NBDC - アーカイブトップ - ヘルプ
データベースの説明 | データ項目の説明 | 利用許諾 | ヘルプ
Dicty_cDB
Contig List | Clone List | cDNA Library List
Atlas
Atlas | Atlas Image List
NBDC - LSDB Archive
Description of this DB | Description of data items | Download | License
Dicty_cDB
Contig List | Clone List | cDNA Library List
Atlas
Atlas | Atlas Image List
Contig-U01883-1
Contig ID Contig-U01883-1
Contig update 2001. 8.29
Contig sequence 
>Contig-U01883-1 (Contig-U01883-1Q) /CSM_Contig/Contig-U01883-1Q.Seq.d
AAATTTTAATTATTCCAAGTAATTATAATTCTTGGTATTAAATTGATCAA
CACTGTTTGTTCAAAAAAATAAAATAAAATTTTCATTTTGTTTTTTTAAT
TAATCTTTGGAAAATGGCTCATAATAATAATAATAATATTAATAATAATA
ATA----------ATAATAATAATAATAATAAAAATAATAATAGTGAATA
TAAAACTAACAGAAATTTATTATACAAAACTATTCTGAATGATATAGAAA
ATAGTTTACAATCATTAATAAAACCTCAAGAATTAACGAATCTATTAGAA
GATAATATTAATAAATTAAAAGAACTTGATGGAGTGCAACCAACAAATAC
TTTTGGAAATCTTCAAAACACAAGTACAAATACAACTACAACAACTACAA
CAACCACAACAACCACTACAACTTCATCTCCAAACAATAATGTTATAACA
CCAAATTCAAATTTAAAGCAAACACTTTCTCCATCTGTATTAATTGAACA
TTTAAATCTTTTTGGAAATGAAAATTTTGAAGAAGGGGATGATGAAGAAG
AAACTAGTAGTGATTCAGATTCTTCTTCTAGTTCTTCGACATCTTCTTCT
TCTTCAGAAAGGGTTCCTTCTAAAAAACTAAAGCCTAAAGCCAAACCACG
ACCAGGTGGATGTAGTATATGCAAGACCCAAGAAACTCCTTACTGGAGAA
AAGGAAAAGATGGTGATAAAACCGTTTATTTATGTAATGCTTGTGGTTTA
CAAATTTA
Gap gap included
Contig length 748
Chromosome number (1..6, M) 3
Chromosome length 6358359
Start point 1919591
End point 1918827
Strand (PLUS/MINUS) MINUS
Number of clones 2
Number of EST 3
Link to clone list U01883
List of clone(s) 

est1=SSC708F,1,151
est2=SSJ634F,1,154
est3=SSJ634Z,155,750
Translated Amino Acid sequence 
iliipsnynswy*idqhclfkkik*NFHFVFLINLWKMAHNNNNNINNNN---

---NNNNNKNNNSEYKTNRNLLYKTILNDIENSLQSLIKPQELTNLLEDNINKLKELDGV
QPTNTFGNLQNTSTNTTTTTTTTTTTTTTSSPNNNVITPNSNLKQTLSPSVLIEHLNLFG
NENFEEGDDEEETSSDSDSSSSSSTSSSSSERVPSKKLKPKAKPRPGGCSICKTQETPYW
RKGKDGDKTVYLCNACGLQI
Translated Amino Acid sequence (All Frames) 
Frame A:
kf*lfqviiilgiklintvcskk*nkifilff*lifgkwliiiiiiliiii---

---iiiiiikiiivniklteiyytklf*mi*kivynh**nlkn*riy*kiilin*knlme
cnqqilleifktqvqiqlqqlqqpqqplqlhlqtiml*hqiqi*skhflhly*lni*ifl
emkilkkgmmkkklvviqilllvlrhllllqkgfllkn*slkpnhdqvdvvyarpkkllt
gekekmvikpfiyvmlvvykf

Frame B:
nfnysk*l*flvln*stlfvqknkikfsfcffn*slengs*****y****---

---******k****i*n*qkfiiqnyse*yrk*ftiinktsrinesirr*y**ikrt*ws
atnkyfwksskhkykynynnynnhnnhynfiskq*cyntkfkfkantfsicin*tfksfw
k*kf*rrg**rrn***frfff*ffdiffffrkgsf*ktka*sqtttrwm*ymqdprnsll
ekrkrw**nrlfm*clwftnl

Frame C:
iliipsnynswy*idqhclfkkik*NFHFVFLINLWKMAHNNNNNINNNN---

---NNNNNKNNNSEYKTNRNLLYKTILNDIENSLQSLIKPQELTNLLEDNINKLKELDGV
QPTNTFGNLQNTSTNTTTTTTTTTTTTTTSSPNNNVITPNSNLKQTLSPSVLIEHLNLFG
NENFEEGDDEEETSSDSDSSSSSSTSSSSSERVPSKKLKPKAKPRPGGCSICKTQETPYW
RKGKDGDKTVYLCNACGLQI
own update 2004. 6. 9
Homology vs CSM-cDNA 
Query= Contig-U01883-1 (Contig-U01883-1Q)
/CSM_Contig/Contig-U01883-1Q.Seq.d
         (758 letters)

Database: CSM
           6905 sequences; 5,674,871 total letters


                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

Contig-U01883-1 (Contig-U01883-1Q) /CSM_Contig/Conti...   335  4e-92
Contig-U04554-1 (Contig-U04554-1Q) /CSM_Contig/Conti...    40  0.003
Contig-U13925-1 (Contig-U13925-1Q) /CSM_Contig/Conti...    38  0.013
Contig-U12392-1 (Contig-U12392-1Q) /CSM_Contig/Conti...    38  0.013
Contig-U03470-1 (Contig-U03470-1Q) /CSM_Contig/Conti...    38  0.013
Contig-U13386-1 (Contig-U13386-1Q) /CSM_Contig/Conti...    36  0.053
Contig-U12164-1 (Contig-U12164-1Q) /CSM_Contig/Conti...    36  0.053
Contig-U12030-1 (Contig-U12030-1Q) /CSM_Contig/Conti...    36  0.053
Contig-U10968-1 (Contig-U10968-1Q) /CSM_Contig/Conti...    36  0.053
Contig-U09394-1 (Contig-U09394-1Q) /CSM_Contig/Conti...    36  0.053

>Contig-U01883-1 (Contig-U01883-1Q) /CSM_Contig/Contig-U01883-1Q.Seq.d
          Length = 758

 Score =  335 bits (169), Expect = 4e-92
 Identities = 169/169 (100%)
 Strand = Plus / Plus

                                                                       
Query: 194 gtgaatataaaactaacagaaatttattatacaaaactattctgaatgatatagaaaata 253
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 194 gtgaatataaaactaacagaaatttattatacaaaactattctgaatgatatagaaaata 253

                                                                       
Query: 254 gtttacaatcattaataaaacctcaagaattaacgaatctattagaagataatattaata 313
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 254 gtttacaatcattaataaaacctcaagaattaacgaatctattagaagataatattaata 313

                                                            
Query: 314 aattaaaagaacttgatggagtgcaaccaacaaatacttttggaaatct 362
           |||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 314 aattaaaagaacttgatggagtgcaaccaacaaatacttttggaaatct 362


 Score =  303 bits (153), Expect = 1e-82
 Identities = 153/153 (100%)
 Strand = Plus / Plus

                                                                       
Query: 606 agaaagggttccttctaaaaaactaaagcctaaagccaaaccacgaccaggtggatgtag 665
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 606 agaaagggttccttctaaaaaactaaagcctaaagccaaaccacgaccaggtggatgtag 665

                                                                       
Query: 666 tatatgcaagacccaagaaactccttactggagaaaaggaaaagatggtgataaaaccgt 725
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 666 tatatgcaagacccaagaaactccttactggagaaaaggaaaagatggtgataaaaccgt 725

                                            
Query: 726 ttatttatgtaatgcttgtggtttacaaattta 758
           |||||||||||||||||||||||||||||||||
Sbjct: 726 ttatttatgtaatgcttgtggtttacaaattta 758


 Score =  289 bits (146), Expect = 2e-78
 Identities = 146/146 (100%)
 Strand = Plus / Plus

                                                                       
Query: 423 ttcatctccaaacaataatgttataacaccaaattcaaatttaaagcaaacactttctcc 482
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 423 ttcatctccaaacaataatgttataacaccaaattcaaatttaaagcaaacactttctcc 482

                                                                       
Query: 483 atctgtattaattgaacatttaaatctttttggaaatgaaaattttgaagaaggggatga 542
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 483 atctgtattaattgaacatttaaatctttttggaaatgaaaattttgaagaaggggatga 542

                                     
Query: 543 tgaagaagaaactagtagtgattcag 568
           ||||||||||||||||||||||||||
Sbjct: 543 tgaagaagaaactagtagtgattcag 568


 Score =  123 bits (62), Expect = 3e-28
 Identities = 62/62 (100%)
 Strand = Plus / Plus

                                                                      
Query: 1  aaattttaattattccaagtaattataattcttggtattaaattgatcaacactgtttgt 60
          ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1  aaattttaattattccaagtaattataattcttggtattaaattgatcaacactgtttgt 60

            
Query: 61 tc 62
          ||
Sbjct: 61 tc 62


 Score = 46.1 bits (23), Expect = 6e-05
 Identities = 23/23 (100%)
 Strand = Plus / Plus

                                  
Query: 98  aattaatctttggaaaatggctc 120
           |||||||||||||||||||||||
Sbjct: 98  aattaatctttggaaaatggctc 120


>Contig-U04554-1 (Contig-U04554-1Q) /CSM_Contig/Contig-U04554-1Q.Seq.d
          Length = 896

