Homology vs DNA |
|
Homology vs Protein |
Query= Contig-U11805-1 (Contig-U11805-1Q) /CSM_Contig/Contig-U11805-1Q.Seq.d (1189 letters)
Database: nrp_B 3,236,559 sequences; 1,051,180,864 total letters
Searching..................................................done
Score E Sequences producing significant alignments: (bits) Value
AJ720039_1(AJ720039|pid:none) Gallus gallus mRNA for hypothetica... 401 e-110 (Q1RHY6) RecName: Full=Cysteine desulfurase; EC=2.8.1.7... 400 e-110 AM451544_1(AM451544|pid:none) Vitis vinifera contig VV78X126826.... 399 e-110 (A8GWB2) RecName: Full=Cysteine desulfurase; EC=2.8.1.7... 399 e-109 BC134974_1(BC134974|pid:none) Danio rerio NFS1 nitrogen fixation... 399 e-109 (Q4UL77) RecName: Full=Cysteine desulfurase; EC=2.8.1.7; 399 e-109 CP000053_845(CP000053|pid:none) Rickettsia felis URRWXCal2, comp... 399 e-109 BC142478_1(BC142478|pid:none) Bos taurus NFS1 nitrogen fixation ... 396 e-109 (O49543) RecName: Full=Cysteine desulfurase 1, mitochondrial; ... 396 e-109 AK317117_1(AK317117|pid:none) Arabidopsis thaliana AT5G65720 mRN... 396 e-109 AJ010952_1(AJ010952|pid:none) Homo sapiens mRNA for putative tRN... 394 e-108 AK223239_1(AK223239|pid:none) Homo sapiens mRNA for NFS1 nitroge... 394 e-108 CP001612_580(CP001612|pid:none) Rickettsia africae ESF-5, comple... 394 e-108 (Q5RDE7) RecName: Full=Cysteine desulfurase, mitochondrial; ... 394 e-108 (A8GSG4) RecName: Full=Cysteine desulfurase; EC=2.8.1.7... 394 e-108 FJ211193_1(FJ211193|pid:none) Sus scrofa nitrogen fixation 1-lik... 393 e-108 AK075575_1(AK075575|pid:none) Mus musculus adult male kidney cDN... 392 e-107 AK312293_1(AK312293|pid:none) Homo sapiens cDNA, FLJ92597, highl... 392 e-107 BC010586_1(BC010586|pid:none) Mus musculus nitrogen fixation gen... 392 e-107 AF097025_1(AF097025|pid:none) Homo sapiens cysteine desulfurase ... 392 e-107 (Q99P39) RecName: Full=Cysteine desulfurase, mitochondrial; ... 391 e-107 BC104699_1(BC104699|pid:none) Rattus norvegicus NFS1 nitrogen fi... 391 e-107 EU959985_1(EU959985|pid:none) Zea mays clone 221007 cysteine des... 391 e-107 CP000583_227(CP000583|pid:none) Ostreococcus lucimarinus CCE9901... 391 e-107 EU959587_1(EU959587|pid:none) Zea mays clone 218756 cysteine des... 391 e-107 FN357550_1(FN357550|pid:none) Schistosoma mansoni genome sequenc... 389 e-107 FN317336_1(FN317336|pid:none) Schistosoma japonicum isolate Anhu... 389 e-106 CR954203_229(CR954203|pid:none) Ostreococcus tauri strain OTTH05... 389 e-106 (Q9Z1J3) RecName: Full=Cysteine desulfurase, mitochondrial; ... 387 e-106 CU640366_43(CU640366|pid:none) Podospora anserina genomic DNA ch... 382 e-104 AY850314_1(AY850314|pid:none) Magnaporthe grisea cysteine desulf... 381 e-104 AF067211_14(AF067211|pid:none) Caenorhabditis elegans cosmid B02... 378 e-103 AL807371_5(AL807371|pid:none) Neurospora crassa DNA linkage grou... 376 e-102 AE017321_28(AE017321|pid:none) Wolbachia endosymbiont strain TRS... 366 e-99 AE017196_889(AE017196|pid:none) Wolbachia endosymbiont of Drosop... 365 2e-99 AM270199_76(AM270199|pid:none) Aspergillus niger contig An09c010... 364 3e-99 CP000107_402(CP000107|pid:none) Ehrlichia canis str. Jake, compl... 364 4e-99 CP001391_789(CP001391|pid:none) Wolbachia sp. wRi, complete geno... 363 5e-99 AP007167_524(AP007167|pid:none) Aspergillus oryzae RIB40 genomic... 