KI+LI++L +GLSVVEATSFVSPKWVPQ+AD K
Sbjct: 80 PRFVKIVEVGPRDGLQNEKNTVPTSVKIELIHKLVASGLSVVEATSFVSPKWVPQLADAK 139
Query: 523 EVLRGIEKVEGVSYPCLTPNIQGFRAALDAGAKEIALFAAASESFSKKNINATIEESLAR 702
+V+ GI+ V V +P LTPN++GF AA+ AGAKE+A+FA+ASESFSK N+N TI+ESL R
Sbjct: 140 DVVEGIKHVPDVRFPVLTPNLRGFEAAVAAGAKEVAVFASASESFSKSNLNCTIKESLVR 199
Query: 703 YKDVCDAARENGIKVRGYVSCVLGCPYEQNVPISKVVYVSKKLYEFGCYEISLGDTIGIG 882
Y DV +A+++GI++RGYVSCV+GCP E + SKV YV+K+LY+ GC EISLGDTIG+G
Sbjct: 200 YHDVVTSAKKHGIRIRGYVSCVVGCPVEGTIHPSKVAYVAKELYDMGCSEISLGDTIGVG 259
Query: 883 TPGATHKLLQAMSQAIPMSAIAVHFHDTYGQALANILTSLQFGISTVDSSVSGLGGCPYA 1062
TPG+ +L+A+ +P+ IAVHFHDTYGQALANIL SLQ GI+ VDSSVSGLGGCPYA
Sbjct: 260 TPGSVLAMLEAVMSFVPVDKIAVHFHDTYGQALANILVSLQLGINIVDSSVSGLGGCPYA 319
Query: 1063 KGATGNVATEDVLYMMKDLGINCNVDMNKLMDVSLWISKKLNRSPSSKVSLAL 1221
KGATGNVATEDV+YM+ LGI NVD+NKLMD +ISK L R SK + AL
Sbjct: 320 KGATGNVATEDVVYMLHGLGIETNVDLNKLMDAGDYISKHLGRQSGSKTTTAL 372
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3236559
Number of Hits to DB: 3,691,681,108
Number of extensions: 69959429
Number of successful extensions: 186936
Number of sequences better than 10.0: 1103
Number of HSP's gapped: 186152
Number of HSP's successfully gapped: 1109
Length of query: 875
Length of database: 1,051,180,864
Length adjustment: 138
Effective length of query: 737
Effective length of database: 604,535,722
Effective search space: 445542827114
Effective search space used: 445542827114
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 32 (16.9 bits)
|
| PSORT |
|
| VS (DIR, S) |
3 |
| VH (FL, L) |
0 |
| VF (FL, S) |
4 |
| AH (FL, L) |
0 |
| AF (FL, S) |
1 |
| SL (DIR, L) |
1 |
| SS (DIR, S) |
3 |
| SH (FL, L) |
0 |
| SF (FL, S) |
2 |
| CH (FL, L) |
1 |
| CF (FL, S) |
1 |
| FCL (DIR, L) |
0 |
| FC (DIR, S) |
0 |
| FC-IC (SUB) |
0 |