 Score = 40.1 bits (20), Expect = 0.003
 Identities = 23/24 (95%)
 Strand = Plus / Plus

                                   
Query: 301 gataatattaataaattaaaagaa 324
           ||||||||||||||||| ||||||
Sbjct: 746 gataatattaataaatttaaagaa 769


>Contig-U13925-1 (Contig-U13925-1Q) /CSM_Contig/Contig-U13925-1Q.Seq.d
          Length = 1417

 Score = 38.2 bits (19), Expect = 0.013
 Identities = 19/19 (100%)
 Strand = Plus / Plus

                              
Query: 447 aacaccaaattcaaattta 465
           |||||||||||||||||||
Sbjct: 307 aacaccaaattcaaattta 325


  Database: CSM
    Posted date:  Jun 9, 2004  7:35 PM
  Number of letters in database: 5,674,871
  Number of sequences in database:  6905
  
Lambda     K      H
    1.37    0.711     1.31 

Gapped
Lambda     K      H
    1.37    0.711     1.31 


Matrix: blastn matrix:1 -3
Gap Penalties: Existence: 5, Extension: 2
Number of Hits to DB: 10,783
Number of Sequences: 6905
Number of extensions: 10783
Number of successful extensions: 1387
Number of sequences better than 10.0: 178
length of query: 758
length of database: 5,674,871
effective HSP length: 16
effective length of query: 742
effective length of database: 5,564,391
effective search space: 4128778122
effective search space used: 4128778122
T: 0
A: 40
X1: 6 (11.9 bits)
X2: 15 (29.7 bits)
S1: 12 (24.3 bits)
S2: 15 (30.2 bits)
dna update 2009. 5.10
Homology vs DNA 
Query= Contig-U01883-1 (Contig-U01883-1Q) /CSM_Contig/Contig-U01883-1Q.Seq.d
         (758 letters)

Database: ddbj_A
           102,105,510 sequences; 101,790,757,118 total letters

Searching..................................................done

                                                             Score    E
Sequences producing significant alignments:                  (bits) Value  N