362 1e-98 FM992694_60(FM992694|pid:none) Candida dubliniensis CD36 chromos... 362 1e-98 AP007255_3028(AP007255|pid:none) Magnetospirillum magneticum AMB... 362 1e-98 AF338108_2(AF338108|pid:none) Cowdria ruminantium clone 11hw hyp... 361 3e-98 CR925677_425(CR925677|pid:none) Ehrlichia ruminantium str. Garde... 360 4e-98 (P87185) RecName: Full=Cysteine desulfurase, mitochondrial; ... 360 7e-98 CP000502_317(CP000502|pid:none) Pichia stipitis CBS 6054 chromos... 360 7e-98 FN392321_30(FN392321|pid:none) Pichia pastoris GS115 chromosome ... 359 9e-98 CR382139_482(CR382139|pid:none) Debaryomyces hansenii strain CBS... 359 9e-98 AM920428_1570(AM920428|pid:none) Penicillium chrysogenum Wiscons... 359 9e-98 CP001079_445(CP001079|pid:none) Anaplasma marginale str. Florida... 358 2e-97 CP000030_450(CP000030|pid:none) Anaplasma marginale str. St. Mar... 358 2e-97 CR382129_705(CR382129|pid:none) Yarrowia lipolytica strain CLIB1... 357 6e-97 (O60028) RecName: Full=Cysteine desulfurase, mitochondrial; ... 356 8e-97 CP000235_617(CP000235|pid:none) Anaplasma phagocytophilum HZ, co... 354 3e-96 AM999887_1014(AM999887|pid:none) Wolbachia endosymbiont of Culex... 353 5e-96 AM989984_9(AM989984|pid:none) Zygosaccharomyces rouxii strain CB... 351 3e-95 (P87187) RecName: Full=Cysteine desulfurase, mitochondrial; ... 348 3e-94 CU928180_512(CU928180|pid:none) Kluyveromyces thermotolerans str... 347 4e-94 M98808_1(M98808|pid:none) Saccharomyces cerevisiae nitrogen fixa... 347 5e-94 (P25374) RecName: Full=Cysteine desulfurase, mitochondrial; ... 347 5e-94 CR382124_196(CR382124|pid:none) Kluyveromyces lactis strain NRRL... 342 2e-92 CP000124_2696(CP000124|pid:none) Burkholderia pseudomallei 1710b... 342 2e-92 CP000086_1845(CP000086|pid:none) Burkholderia thailandensis E264... 341 3e-92 AJ279023_1(AJ279023|pid:none) Candida rugosa partial putative SP... 340 4e-92 CR380954_157(CR380954|pid:none) Candida glabrata strain CBS138 c... 340 6e-92 CR555306_3662(CR555306|pid:none) Azoarcus sp. EbN1 complete geno... 340 6e-92 CP000010_1467(CP000010|pid:none) Burkholderia mallei ATCC 23344 ... 339 1e-91 CP000090_1054(CP000090|pid:none) Ralstonia eutropha JMP134 chrom... 336 8e-91 CU633749_1112(CU633749|pid:none) Cupriavidus taiwanensis str. LM... 335 1e-90 AL646052_1020(AL646052|pid:none) Ralstonia solanacearum GMI1000 ... 335 2e-90 CP001281_2142(CP001281|pid:none) Thauera sp. MZ1T, complete geno... 334 3e-90 AM260479_1147(AM260479|pid:none) Ralstonia eutropha H16 chromoso... 334 4e-90 CP001052_2521(CP001052|pid:none) Burkholderia phytofirmans PsJN ... 334 4e-90 CP001219_646(CP001219|pid:none) Acidithiobacillus ferrooxidans A... 334 4e-90 (Q486Z0) RecName: Full=Cysteine desulfurase; EC=2.8.1.7... 333 9e-90 CP001321_52(CP001321|pid:none) Haemophilus parasuis SH0165, comp... 333 9e-90 (A9MHJ4) RecName: Full=Cysteine desulfurase; EC=2.8.1.7... 332 1e-89 (Q6D259) RecName: Full=Cysteine desulfurase; EC=2.8.1.7... 332 1e-89 (A1S544) RecName: Full=Cysteine desulfurase; EC=2.8.1.7... 332 1e-89 CU914168_1831(CU914168|pid:none) Ralstonia solanacearum strain I... 332 2e-89 (Q87S28) RecName: Full=Cysteine desulfurase; EC=2.8.1.7... 332 2e-89 BX640416_152(BX640416|pid:none) Bordetella pertussis strain Toha... 331 3e-89 BX640429_75(BX640429|pid:none) Bordetella parapertussis strain 1... 331 3e-89 (A1SUI4) RecName: Full=Cysteine desulfurase; EC=2.8.1.7... 331 3e-89 (Q8Z4N0) RecName: Full=Cysteine desulfurase; EC=2.8.1.7... 331 3e-89 AM286415_1009(AM286415|pid:none) Yersinia enterocolitica subsp. ... 331 4e-89 (B5XNJ7) RecName: Full=Cysteine desulfurase; EC=2.8.1.7... 330 5e-89 CP000151_2243(CP000151|pid:none) Burkholderia sp. 383 chromosome... 330 5e-89 AE009952_1311(AE009952|pid:none) Yersinia pestis KIM, complete g... 330 5e-89 BX936398_2857(BX936398|pid:none) Yersinia pseudotuberculosis IP3... 330 6e-89 CP000440_2155(CP000440|pid:none) Burkholderia ambifaria AMMD chr... 330 6e-89 CP000614_2179(CP000614|pid:none) Burkholderia vietnamiensis G4 c... 330 6e-89 (A7ZPX4) RecName: Full=Cysteine desulfurase; EC=2.8.1.7... 330 8e-89 (Q6LU62) RecName: Full=Cysteine desulfurase; EC=2.8.1.7... 330 8e-89 (B7LKA9) RecName: Full=Cysteine desulfurase; EC=2.8.1.7... 330 8e-89 A65030(A65030) probable iron-sulfur cofactor synthesis protein b... 330 8e-89 CP001252_1922(CP001252|pid:none) Shewanella baltica OS223, compl... 329 1e-88 (B4TRX5) RecName: Full=Cysteine desulfurase; EC=2.8.1.7... 329 1e-88 (A1RJ52) RecName: Full=Cysteine desulfurase; EC=2.8.1.7... 329 1e-88 CP001503_2336(CP001503|pid:none) Burkholderia glumae BGR1 chromo... 329 1e-88 (Q65RS7) RecName: Full=Cysteine desulfurase; EC=2.8.1.7... 328 2e-88 (A6WNY5) RecName: Full=Cysteine desulfurase; EC=2.8.1.7... 328 2e-88 (A4WDB1) RecName: Full=Cysteine desulfurase; EC=2.8.1.7... 328 3e-88 AM902716_2788(AM902716|pid:none) Bordetella petrii strain DSM 12... 328 3e-88 (Q0I1L2) RecName: Full=Cysteine desulfurase; EC=2.8.1.7... 327 5e-88 (P57803) RecName: Full=Cysteine desulfurase; EC=2.8.1.7... 327 5e-88 CP000668_2190(CP000668|pid:none) Yersinia pestis Pestoides F, co... 327 5e-88 (A8GHY3) RecName: Full=Cysteine desulfurase; EC=2.8.1.7... 327 7e-88 (Q12P83) RecName: Full=Cysteine desulfurase; EC=2.8.1.7... 326 9e-88 (A5CWM6) RecName: Full=Cysteine desulfurase; EC=2.8.1.7... 326 9e-88 (A7MU48) RecName: Full=Cysteine desulfurase; EC=2.8.1.7... 326 1e-87 (A0KJ32) RecName: Full=Cysteine desulfurase; EC=2.8.1.7... 325 1e-87 (Q0HJF4) RecName: Full=Cysteine desulfurase; EC=2.8.1.7... 325 2e-87 CP001600_3071(CP001600|pid:none) Edwardsiella ictaluri 93-146, c... 325 3e-87 (B1KNI3) RecName: Full=Cysteine desulfurase; EC=2.8.1.7... 324 3e-87 CP000512_2400(CP000512|pid:none) Acidovorax citrulli AAC00-1, co... 324 3e-87 (Q080P6) RecName: Full=Cysteine desulfurase; EC=2.8.1.7... 324 3e-87 CP001339_1466(CP001339|pid:none) Thioalkalivibrio sp. HL-EbGR7, ... 324 3e-87 CP000529_2271(CP000529|pid:none) Polaromonas naphthalenivorans C... 324 4e-87 CP001139_602(CP001139|pid:none) Vibrio fischeri MJ11 chromosome ... 324 4e-87 CP000057_431(CP000057|pid:none) Haemophilus influenzae 86-028NP,... 323 6e-87 D64064(D64064) iron-sulfur cofactor synthesis protein HI0378 - H... 323 6e-87 CP001616_1988(CP001616|pid:none) Tolumonas auensis DSM 9187, com... 322 1e-86 (A3QFD5) RecName: Full=Cysteine desulfurase; EC=2.8.1.7... 322 1e-86 CP001392_1607(CP001392|pid:none) Diaphorobacter sp. TPSY, comple... 322 2e-86 AM260480_485(AM260480|pid:none) Ralstonia eutropha H16 chromosom... 