(C90696) Dictyostelium discoideum slug cDNA, clone SSJ634.        303   0.0    3
(AU074148) Dictyostelium discoideum slug cDNA, clone SSJ634.      123   2e-32  3
(AU071898) Dictyostelium discoideum slug cDNA, clone SSC708.      119   3e-31  3
(AC133611) Rattus norvegicus clone CH230-84C6, *** SEQUENCIN...    44   0.020  3
(AC108493) Homo sapiens BAC clone RP11-174N13 from 2, comple...    50   0.042  2
(DT685055) s13dFA07D07FS062_519258 Tall fescue, Festuca arun...    50   0.12   1
(AC116985) Dictyostelium discoideum chromosome 2 map 6135249...    34   0.27   4
(J01477) Yeast (S.cerevisiae) mitochondrial cox1 gene for cy...    46   0.36   2
(BT058980) Salmo salar clone ssal-rgf-517-276 Ribosome bioge...    48   0.49   1
(AC179648) Strongylocentrotus purpuratus clone R3-1024L07, W...    48   0.49   1
(CR370070) AGENAE Rainbow trout normalized testis library (t...    48   0.49   1
(BX888563) AGENAE Rainbow trout multi-tissues-normalized + 2...    48   0.49   1
(GE780274) EST_ssal_rgf_846132 ssalrgf mixed_tissue full-len...    48   0.49   1
(FE261356) CAZO1953.fwd CAZO Naegleria gruberi Flagellate St...    48   0.49   1
(FE240742) CAPG5997.fwd CAPG Naegleria gruberi amoeba stage ...    48   0.49   1
(FE237988) CAPG4637.fwd CAPG Naegleria gruberi amoeba stage ...    48   0.49   1
(CP000981) Borrelia duttonii Ly plasmid pl23b, partial seque...    44   1.1    3
(CW883099) 604265_QCD-77r58SL1-1A07_M13F QCD-77r58SL1 Clostr...    38   1.4    2
(L36897) Saccharomyces cerevisiae mitochondrion oxi3 gene, a...    46   1.8    2
(CP000942) Ureaplasma parvum serovar 3 str. ATCC 27815, comp...    36   1.9    10
(AF222894) Ureaplasma parvum serovar 3 str. ATCC 700970, com...    36   1.9    10
(EF058458) Synthetic construct Saccharomyces cerevisiae clon...    46   2.0    1
(EU004203) Saccharomyces cerevisiae YJM789 mitochondrion, co...    46   2.0    1
(AY101610) Nicotiana tabacum homeodomain protein Hfi22 (Hfi2...    46   2.0    1
(AJ011856) Saccharomyces cerevisiae complete mitochondrial g...    46   2.0    1
(CS819489) Sequence 6398 from Patent WO2007106407.                 46   2.0    1
(CU638863) Pig DNA sequence *** SEQUENCING IN PROGRESS *** f...    46   2.0    1
(FH189036) CHO_OF3441xc17r1.ab1 CHO_OF3 Nicotiana tabacum ge...    46   2.0    1
(ET158045) MEcgc725.1p1p2_p2.k_078 Merino PCR library Ovis a...    46   2.0    1
(ER501440) 1093015399798 Global-Ocean-Sampling_GS-35-01-01-1...    46   2.0    1
(ER494486) 1093015341694 Global-Ocean-Sampling_GS-35-01-01-1...    46   2.0    1
(ER485760) 1093015297033 Global-Ocean-Sampling_GS-35-01-01-1...    46   2.0    1
(EK499832) 1095505205809 Global-Ocean-Sampling_GS-32-01-01-1...    46   2.0    1
(EK431498) 1095516155534 Global-Ocean-Sampling_GS-31-01-01-1...    46   2.0    1
(EK404221) 1095469558765 Global-Ocean-Sampling_GS-31-01-01-1...    46   2.0    1
(EK374241) 1095469431490 Global-Ocean-Sampling_GS-31-01-01-1...    46   2.0    1
(EK303485) 1095462372621 Global-Ocean-Sampling_GS-31-01-01-1...    46   2.0    1
(EK263416) 1095462198509 Global-Ocean-Sampling_GS-31-01-01-1...    46   2.0    1
(EK239555) 1095460216525 Global-Ocean-Sampling_GS-31-01-01-1...    46   2.0    1
(EK198969) 1095460049244 Global-Ocean-Sampling_GS-31-01-01-1...    46   2.0    1
(EK139785) 1095454078587 Global-Ocean-Sampling_GS-31-01-01-1...    46   2.0    1
(EK120624) 1092963364271 Global-Ocean-Sampling_GS-31-01-01-1...    46   2.0    1
(EK115727) 1092963238669 Global-Ocean-Sampling_GS-31-01-01-1...    46   2.0    1
(EK076372) 1092961044067 Global-Ocean-Sampling_GS-31-01-01-1...    46   2.0    1
(EJ946641) 1093018917193 Global-Ocean-Sampling_GS-30-02-01-1...    46   2.0    1
(EJ884677) 1093018412052 Global-Ocean-Sampling_GS-30-02-01-1...    46   2.0    1
(EJ876625) 1093018373797 Global-Ocean-Sampling_GS-30-02-01-1...    46   2.0    1
(EJ863241) 1093018224796 Global-Ocean-Sampling_GS-30-02-01-1...    46   2.0    1
(EJ846589) 1093017858766 Global-Ocean-Sampling_GS-30-02-01-1...    46   2.0    1
(EJ760421) 1092963125316 Global-Ocean-Sampling_GS-30-02-01-1...    46   2.0    1
(EJ476111) 1095403443892 Global-Ocean-Sampling_GS-28-01-01-1...    46   2.0    1
(EJ219697) 1092351213192 Global-Ocean-Sampling_GS-27-01-01-1...    46   2.0    1
(EI296218) GM_WBc0020E12.r GM_WBc Glycine max genomic clone ...    46   2.0    1
(ED701840) GM_WBb0044L14.f GM_WBb Glycine max genomic clone ...    46   2.0    1
(DY887870) CeleSEQ4647 Cunninghamella elegans pBluescript (E...    46   2.0    1
(CN736706) 26RDBNT_UP_018_F11_21JAN2004_085 Brassica napus 2...    46   2.0    1
(BM681492) UI-E-EJ0-aij-g-13-0-UI.s1 UI-E-EJ0 Homo sapiens c...    46   2.0    1
(Z83335) S.pneumoniae dexB, cap1[A,B,C,D,E,F,G,H,I,J,K] gene...    46   2.0    1
(CR931632) Streptococcus pneumoniae strain 519/43 (serotype 1).    46   2.0    1
(CR926497) Streptococcus pneumoniae strain 519/43 (serotype ...    46   2.0    1
(CP000923) Thermoanaerobacter sp. X514, complete genome.           46   2.0    1
(CP000825) Prochlorococcus marinus str. MIT 9215, complete g...    46   2.0    1
(CP000746) Actinobacillus succinogenes 130Z, complete genome.      46   2.0    1
(AC233370) Solanum tuberosum chromosome 1 clone RH031N23, **...    40   2.0    5
(AC123191) Rattus norvegicus clone CH230-145J12, WORKING DRA...    38   2.1    4
(Z82073) Caenorhabditis elegans Cosmid W06D12.                     40   2.2    3
(AE014842) Plasmodium falciparum 3D7 chromosome 11 section 7...    36   2.3    8
(AC143356) Pan troglodytes BAC clone RP43-64A13 from chromos...    42   2.4    3
(AC126632) Rattus norvegicus clone CH230-440I11, WORKING DRA...    36   2.5    3
(AC176269) Strongylocentrotus purpuratus clone R3-3058A12, W...    38   2.7    5
(CU467965) Zebrafish DNA sequence *** SEQUENCING IN PROGRESS...    36   3.9    4
(AF063866) Melanoplus sanguinipes entomopoxvirus, complete g...    30   4.0    10
(AC103321) Rattus norvegicus clone CH230-44O6, *** SEQUENCIN...    36   4.2    4
(DY888366) CeleSEQ5268 Cunninghamella elegans pBluescript (E...    40   4.4    2
(DY887837) CeleSEQ4578 Cunninghamella elegans pBluescript (E...    40   4.4    2
(CR113564) Forward strand read from insert in 3'HPRT inserti...    40   4.8    2
(ER609221) 1093016297346 Global-Ocean-Sampling_GS-36-01-01-2...    42   4.8    2
(DX521068) GH_MBb0079P14f GH_MBb Gossypium hirsutum genomic ...    34   4.9    2
(EK360491) 1095468941306 Global-Ocean-Sampling_GS-31-01-01-1...    36   4.9    2
(EI431106) PV_GBa0023B13.f PV_GBa Phaseolus vulgaris genomic...    34   5.0    2
(AE014839) Plasmodium falciparum 3D7 chromosome 11 section 4...    32   5.7    10
(AC137704) Homo sapiens chromosome 11 clone RP13-824A24 map ...    36   7.3    4
(CP000398) Borrelia afzelii PKo plasmid lp34, complete seque...    36   7.6    3
(AC145979) Gallus gallus BAC clone CH261-10P22 from chromoso...    44   7.7    1
(CT025564) Mouse DNA sequence from clone RP24-123J6 on chrom...    44   7.7    1
(AC161266) Mus musculus BAC clone RP23-231B13 from chromosom...    44   7.7    1
(AC156574) Mus musculus BAC clone RP23-54L14 from chromosome...    44   7.7    1
(CR380957) Candida glabrata strain CBS138 chromosome K compl...    44   7.7    1
(AM432305) Vitis vinifera contig VV78X237792.9, whole genome...    44   7.7    1
(DL190605) Nicotiana Nucleic Acid Molecules and Uses Thereof.      44   7.7    1
(CS224946) Sequence 1261 from Patent WO2005111217.                 44   7.7    1
(CQ724532) Sequence 10466 from Patent WO02068579.                  44   7.7    1
(CQ335488) Sequence 9582 from Patent WO0157275.                    44   7.7    1
(CQ298717) Sequence 9822 from Patent WO0186003.                    44   7.7    1
(CQ261340) Sequence 9601 from Patent WO0157277.                    44   7.7    1
(CQ223369) Sequence 10208 from Patent WO0157273.                   44   7.7    1
(CQ176187) Sequence 7583 from Patent WO0157274.                    44   7.7    1
(CQ140020) Sequence 10042 from Patent WO0157276.                   44   7.7    1
(CQ101026) Sequence 9885 from Patent WO0157272.                    44   7.7    1
(AY449461) Oikopleura dioica clone BACOIKO005 4xj24, complet...    44   7.7    1
(AC117267) Dictyostelium discoideum chromosome 2 map 5836255...    44   7.7    1
(AL160492) Homo sapiens chromosome 17 sequence from PAC RPCI...    44   7.7    1
(AK293815) Homo sapiens cDNA FLJ60445 complete cds, highly s...    44   7.7    1
(AC124066) Homo sapiens chromosome 17, clone RP11-135L13, co...    44   7.7    1
(AC104533) Homo sapiens chromosome 19 clone LLNLR-276C7, com...    44   7.7    1
(AC004597) Homo sapiens chromosome 19, cosmid F20722, comple...    44   7.7    1
(AC135680) Rattus norvegicus clone CH230-91C9, *** SEQUENCIN...    44   7.7    1
(AC135093) Rattus norvegicus clone CH230-113A23, *** SEQUENC...    44   7.7    1
(AC127095) Rattus norvegicus clone CH230-75F6, *** SEQUENCIN...    44   7.7    1
(AC123077) Rattus norvegicus clone CH230-7J18, *** SEQUENCIN...    44   7.7    1
(AC120715) Rattus norvegicus clone CH230-115D12, *** SEQUENC...    44   7.7    1
(AC120090) Rattus norvegicus clone CH230-498I1, *** SEQUENCI...    44   7.7    1
(AC112619) Rattus norvegicus clone CH230-233I2, *** SEQUENCI...    44   7.7    1
(AC111496) Rattus norvegicus clone CH230-114H12, WORKING DRA...    44   7.7    1
(AC111303) Rattus norvegicus clone CH230-227E18, *** SEQUENC...    44   7.7    1
(AC110135) Rattus norvegicus clone CH230-51K24, *** SEQUENCI...    44   7.7    1
(AC103075) Rattus norvegicus clone CH230-187B6, *** SEQUENCI...    44   7.7    1
(AC097340) Rattus norvegicus clone CH230-81G10, WORKING DRAF...    44   7.7    1
(AC097026) Rattus norvegicus clone CH230-85M24, WORKING DRAF...    44   7.7    1
(AC094839) Rattus norvegicus clone CH230-6B1, *** SEQUENCING...    44   7.7    1
(AC036110) Homo sapiens chromosome 17 clone RP11-970O14 map ...    44   7.7    1
(CR606056) full-length cDNA clone CS0DI039YA09 of Placenta C...    44   7.7    1
(AK136465) Mus musculus adult male colon cDNA, RIKEN full-le...    44   7.7    1
(BH002881) BMBAC03J21T7_PSU Brugia malayi Genomic Bac Librar...    44   7.7    1
(ER291494) 1092343606454 Global-Ocean-Sampling_GS-34-01-01-1...    44   7.7    1
(EK406012) 1095505002839 Global-Ocean-Sampling_GS-31-01-01-1...    44   7.7    1
(EK362844) 1095469299609 Global-Ocean-Sampling_GS-31-01-01-1...    44   7.7    1
(EK362598) 1095469199187 Global-Ocean-Sampling_GS-31-01-01-1...    44   7.7    1
(EK333463) 1095467032754 Global-Ocean-Sampling_GS-31-01-01-1...    44   7.7    1
(EK301277) 1095462365532 Global-Ocean-Sampling_GS-31-01-01-1...    44   7.7    1
(EK000641) 1093025054052 Global-Ocean-Sampling_GS-30-02-01-1...    44   7.7    1
(EK000122) 1093025036830 Global-Ocean-Sampling_GS-30-02-01-1...    44   7.7    1
(EJ970660) 1093022078581 Global-Ocean-Sampling_GS-30-02-01-1...    44   7.7    1
(EJ945440) 1093018910896 Global-Ocean-Sampling_GS-30-02-01-1...    44   7.7    1
(EJ593692) 1092961065980 Global-Ocean-Sampling_GS-29-01-01-1...    44   7.7    1
(EJ542993) 1092955412900 Global-Ocean-Sampling_GS-29-01-01-1...    44   7.7    1
(EJ471001) 1095403410855 Global-Ocean-Sampling_GS-28-01-01-1...    44   7.7    1
(EJ257335) 1095349016996 Global-Ocean-Sampling_GS-27-01-01-1...    44   7.7    1
(EI936059) VUH2-70D8TV VUUBBa (VUH2) Vigna unguiculata genom...    44   7.7    1
(EI810910) MUGQ_CH252P259M08Sp6_CN530_020 CHORI-252 Vervet M...    44   7.7    1
(EI171761) DH046C19_F1.ab1 Brachypodium distachyon Bd21 Hind...    44   7.7    1
(ED824874) MUGQ_CH252P155A03Sp6_CN179_016 CHORI-252 Vervet M...    44   7.7    1
(ED484869) MUGQ_CH252P113L22Sp6_CN66_085 CHORI-252 Vervet Mo...    44   7.7    1
(ED483990) MUGQ_CH252P112B07T7_CN64_032 CHORI-252 Vervet Mon...    44   7.7    1
(CE709493) tigr-gss-dog-17000369450376 Dog Library Canis lup...    44   7.7    1
(CC228906) CH261-45O6_RM1.1 CH261 Gallus gallus genomic clon...    44   7.7    1
(BH616270) BMBAC307D01SP6_PSU Brugia malayi Genomic Bac Libr...    44   7.7    1
(EG649803) D98-AF1 Ethylene Induced Tobacco Leaf cDNA Librar...    44   7.7    1
(EC936682) WIN0513.C21_D04 Cab Sauv flower, leaf and root no...    44   7.7    1
(DW488753) GH_RMIRS_071_C08_F Cotton Normalized Library rand...    44   7.7    1
(DV605739) EST1208735 Glossina morsitans morsitans Fat body ...    44   7.7    1
(DT009372) VVH036A02_744569 CabSau Flower Nectary Stage 25 (...    44   7.7    1
(DB895842) Populus nigra mRNA, clone: PnFL2-017_D17, 3'end.        44   7.7    1
(DB772445) Apis mellifera head cDNA, RIKEN full-length enric...    44   7.7    1
(CN479141) UI-CF-FN0-afv-m-14-0-UI.s1 UI-CF-FN0 Homo sapiens...    44   7.7    1
(CN306145) 17000532619636 GRN_ES Homo sapiens cDNA 5', mRNA ...    44   7.7    1
(CN007250) CSECS145F09_NECu0025 CabSau Flower Nectary Stage ...    44   7.7    1
(CK819721) if23e09.x5 Melton Normalized Human Islet 4 N4-HIS...    44   7.7    1
(CF528564) UI-1-BC1-aja-c-12-0-UI.s1 NCI_CGAP_Pl2 Homo sapie...    44   7.7    1
(CD107270) AGENCOURT_13979994 NIH_MGC_179 Homo sapiens cDNA ...    44   7.7    1
(CA424618) UI-H-FE1-bdx-i-21-0-UI.s1 NCI_CGAP_FE1 Homo sapie...    44   7.7    1
(AI818169) wk42a01.x1 NCI_CGAP_Pr22 Homo sapiens cDNA clone ...    44   7.7    1
(BX389591) human full-length cDNA 5-PRIME end of clone CS0DI...    44   7.7    1
(BX389590) human full-length cDNA 5-PRIME end of clone CS0DI...    44   7.7    1
(BX389589) human full-length cDNA 5-PRIME end of clone CS0DI...    44   7.7    1
(BU753424) UI-1-BC1-ajh-e-01-0-UI.s1 NCI_CGAP_Pl2 Homo sapie...    44   7.7    1
(BU684397) UI-CF-EN0-aco-f-12-0-UI.s1 UI-CF-EN0 Homo sapiens...    44   7.7    1
(AI347473) qo98d02.x1 NCI_CGAP_Kid5 Homo sapiens cDNA clone ...    44   7.7    1
(AI300844) qn37f01.x1 NCI_CGAP_Kid5 Homo sapiens cDNA clone ...    44   7.7    1
(AI204539) qf56h07.x1 Soares_testis_NHT Homo sapiens cDNA cl...    44   7.7    1
(AI129142) ox86h03.s1 Soares_senescent_fibroblasts_NbHSF Hom...    44   7.7    1
(AI079173) oy44f08.s1 Soares_parathyroid_tumor_NbHPA Homo sa...    44   7.7    1
(AI050894) ow31g11.s1 Soares_parathyroid_tumor_NbHPA Homo sa...    44   7.7    1
(BM979596) UI-CF-DU1-adt-i-09-0-UI.s1 UI-CF-DU1 Homo sapiens...    44   7.7    1
(BM976857) UI-CF-EN1-adb-f-13-0-UI.s1 UI-CF-EN1 Homo sapiens...    44   7.7    1
(BM129507) if23e09.x1 Melton Normalized Human Islet 4 N4-HIS...    44   7.7    1
(BJ334887) Dictyostelium discoideum cDNA clone:dda48m02, 5' ...    44   7.7    1
(AA906546) ol20f11.s1 Soares_NFL_T_GBC_S1 Homo sapiens cDNA ...    44   7.7    1
(BE677745) 7f59f04.x1 Soares_NSF_F8_9W_OT_PA_P_S1 Homo sapie...    44   7.7    1
(BB588725) Mus musculus adult male hypothalamus cDNA, RIKEN ...    44   7.7    1
(W44801) zb98f10.s1 Soares_parathyroid_tumor_NbHPA Homo sapi...    44   7.7    1
(T69563) yc44a07.s1 Stratagene liver (#937224) Homo sapiens ...    44   7.7    1
(AW965536) EST377609 MAGE resequences, MAGI Homo sapiens cDN...    44   7.7    1
(EY098388) CAZI23711.fwd CAZI Artemisia annua normalized lea...    44   7.7    1
(AW300551) xs66h08.x1 NCI_CGAP_Kid11 Homo sapiens cDNA clone...    44   7.7    1
(AW294805) UI-H-BI2-ahi-c-11-0-UI.s1 NCI_CGAP_Sub4 Homo sapi...    44   7.7    1
(AW292166) UI-H-BI2-agx-h-03-0-UI.s1 NCI_CGAP_Sub4 Homo sapi...    44   7.7    1
(AW276624) xr17d05.x1 NCI_CGAP_Lu28 Homo sapiens cDNA clone ...    44   7.7    1
(AW205236) UI-H-BI1-aeo-h-02-0-UI.s1 NCI_CGAP_Sub3 Homo sapi...    44   7.7    1
(AW080434) xe53f10.x1 NCI_CGAP_Ut3 Homo sapiens cDNA clone I...    44   7.7    1
(AA335386) EST39813 Epididymus Homo sapiens cDNA 5' end, mRN...    44   7.7    1
(AA256668) zr82h02.s1 Soares_NhHMPu_S1 Homo sapiens cDNA clo...    44   7.7    1
(AA243762) zr67c04.r1 Soares_NhHMPu_S1 Homo sapiens cDNA clo...    44   7.7    1
(AA243643) zr67c04.s1 Soares_NhHMPu_S1 Homo sapiens cDNA clo...    44   7.7    1
(CP000263) Buchnera aphidicola str. Cc (Cinara cedri), compl...    44   7.7    1
(AM424812) Vitis vinifera contig VV78X036776.7, whole genome...    42   8.7    2
(AP000826) Homo sapiens genomic DNA, chromosome 11 clone:RP1...    40   9.4    3
(BM276268) PfESToaa72f03.y1 Plasmodium falciparum 3D7 gameto...    36   9.9    2

>(C90696) Dictyostelium discoideum slug cDNA, clone SSJ634.
          Length = 596

 Score =  303 bits (153), Expect(3) = 0.0
 Identities = 153/153 (100%)
 Strand = Plus / Plus


Query: 606 agaaagggttccttctaaaaaactaaagcctaaagccaaaccacgaccaggtggatgtag 665
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 443 agaaagggttccttctaaaaaactaaagcctaaagccaaaccacgaccaggtggatgtag 502


Query: 666 tatatgcaagacccaagaaactccttactggagaaaaggaaaagatggtgataaaaccgt 725
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 503 tatatgcaagacccaagaaactccttactggagaaaaggaaaagatggtgataaaaccgt 562


Query: 726 ttatttatgtaatgcttgtggtttacaaattta 758
           |||||||||||||||||||||||||||||||||
Sbjct: 563 ttatttatgtaatgcttgtggtttacaaattta 595

 Score =  268 bits (135), Expect(3) = 0.0
 Identities = 135/135 (100%)
 Strand = Plus / Plus


Query: 206 ctaacagaaatttattatacaaaactattctgaatgatatagaaaatagtttacaatcat 265
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 43  ctaacagaaatttattatacaaaactattctgaatgatatagaaaatagtttacaatcat 102


Query: 266 taataaaacctcaagaattaacgaatctattagaagataatattaataaattaaaagaac 325
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 103 taataaaacctcaagaattaacgaatctattagaagataatattaataaattaaaagaac 162


Query: 326 ttgatggagtgcaac 340
           |||||||||||||||
Sbjct: 163 ttgatggagtgcaac 177

 Score =  262 bits (132), Expect(3) = 0.0
 Identities = 132/132 (100%)
 Strand = Plus / Plus


Query: 438 taatgttataacaccaaattcaaatttaaagcaaacactttctccatctgtattaattga 497
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 275 taatgttataacaccaaattcaaatttaaagcaaacactttctccatctgtattaattga 334


Query: 498 acatttaaatctttttggaaatgaaaattttgaagaaggggatgatgaagaagaaactag 557
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 335 acatttaaatctttttggaaatgaaaattttgaagaaggggatgatgaagaagaaactag 394


Query: 558 tagtgattcaga 569
           ||||||||||||
Sbjct: 395 tagtgattcaga 406

Lambda     K      H
    1.37    0.711     1.31

Matrix: blastn matrix:1 -3
Number of Sequences: 102105510
Number of Hits to DB: 769,609,373
Number of extensions: 51289989
Number of successful extensions: 4486989
Number of sequences better than 10.0: 198
Length of query: 758
Length of database: 101,790,757,118
Length adjustment: 24
Effective length of query: 734
Effective length of database: 99,340,224,878
Effective search space: 72915725060452
Effective search space used: 72915725060452
X1: 11 (21.8 bits)
S2: 22 (44.1 bits)
protein update 2009. 7.18
Homology vs Protein 
Query= Contig-U01883-1 (Contig-U01883-1Q) /CSM_Contig/Contig-U01883-1Q.Seq.d
         (758 letters)

Database: nrp_B
           3,236,559 sequences; 1,051,180,864 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

(Q54WY0) RecName: Full=GATA zinc finger domain-containing protei...   250   4e-65
U70043_1(U70043|pid:none) Aspergillus nidulans NsdD (nsdD) gene,...    52   2e-05
AP007161_640(AP007161|pid:none) Aspergillus oryzae RIB40 genomic...    52   2e-05
AM920428_1535(AM920428|pid:none) Penicillium chrysogenum Wiscons...    50   6e-05
(Q54L80) RecName: Full=GATA zinc finger domain-containing protei...    50   1e-04
AL670009_23(AL670009|pid:none) Neurospora crassa DNA linkage gro...    47   5e-04
(Q54FV1) RecName: Full=GATA zinc finger domain-containing protei...    47   6e-04
(Q75JZ0) RecName: Full=GATA zinc finger domain-containing protei...    47   6e-04
CR382132_225(CR382132|pid:none) Yarrowia lipolytica strain CLIB1...    46   0.001
(Q54TE3) RecName: Full=GATA zinc finger domain-containing protei...    45   0.002
(Q9SKN6) RecName: Full=Putative GATA transcription factor 7;  &A...    45   0.002
AF082072_2(AF082072|pid:none) Emericella nidulans ABC transporte...    45   0.002
CP000582_136(CP000582|pid:none) Ostreococcus lucimarinus CCE9901...    45   0.002
CR382138_1228(CR382138|pid:none) Debaryomyces hansenii chromosom...    44   0.004
(Q75JZ1) RecName: Full=GATA zinc finger domain-containing protei...    44   0.004
CP000585_217(CP000585|pid:none) Ostreococcus lucimarinus CCE9901...    44   0.004
(Q54V32) RecName: Full=GATA zinc finger domain-containing protei...    44   0.004
CR855197_1(CR855197|pid:none) Oryza sativa genomic DNA, chromoso...    44   0.005
CR954207_324(CR954207|pid:none) Ostreococcus tauri strain OTTH05...    44   0.005
AP007167_43(AP007167|pid:none) Aspergillus oryzae RIB40 genomic ...    44   0.005
AP008210_1450(AP008210|pid:none) Oryza sativa (japonica cultivar...    44   0.005
AL590442_26(AL590442|pid:none) chromosome II of strain GB-M1 of ...    44   0.005
AC147428_8(AC147428|pid:none) Medicago truncatula clone mth2-34i...    44   0.007
AL590448_139(AL590448|pid:none) chromosome VIII of strain GB-M1 ...    44   0.007
FM178799_1(FM178799|pid:none) Phycomyces blakesleeanus madB gene...    44   0.007
FN392322_654(FN392322|pid:none) Pichia pastoris GS115 chromosome...    43   0.009
EU963121_1(EU963121|pid:none) Zea mays clone 257954 unknown mRNA.      43   0.009
AC146720_8(AC146720|pid:none) Medicago truncatula clone mth2-17n...    43   0.009
CP000587_66(CP000587|pid:none) Ostreococcus lucimarinus CCE9901 ...    43   0.009
EU958035_1(EU958035|pid:none) Zea mays clone 1667273 unknown mRNA.     43   0.009
AC128644_13(AC128644|pid:none) Oryza sativa (japonica cultivar-g...    43   0.009
(Q54KX0) RecName: Full=GATA zinc finger domain-containing protei...    43   0.009
(Q54NM5) RecName: Full=GATA zinc finger domain-containing protei...    43   0.009
FM992689_206(FM992689|pid:none) Candida dubliniensis CD36 chromo...    43   0.009
S69206(S69206)regulator protein white collar 1 - Neurospora crassa     43   0.012
(Q01371) RecName: Full=White collar 1 protein;          Short=WC...    43   0.012
AM920436_367(AM920436|pid:none) Penicillium chrysogenum Wisconsi...    43   0.012
(Q54UG8) RecName: Full=GATA zinc finger domain-containing protei...    43   0.012
(B0G188) RecName: Full=GATA zinc finger domain-containing protei...    42   0.016
AF515628_1(AF515628|pid:none) Emericella nidulans GATA-factor (l...    42   0.016
BT060950_1(BT060950|pid:none) Zea mays full-length cDNA clone ZM...    42   0.016
EU969352_1(EU969352|pid:none) Zea mays clone 329022 GATA zinc fi...    42   0.016
CR382121_56(CR382121|pid:none) Kluyveromyces lactis strain NRRL ...    42   0.016
CR382130_824(CR382130|pid:none) Yarrowia lipolytica strain CLIB1...    42   0.016
AP008218_348(AP008218|pid:none) Oryza sativa (japonica cultivar-...    42   0.016
(Q8LC59) RecName: Full=GATA transcription factor 22;  &AB493761_...    42   0.021
CP001323_604(CP001323|pid:none) Micromonas sp. RCC299 chromosome...    42   0.021
AY628432_1(AY628432|pid:none) Trichoderma atroviride blue light ...    42   0.021
AF007270_14(AF007270|pid:none) Arabidopsis thaliana BAC F2P16, c...    42   0.021
CP000587_339(CP000587|pid:none) Ostreococcus lucimarinus CCE9901...    42   0.027
AE016819_746(AE016819|pid:none) Ashbya gossypii (= Eremothecium ...    42   0.027
(Q54HA4) RecName: Full=GATA zinc finger domain-containing protei...    42   0.027
(Q54TM6) RecName: Full=GATA zinc finger domain-containing protei...    42   0.027
(Q54X31) RecName: Full=Putative GATA zinc finger domain-containi...    42   0.027
(P0C6A0) RecName: Full=GATA-like protein 1;          Short=GLP-1;      42   0.027
CR382137_291(CR382137|pid:none) Debaryomyces hansenii strain CBS...    42   0.027
(P78714) RecName: Full=White collar 2 protein;          Short=WC...    42   0.027
BX088700_80(BX088700|pid:none) DNA centromeric region sequence f...    41   0.036
AB273633_1(AB273633|pid:none) Bipolaris oryzae BLR1 gene for blu...    41   0.036
AE017347_189(AE017347|pid:none) Cryptococcus neoformans var. neo...    41   0.036
AP007150_250(AP007150|pid:none) Aspergillus oryzae RIB40 genomic...    41   0.036
CR382138_450(CR382138|pid:none) Debaryomyces hansenii strain CBS...    41   0.036
AC116977_1(AC116977|pid:none) Dictyostelium discoideum chromosom...    41   0.046
CP001326_323(CP001326|pid:none) Micromonas sp. RCC299 chromosome...    41   0.046
CP000496_378(CP000496|pid:none) Pichia stipitis CBS 6054 chromos...    41   0.046
(Q55GK0) RecName: Full=GATA zinc finger domain-containing protei...    41   0.046
DQ229145_2(DQ229145|pid:none) Phycomyces blakesleeanus MAP kinas...    41   0.046
(Q550D5) RecName: Full=Transcription factor stalky; AltName: Ful...    41   0.046
AM920435_838(AM920435|pid:none) Penicillium chrysogenum Wisconsi...    41   0.046
AY084525_1(AY084525|pid:none) Arabidopsis thaliana clone 110655 ...    41   0.046
AP003284_18(AP003284|pid:none) Oryza sativa Japonica Group genom...    41   0.046
(Q8LG10) RecName: Full=GATA transcription factor 16;  &AY063926_...    41   0.046
AY065074_1(AY065074|pid:none) Arabidopsis thaliana unknown prote...    40   0.061
DQ856314_1(DQ856314|pid:none) Penicillium marneffei AreA (areA) ...    40   0.061
(Q5HZ36) RecName: Full=GATA transcription factor 24;  &AB020747_...    40   0.061
FM992688_1082(FM992688|pid:none) Candida dubliniensis CD36 chrom...    40   0.061
AB124838_1(AB124838|pid:none) Drosophila melanogaster dGATAe mRN...    40   0.061
BT070097_1(BT070097|pid:none) Zea mays full-length cDNA clone ZM...    40   0.061
AB054995_1(AB054995|pid:none) Drosophila melanogaster mRNA for G...    40   0.061
AB446463_1(AB446463|pid:none) Lentinula edodes phrB mRNA for whi...    40   0.061
EU966045_1(EU966045|pid:none) Zea mays clone 291148 unknown mRNA.      40   0.061
EF087570_1(EF087570|pid:none) Picea sitchensis clone WS02751_L09...    40   0.061
AB054996_1(AB054996|pid:none) Drosophila melanogaster dGATAe mRN...    40   0.061
BT067067_1(BT067067|pid:none) Zea mays full-length cDNA clone ZM...    40   0.061
BT055755_1(BT055755|pid:none) Zea mays full-length cDNA clone ZM...    40   0.061
AM040843_1(AM040843|pid:none) Mucor circinelloides wc-1c gene fo...    40   0.061
AP004729_5(AP004729|pid:none) Oryza sativa Japonica Group genomi...    40   0.079
(P19212) RecName: Full=Nitrogen catabolic enzyme regulatory prot...    40   0.079
FM992688_484(FM992688|pid:none) Candida dubliniensis CD36 chromo...    40   0.079
AB364680_1(AB364680|pid:none) Arthroderma vanbreuseghemii tnr mR...    40   0.079
AC146329_26(AC146329|pid:none) Medicago truncatula clone mth2-5i...    40   0.079
EU955555_1(EU955555|pid:none) Zea mays clone 1536888 GATA transc...    40   0.079
BT033679_1(BT033679|pid:none) Zea mays full-length cDNA clone ZM...    40   0.079
T05288(T05288;T52105)GATA-binding transcription factor homolog 3...    40   0.079
M33956_1(M33956|pid:none) N.crassa nitrogen catabolic enzyme reg...    40   0.079
AE016817_649(AE016817|pid:none) Ashbya gossypii (= Eremothecium ...    40   0.079
AK241643_1(AK241643|pid:none) Oryza sativa Japonica Group cDNA, ...    40   0.079
AY099790_1(AY099790|pid:none) Arabidopsis thaliana GATA transcri...    40   0.079
EF148510_1(EF148510|pid:none) Populus trichocarpa x Populus delt...    40   0.079
BT051382_1(BT051382|pid:none) Medicago truncatula clone MTYF1_F2...    40   0.079
AM470429_1(AM470429|pid:none) Vitis vinifera contig VV78X191569....    40   0.079
AY823264_1(AY823264|pid:none) Hypocrea jecorina white collar 1 (...    40   0.10
AM778551_1(AM778551|pid:none) Fusarium fujikuroi wcoA gene for w...    40   0.10
AM040841_1(AM040841|pid:none) Mucor circinelloides wc-1a gene fo...    40   0.10
AB107691_1(AB107691|pid:none) Nicotiana tabacum AGP3 mRNA for AG...    40   0.10
(O65515) RecName: Full=GATA transcription factor 12;  &AL022141_...    40   0.10
AY628431_1(AY628431|pid:none) Trichoderma atroviride blue light ...    40   0.10
(Q9M1U2) RecName: Full=GATA transcription factor 8;  &AL138649_1...    39   0.14
(O82632) RecName: Full=GATA transcription factor 11;          Sh...    39   0.14
BC122298_1(BC122298|pid:none) Danio rerio zgc:153462, mRNA (cDNA...    39   0.14
(Q01168) RecName: Full=Nitrogen regulatory protein NUT1;  &U6029...    39   0.14
(Q92269) RecName: Full=Nitrogen regulatory protein nrfA;  &U5313...    39   0.14
(Q54US7) RecName: Full=GATA zinc finger domain-containing protei...    39   0.14
EU967675_1(EU967675|pid:none) Zea mays clone 305252 unknown mRNA.      39   0.14
AP003376_20(AP003376|pid:none) Oryza sativa Japonica Group genom...    39   0.14
CR380958_128(CR380958|pid:none) Candida glabrata strain CBS138 c...    39   0.14
(O13508) RecName: Full=Nitrogen regulatory protein areA; AltName...    39   0.14
BT054607_1(BT054607|pid:none) Zea mays full-length cDNA clone ZM...    39   0.14
AC034258_5(AC034258|pid:none) Oryza sativa chromosome 10 BAC OSJ...    39   0.18
AF148539_1(AF148539|pid:none) Aspergillus parasiticus major nitr...    39   0.18
FM992692_391(FM992692|pid:none) Candida dubliniensis CD36 chromo...    39   0.18
CR382135_230(CR382135|pid:none) Debaryomyces hansenii strain CBS...    39   0.18
AM232660_1(AM232660|pid:none) Debaryomyces hansenii GZF3 gene fo...    39   0.18
(Q01582) RecName: Full=Nitrogen regulatory protein areA;        ...    39   0.18
S51493(S51493)major nitrogen regulation protein - Penicillium ch...    39   0.18
AE017341_190(AE017341|pid:none) Cryptococcus neoformans var. neo...    39   0.18
AC096781_12(AC096781|pid:none) Oryza sativa chromosome 10 BAC OS...    39   0.18
AF320305_1(AF320305|pid:none) Aspergillus oryzae AreA (areA) gen...    39   0.18
AL049521_2(AL049521|pid:none) S.pombe chromosome III cosmid c1902.     39   0.18
(Q10280) RecName: Full=Transcription factor gaf1;          Short...    39   0.18
(Q55C49) RecName: Full=GATA zinc finger domain-containing protei...    39   0.18
(O13415) RecName: Full=Nitrogen regulatory protein areA;  &AJ002...    39   0.18
DQ387858_1(DQ387858|pid:none) Fusarium oxysporum f. sp. lycopers...    39   0.23
CR382136_130(CR382136|pid:none) Debaryomyces hansenii strain CBS...    39   0.23
EU962233_1(EU962233|pid:none) Zea mays clone 241131 GATA zinc fi...    39   0.23
(O49743) RecName: Full=GATA transcription factor 4;          Sho...    39   0.23
(O49741) RecName: Full=GATA transcription factor 2;          Sho...    39   0.23
AC069300_10(AC069300|pid:none) Oryza sativa chromosome 10 BAC OS...    39   0.23
BT068804_1(BT068804|pid:none) Zea mays full-length cDNA clone ZM...    39   0.23
(Q6QPM2) RecName: Full=GATA transcription factor 21;  &AB493721_...    39   0.23
AY079198_1(AY079198|pid:none) Raja eglanteria GATA-3 mRNA, compl...    39   0.23
M80547_1(M80547|pid:none) Ustilago maydis URBS1 protein (urbS1) ...    39   0.23
AY086746_1(AY086746|pid:none) Arabidopsis thaliana clone 27213 m...    39   0.23
X73111_1(X73111|pid:none) Nicotiana tabacum mRNA for GATA-1 zinc...    39   0.23
BT065232_1(BT065232|pid:none) Zea mays full-length cDNA clone ZM...    39   0.23
AY530746_1(AY530746|pid:none) Arabidopsis thaliana At4g36620 gen...    39   0.23
AY168017_1(AY168017|pid:none) Colletotrichum lindemuthianum majo...    39   0.23
AY195740_1(AY195740|pid:none) Asterina miniata GATA transcriptio...    39   0.23
BT070054_1(BT070054|pid:none) Zea mays full-length cDNA clone ZM...    39   0.23
CP000497_408(CP000497|pid:none) Pichia stipitis CBS 6054 chromos...    39   0.23
(Q54L83) RecName: Full=GATA zinc finger domain-containing protei...    39   0.23
AE017343_639(AE017343|pid:none) Cryptococcus neoformans var. neo...    39   0.23
AC098571_17(AC098571|pid:none) Oryza sativa (japonica cultivar-g...    38   0.30
EU967444_1(EU967444|pid:none) Zea mays clone 303140 GATA zinc fi...    38   0.30
AK157939_1(AK157939|pid:none) Mus musculus adult inner ear cDNA,...    38   0.30
AK227493_1(AK227493|pid:none) Arabidopsis thaliana mRNA for GATA...    38   0.30
EU220030_1(EU220030|pid:none) Ajellomyces capsulatus siderophore...    38   0.30
EU967850_1(EU967850|pid:none) Zea mays clone 306547 GATA transcr...    38   0.30
AL606587_7(AL606587|pid:none) Oryza sativa genomic DNA, chromoso...    38   0.30
(Q8LAU9) RecName: Full=GATA transcription factor 1;          Sho...    38   0.30
AY135715_1(AY135715|pid:none) Phaeosphaeria nodorum AreA protein...    38   0.30
AY095095_1(AY095095|pid:none) Drosophila melanogaster SD02611 fu...    38   0.30
(P23771) RecName: Full=Trans-acting T-cell-specific transcriptio...    38   0.30
AF520973_1(AF520973|pid:none) Candida albicans transcription fac...    38   0.30
AB463676_1(AB463676|pid:none) Synthetic construct DNA, clone: pF...    38   0.30
AE014297_2213(AE014297|pid:none) Drosophila melanogaster chromos...    38   0.30
AK155549_1(AK155549|pid:none) Mus musculus NOD-derived CD11c +ve...    38   0.30
X55037_1(X55037|pid:none) H.sapiens GATA-3 mRNA.                       38   0.30
(P52168) RecName: Full=GATA-binding factor A; AltName: Full=Tran...    38   0.30
(Q92259) RecName: Full=GATA factor SREP;  &AM920436_564(AM920436...    38   0.39
AE017345_130(AE017345|pid:none) Cryptococcus neoformans var. neo...    38   0.39
(Q10134) RecName: Full=Iron-sensing transcription factor 1; AltN...    38   0.39
CU928180_268(CU928180|pid:none) Kluyveromyces thermotolerans str...    38   0.39
CU928181_357(CU928181|pid:none) Zygosaccharomyces rouxii strain ...    38   0.39
AK157625_1(AK157625|pid:none) Mus musculus activated spleen cDNA...    38   0.39
A39794(A39794;S16326;S15027;A41148;S16155) transcription factor ...    38   0.39
CU633872_202(CU633872|pid:none) Podospora anserina genomic DNA c...    38   0.39
(P23825) RecName: Full=GATA-binding factor 3;          Short=GAT...    38   0.39
(P23772) RecName: Full=Trans-acting T-cell-specific transcriptio...    38   0.39
L29051_1(L29051|pid:none) Schizosaccharomyces pombe GATA-binding...    38   0.39
AY024364_1(AY024364|pid:none) Rattus norvegicus GATA-3 mRNA, com...    38   0.39
AY891238_1(AY891238|pid:none) Synthetic construct Homo sapiens c...    38   0.39
AB107693_1(AB107693|pid:none) Nicotiana tabacum AGP5 mRNA for AG...    37   0.51
AC152422_5(AC152422|pid:none) Medicago truncatula clone mth2-48d...    37   0.51
CR380958_292(CR380958|pid:none) Candida glabrata strain CBS138 c...    37   0.51
EU972972_1(EU972972|pid:none) Zea mays clone 390973 unknown mRNA.      37   0.51
AY699608_1(AY699608|pid:none) Colletotrichum gloeosporioides glo...    37   0.51
(O94720) RecName: Full=GATA zinc finger domain-containing protei...    37   0.51
(Q54L72) RecName: Full=GATA zinc finger domain-containing protei...    37   0.51
CU928171_44(CU928171|pid:none) Kluyveromyces thermotolerans stra...    37   0.67
FN357326_34(FN357326|pid:none) Schistosoma mansoni genome sequen...    37   0.67
(Q9SV30) RecName: Full=GATA transcription factor 10;          Sh...    37   0.67
CR382126_919(CR382126|pid:none) Kluyveromyces lactis strain NRRL...    37   0.67
FJ615537_1(FJ615537|pid:none) Branchiostoma floridae transcripti...    37   0.67
AC148757_3(AC148757|pid:none) Medicago truncatula clone mth2-57e...    37   0.67
(Q07928) RecName: Full=Protein GAT3;  &AY558530_1(AY558530|pid:n...    37   0.67
FJ615538_1(FJ615538|pid:none) Branchiostoma floridae transcripti...    37   0.67
CR382126_1080(CR382126|pid:none) Kluyveromyces lactis strain NRR...    37   0.67
AK101421_1(AK101421|pid:none) Oryza sativa Japonica Group cDNA c...    37   0.67
CP000588_205(CP000588|pid:none) Ostreococcus lucimarinus CCE9901...    37   0.67
CU928178_141(CU928178|pid:none) Zygosaccharomyces rouxii strain ...    37   0.67
AY465174_1(AY465174|pid:none) Nematostella vectensis GATA transc...    37   0.88
CR382126_738(CR382126|pid:none) Kluyveromyces lactis strain NRRL...    37   0.88
AY196328_1(AY196328|pid:none) Asterina miniata GATA transcriptio...    37   0.88
AB107690_1(AB107690|pid:none) Nicotiana tabacum AGP2 mRNA for AG...    37   0.88
CU633899_522(CU633899|pid:none) Podospora anserina genomic DNA c...    37   0.88
B48099(B48099)transcription factor GATA-2, retinoic acid-inducib...    37   0.88
AF077675_1(AF077675|pid:none) Strongylocentrotus purpuratus dev-...    37   0.88
FJ710596_1(FJ710596|pid:none) Rhagoletis juglandis clone Rjug_pn...    36   1.1
FJ710555_1(FJ710555|pid:none) Bactrocera dorsalis clone Bdor_pnr...    36   1.1
(P23773) RecName: Full=GATA-binding factor 3; AltName: Full=Tran...    36   1.1
FJ710546_2(FJ710546|pid:none) Bactrocera cucurbitae clone Bcuc_p...    36   1.1
CR382137_78(CR382137|pid:none) Debaryomyces hansenii strain CBS7...    36   1.1
CU638744_471(CU638744|pid:none) Podospora anserina genomic DNA c...    36   1.1
FJ710571_1(FJ710571|pid:none) Ceratitis capitata clone Ccap_pnrf...    36   1.1
DQ536171_1(DQ536171|pid:none) Populus trichocarpa clone 19012879...    36   1.1
AP007159_626(AP007159|pid:none) Aspergillus oryzae RIB40 genomic...    36   1.1
AF345897_1(AF345897|pid:none) Rattus norvegicus transcription fa...    36   1.5
AK004551_1(AK004551|pid:none) Mus musculus adult male lung cDNA,...    36   1.5
(Q924Y4) RecName: Full=Endothelial transcription factor GATA-2; ...    36   1.5
BC107010_1(BC107010|pid:none) Mus musculus GATA binding protein ...    36   1.5
AY891805_1(AY891805|pid:none) Synthetic construct Homo sapiens c...    36   1.5
BC116537_1(BC116537|pid:none) Danio rerio GATA-binding protein 5...    36   1.5
AY251012_1(AY251012|pid:none) Sus scrofa transcription factor GA...    36   1.5
CU928165_116(CU928165|pid:none) Kluyveromyces thermotolerans str...    36   1.5
BC093138_1(BC093138|pid:none) Danio rerio GATA-binding protein 5...    36   1.5
BC108544_1(BC108544|pid:none) Xenopus laevis XGATA-2 protein, mR...    36   1.5
(Q1L8G7) RecName: Full=GATA zinc finger domain-containing protei...    36   1.5
CR382131_236(CR382131|pid:none) Yarrowia lipolytica strain CLIB1...    36   1.5
AF087130_1(AF087130|pid:none) Neurospora crassa siderophore regu...    36   1.5
(P23769) RecName: Full=Endothelial transcription factor GATA-2; ...    36   1.5
(P23770) RecName: Full=GATA-binding factor 2;          Short=GAT...    36   1.5
AB302070_1(AB302070|pid:none) Carassius auratus langsdorfii GATA...    36   1.5
AB500940_1(AB500940|pid:none) Polypterus senegalus gata5 mRNA fo...    36   1.5
AK314826_1(AK314826|pid:none) Homo sapiens cDNA, FLJ95705, highl...    36   1.5
AJ242515_1(AJ242515|pid:none) Danio rerio mRNA for transcription...    36   1.5
AY177678_1(AY177678|pid:none) Marmota monax GATA-binding protein...    35   2.0
CR382129_854(CR382129|pid:none) Yarrowia lipolytica strain CLIB1...    35   2.0
BC124483_1(BC124483|pid:none) Danio rerio GATA-binding protein 1...    35   2.0
AB429307_1(AB429307|pid:none) Cyprinus carpio gata1 mRNA for GAT...    35   2.0
AF346837_1(AF346837|pid:none) Xenopus laevis atypical GATA prote...    35   2.0
AP003329_17(AP003329|pid:none) Oryza sativa Japonica Group genom...    35   2.0
(Q9UHF7) RecName: Full=Zinc finger transcription factor Trps1; A...    35   2.0
AF183810_1(AF183810|pid:none) Homo sapiens zinc finger transcrip...    35   2.0
AB302073_1(AB302073|pid:none) Carassius auratus langsdorfii GATA...    35   2.0
CT737163_1(CT737163|pid:none) Zebrafish DNA sequence from clone ...    35   2.0
BT041227_1(BT041227|pid:none) Zea mays full-length cDNA clone ZM...    35   2.0
FM992691_518(FM992691|pid:none) Candida dubliniensis CD36 chromo...    35   2.0
BT040389_1(BT040389|pid:none) Zea mays full-length cDNA clone ZM...    35   2.0
EU972328_1(EU972328|pid:none) Zea mays clone 379713 GATA transcr...    35   2.0
EU964147_1(EU964147|pid:none) Zea mays clone 276193 hypothetical...    35   2.0
(Q90ZS6) RecName: Full=Zinc finger transcription factor Trps1;  ...    35   2.0
BC099962_1(BC099962|pid:none) Mus musculus trichorhinophalangeal...    35   2.0
AK142355_1(AK142355|pid:none) Mus musculus 13 days embryo lung c...    35   2.0
E88640(E88640)protein F55A8.1 [imported] - Caenorhabditis elegans      35   2.6
EF651790_1(EF651790|pid:none) Capitella sp. I ECS-2004 GATA-bind...    35   2.6
Z68221_1(Z68221|pid:none) Caenorhabditis elegans Cosmid W09C2, c...    35   2.6
AB302075_1(AB302075|pid:none) Carassius auratus langsdorfii GATA...    35   2.6
EU287991_1(EU287991|pid:none) Megaselia abdita pannier-like prot...    35   2.6
FJ615540_1(FJ615540|pid:none) Branchiostoma floridae transcripti...    35   2.6
AY260735_1(AY260735|pid:none) Xenopus tropicalis zinc-finger tra...    35   2.6
AE016819_302(AE016819|pid:none) Ashbya gossypii (= Eremothecium ...    35   2.6
CP001325_322(CP001325|pid:none) Micromonas sp. RCC299 chromosome...    35   2.6
AY462219_1(AY462219|pid:none) Caenorhabditis elegans clone yk345...    35   2.6
U18311_1(U18311|pid:none) Danio rerio zg1 mRNA, complete cds.          35   2.6
BC053131_1(BC053131|pid:none) Danio rerio GATA-binding protein 2...    35   2.6
AB429308_1(AB429308|pid:none) Cyprinus carpio gata2 mRNA for GAT...    35   2.6
AY891319_1(AY891319|pid:none) Synthetic construct Homo sapiens c...    35   3.3
AM075623_1(AM075623|pid:none) Fusarium fujikuroi areB gene for G...    35   3.3
PDBN(1GNF) MOL_ID: 1;MOL_ID: 1; MOLECULE: TRANSCRIPTION FACTOR G...    35   3.3
AF320976_1(AF320976|pid:none) Aspergillus nidulans GATA factor A...    35   3.3
BT061503_1(BT061503|pid:none) Zea mays full-length cDNA clone ZM...    35   3.3
(P43429) RecName: Full=Erythroid transcription factor; AltName: ...    35   3.3
CP001323_254(CP001323|pid:none) Micromonas sp. RCC299 chromosome...    35   3.3
AJ400338_1(AJ400338|pid:none) Aedes aegypti mRNA for GATA transc...    35   3.3
AF320976_2(AF320976|pid:none) Aspergillus nidulans GATA factor A...    35   3.3
CU928169_659(CU928169|pid:none) Kluyveromyces thermotolerans str...    35   3.3
(P15976) RecName: Full=Erythroid transcription factor; AltName: ...    35   3.3
AY763413_1(AY763413|pid:none) Aedes aegypti GATAa2 transcription...    35   3.3
CU633897_288(CU633897|pid:none) Podospora anserina genomic DNA c...    35   3.3
BC170023_1(BC170023|pid:none) Xenopus laevis GATA binding factor...    35   3.3
AK118169_1(AK118169|pid:none) Arabidopsis thaliana At3g21175 mRN...    35   3.3
(P43693) RecName: Full=Transcription factor GATA-6; AltName: Ful...    35   3.3
BT068787_1(BT068787|pid:none) Zea mays full-length cDNA clone ZM...    35   3.3
AY849629_1(AY849629|pid:none) Magnaporthe grisea GATA type zinc ...    35   3.3
BT033727_1(BT033727|pid:none) Zea mays full-length cDNA clone ZM...    35   3.3
AY042817_1(AY042817|pid:none) Arabidopsis thaliana Unknown prote...    35   3.3
A41782(A41782) transcription factor GATA-2 (version 2) - human  ...    35   3.3
AF320976_3(AF320976|pid:none) Aspergillus nidulans GATA factor A...    34   4.4
U16320_2(U16320|pid:none) Bombyx mori transcription factor BmGAT...    34   4.4
A53741(A53741) transcription factor BmGATA beta - silkworm  &L27...    34   4.4
DQ976927_1(DQ976927|pid:none) Papio hamadryas GATA3 (GATA3) gene...    34   4.4
CP000583_109(CP000583|pid:none) Ostreococcus lucimarinus CCE9901...    34   4.4
NRL(1GATA) Erythroid transcription factor gata-1 (zinc-containin...    34   4.4
Z28258_2(Z28258|pid:none) S.cerevisiae chromosome XI reading fra...    34   4.4
(P23768) RecName: Full=GATA-binding factor 1-B; AltName: Full=Tr...    34   4.4
AY745808_1(AY745808|pid:none) Aedes aegypti GATA transcription f...    34   4.4
DQ977540_1(DQ977540|pid:none) Pongo pygmaeus GATA3 (GATA3) gene,...    34   4.4
CU928176_160(CU928176|pid:none) Zygosaccharomyces rouxii strain ...    34   4.4
S53811(S53811) BmGATA beta isoform 2 - silkworm (fragment)  &U16...    34   4.4
U18312_1(U18312|pid:none) Danio rerio zg2 mRNA, partial cds.           34   4.4
BC105653_1(BC105653|pid:none) Mus musculus GATA binding protein ...    34   5.7
(Q9LT45) RecName: Full=Putative GATA transcription factor 18;  &...    34   5.7
BC055963_1(BC055963|pid:none) Xenopus laevis transcription facto...    34   5.7
(P46152) RecName: Full=Transcription factor GATA-4; AltName: Ful...    34   5.7
AM937234_1(AM937234|pid:none) Sus scrofa partial mRNA for GATA b...    34   5.7
AB075549_1(AB075549|pid:none) Mus musculus mRNA for transcriptio...    34   5.7
AB034243_1(AB034243|pid:none) Mus musculus gene for transcriptio...    34   5.7
DQ976519_1(DQ976519|pid:none) Gorilla gorilla GATA4 (GATA4) gene...    34   5.7
(P97489) RecName: Full=Transcription factor GATA-5; AltName: Ful...    34   5.7
BC105654_1(BC105654|pid:none) Mus musculus GATA binding protein ...    34   5.7
BT084131_1(BT084131|pid:none) Zea mays full-length cDNA clone ZM...    34   5.7
AK132020_1(AK132020|pid:none) Mus musculus 10, 11 days embryo wh...    34   5.7
BC143479_1(BC143479|pid:none) Homo sapiens GATA binding protein ...    34   5.7
D87811_1(D87811|pid:none) Homo sapiens mRNA for GATA-6, complete...    34   5.7
AJ316283_1(AJ316283|pid:none) Bos taurus partial mRNA for gata4 ...    34   5.7
CR761720_1(CR761720|pid:none) Xenopus tropicalis finished cDNA, ...    34   5.7
AK134639_1(AK134639|pid:none) Mus musculus adult male medulla ob...    34   5.7
L34357_1(L34357|pid:none) Homo sapiens GATA-4 mRNA, complete cds.      34   5.7
EU969898_1(EU969898|pid:none) Zea mays clone 337006 hypothetical...    34   5.7
DQ886664_1(DQ886664|pid:none) Danio rerio GATA4 mRNA, complete c...    34   5.7
CU207296_4(CU207296|pid:none) Zebrafish DNA sequence from clone ...    34   5.7
U51335_1(U51335|pid:none) Mus musculus transcription factor GATA...    34   5.7
(P43691) RecName: Full=Transcription factor GATA-4; AltName: Ful...    34   5.7
D78260_1(D78260|pid:none) Homo sapiens mRNA for GATA-4 transcrip...    34   5.7
L22760_1(L22760|pid:none) Rat DNA binding protein (GATA-GT1) mRN...    34   5.7
EU285604_1(EU285604|pid:none) Microtus rossiaemeridionalis GATA-...    34   5.7
(Q91677) RecName: Full=Transcription factor GATA-4; AltName: Ful...    34   5.7
AK223547_1(AK223547|pid:none) Homo sapiens mRNA for GATA binding...    34   5.7
BC167280_1(BC167280|pid:none) Xenopus tropicalis GATA binding pr...    34   5.7
AF179424_1(AF179424|pid:none) Mus musculus transcription factor ...    34   5.7
BC088567_1(BC088567|pid:none) Xenopus tropicalis GATA binding pr...    34   5.7
AJ291310_1(AJ291310|pid:none) Oryctolagus cuniculus partial mRNA...    34   5.7
AB302074_1(AB302074|pid:none) Carassius auratus langsdorfii GATA...    33   7.4
BT031095_1(BT031095|pid:none) Drosophila melanogaster GH11649 fu...    33   7.4
EF577031_1(EF577031|pid:none) Oreochromis niloticus GATA4 mRNA, ...    33   7.4
(Q91678) RecName: Full=GATA-binding factor 6-A; AltName: Full=Tr...    33   7.4
BC085855_1(BC085855|pid:none) Rattus norvegicus GATA binding pro...    33   7.4
AY439009_1(AY439009|pid:none) Aedes aegypti GATA transcription f...    33   7.4
S40382(S40382) box A-binding factor - fruit fly (Drosophila mela...    33   7.4
AE014297_2207(AE014297|pid:none) Drosophila melanogaster chromos...    33   7.4
AK070729_1(AK070729|pid:none) Oryza sativa Japonica Group cDNA c...    33   7.4
AY069823_1(AY069823|pid:none) Drosophila melanogaster SD07261 fu...    33   7.4
Y07662_1(Y07662|pid:none) D.melanogaster mRNA for GATA transcrip...    33   7.4
AP007159_286(AP007159|pid:none) Aspergillus oryzae RIB40 genomic...    33   7.4
AY395731_1(AY395731|pid:none) Danio rerio Gata6 protein mRNA, co...    33   7.4
BC076718_1(BC076718|pid:none) Xenopus laevis transcription facto...    33   7.4
EU966996_1(EU966996|pid:none) Zea mays clone 298733 unknown mRNA.      33   7.4
AF068708_10(AF068708|pid:none) Caenorhabditis elegans cosmid C18...    33   9.7
EF014969_1(EF014969|pid:none) Platynereis dumerilii GATA transcr...    33   9.7
BC047790_1(BC047790|pid:none) Homo sapiens GATA binding protein ...    33   9.7
AF295687_1(AF295687|pid:none) Sus scrofa transcription factor GA...    33   9.7
EF651789_1(EF651789|pid:none) Capitella sp. I ECS-2004 GATA-bind...    33   9.7
BT057253_1(BT057253|pid:none) Salmo salar clone ssal-eve-517-020...    33   9.7
AF068708_9(AF068708|pid:none) Caenorhabditis elegans cosmid C18G...    33   9.7
DQ976686_1(DQ976686|pid:none) Hylobates klossii GATA4 (GATA4) ge...    33   9.7
(Q95JA5) RecName: Full=Transcription factor GATA-6; AltName: Ful...    33   9.7
(Q9BWX5) RecName: Full=Transcription factor GATA-5; AltName: Ful...    33   9.7
(Q7ZXY4) RecName: Full=GATA zinc finger domain-containing protei...    33   9.7
BC161128_1(BC161128|pid:none) Xenopus tropicalis cDNA clone MGC:...    33   9.7
T19677(T19677;T19844)hypothetical protein C33D3.1 - Caenorhabdit...    33   9.7

>(Q54WY0) RecName: Full=GATA zinc finger domain-containing protein
           18;
          Length = 237

 Score =  250 bits (638), Expect = 4e-65
 Identities = 131/188 (69%), Positives = 131/188 (69%)
 Frame = +1

Query: 193 SEYKTNRNLLYKTILNDIENSLQSLIKPQELTNLLEDNINKLKELDGVQPTNTFGNLQXX 372
           SEYKTNRNLLYKTILNDIENSLQSLIKPQELTNLLEDNINKLKELDGVQPTNTFGNLQ
Sbjct: 29  SEYKTNRNLLYKTILNDIENSLQSLIKPQELTNLLEDNINKLKELDGVQPTNTFGNLQNT 88

Query: 373 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLKQTLSPSVLIEHLNLFGNENFEEGXXXXX 552
                                         LKQTLSPSVLIEHLNLFGNENFEEG
Sbjct: 89  STNTTTTTTTTTTTTTTSSPNNNVITPNSNLKQTLSPSVLIEHLNLFGNENFEEGDDEEE 148

Query: 553 XXXXXXXXXXXXXXXXXXXRVPSKKLKPKAKPRPGGCSICKTQETPYWRKGKDGDKTVYL 732
                              RVPSKKLKP AKPRPGGCSICKTQETPYWRKGKDGDKTVYL
Sbjct: 149 TSSDSDSSSSSSTSSSSSERVPSKKLKPMAKPRPGGCSICKTQETPYWRKGKDGDKTVYL 208

Query: 733 CNACGLQI 756
           CNACGLQI
Sbjct: 209 CNACGLQI 216

Lambda     K      H
   0.318    0.134    0.401

Gapped
Lambda     K      H
   0.267   0.0410    0.140

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3236559
Number of Hits to DB: 825,849,403
Number of extensions: 11963867
Number of successful extensions: 26121
Number of sequences better than 10.0: 361
Number of HSP's gapped: 25891
Number of HSP's successfully gapped: 451
Length of query: 252
Length of database: 1,051,180,864
Length adjustment: 126
Effective length of query: 126
Effective length of database: 643,374,430
Effective search space: 81065178180
Effective search space used: 81065178180
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 31 (16.5 bits)
PSORT 

 psg: 0.92  gvh: 0.36  alm: 0.52  top: 0.53  tms: 0.00  mit: 0.24  mip: 0.08
 nuc: 0.08  erl: 0.00  erm: 0.00  pox: 0.00  px2: 0.00  vac: 0.00  rnp: 0.00
 act: 0.00  caa: 0.00  yqr: 0.00  tyr: 0.00  leu: 0.00  gpi: 0.00  myr: 0.00
 dna: 0.00  rib: 0.00  bac: 0.00  m1a: 0.00  m1b: 0.00  m2 : 0.00  mNt: 0.00
 m3a: 0.00  m3b: 0.00  m_ : 1.00 

	 36.0 %: cytoplasmic
	 36.0 %: nuclear
	  8.0 %: cytoskeletal
	  8.0 %: mitochondrial
	  4.0 %: Golgi
	  4.0 %: plasma membrane
	  4.0 %: endoplasmic reticulum

>> prediction for Contig-U01883-1 is cyt
VS (DIR, S) 0
VH (FL, L) 0
VF (FL, S) 0
AH (FL, L) 0
AF (FL, S) 0
SL (DIR, L) 0
SS (DIR, S) 2
SH (FL, L) 0
SF (FL, S) 0
CH (FL, L) 0
CF (FL, S) 0
FCL (DIR, L) 0
FC (DIR, S) 0
FC-IC (SUB) 0