322 2e-86 (Q7MNG2) RecName: Full=Cysteine desulfurase; EC=2.8.1.7... 321 3e-86 (Q8DEY7) RecName: Full=Cysteine desulfurase; EC=2.8.1.7... 321 3e-86 CP000655_1485(CP000655|pid:none) Polynucleobacter necessarius su... 321 4e-86 (Q7N224) RecName: Full=Cysteine desulfurase; EC=2.8.1.7... 321 4e-86 AK297969_1(AK297969|pid:none) Homo sapiens cDNA FLJ60737 complet... 320 5e-86 (A1AWM1) RecName: Full=Cysteine desulfurase; EC=2.8.1.7... 320 6e-86 CP000267_2139(CP000267|pid:none) Rhodoferax ferrireducens T118, ... 320 6e-86 (A9M029) RecName: Full=Cysteine desulfurase; EC=2.8.1.7... 320 6e-86 (Q9JYY0) RecName: Full=Cysteine desulfurase; EC=2.8.1.7... 319 1e-85 (A5F3G4) RecName: Full=Cysteine desulfurase; EC=2.8.1.7... 319 1e-85 CP000379_1664(CP000379|pid:none) Burkholderia cenocepacia AU 105... 318 2e-85 FM178379_717(FM178379|pid:none) Aliivibrio salmonicida LFI1238 c... 318 2e-85 CP001233_690(CP001233|pid:none) Vibrio cholerae M66-2 chromosome... 318 2e-85 CP001010_405(CP001010|pid:none) Polynucleobacter necessarius sub... 318 2e-85 (A1KUK1) RecName: Full=Cysteine desulfurase; EC=2.8.1.7... 318 2e-85 CP000687_893(CP000687|pid:none) Actinobacillus pleuropneumoniae ... 318 3e-85 AM747721_739(AM747721|pid:none) Burkholderia cenocepacia J2315 c... 317 4e-85 (B4RMB8) RecName: Full=Cysteine desulfurase; EC=2.8.1.7... 317 4e-85 CP000388_1231(CP000388|pid:none) Pseudoalteromonas atlantica T6c... 317 4e-85 (A8H2M6) RecName: Full=Cysteine desulfurase; EC=2.8.1.7... 317 4e-85 CP000360_484(CP000360|pid:none) Acidobacteria bacterium Ellin345... 317 7e-85 CP000555_2256(CP000555|pid:none) Methylibium petroleiphilum PM1,... 315 2e-84 CP001013_1040(CP001013|pid:none) Leptothrix cholodnii SP-6, comp... 315 3e-84 (B8CMW5) RecName: Full=Cysteine desulfurase; EC=2.8.1.7... 314 3e-84 (Q60C64) RecName: Full=Cysteine desulfurase; EC=2.8.1.7... 314 3e-84 CP000092_406(CP000092|pid:none) Ralstonia eutropha JMP134 megapl... 313 6e-84 CP000316_2138(CP000316|pid:none) Polaromonas sp. JS666, complete... 313 8e-84 CP001359_614(CP001359|pid:none) Anaeromyxobacter dehalogenans 2C... 311 2e-83 (B4EZU8) RecName: Full=Cysteine desulfurase; EC=2.8.1.7... 311 3e-83 (P57657) RecName: Full=Cysteine desulfurase; EC=2.8.1.7... 310 6e-83 AY029212_1(AY029212|pid:none) Cryptosporidium parvum NifS-like p... 308 2e-82 (A7H804) RecName: Full=Cysteine desulfurase; EC=2.8.1.7... 308 3e-82 CP000542_2326(CP000542|pid:none) Verminephrobacter eiseniae EF01... 308 3e-82 CP000113_4871(CP000113|pid:none) Myxococcus xanthus DK 1622, com... 308 3e-82 CP000884_3983(CP000884|pid:none) Delftia acidovorans SPH-1, comp... 307 4e-82 AF321006_1(AF321006|pid:none) Trichomonas vaginalis IscS/NifS-li... 305 2e-81 AM910984_116(AM910984|pid:none) Plasmodium knowlesi strain H chr... 300 7e-80 CP000263_354(CP000263|pid:none) Buchnera aphidicola str. Cc (Cin... 299 1e-79 (B0KPH6) RecName: Full=Cysteine desulfurase; EC=2.8.1.7... 299 1e-79 (Q89A19) RecName: Full=Cysteine desulfurase; EC=2.8.1.7... 298 3e-79 (A6V0U8) RecName: Full=Cysteine desulfurase; EC=2.8.1.7... 298 3e-79 CP000529_1556(CP000529|pid:none) Polaromonas naphthalenivorans C... 298 3e-79 (Q02RW8) RecName: Full=Cysteine desulfurase; EC=2.8.1.7... 297 6e-79 AY675347_1(AY675347|pid:none) Pseudomonas putida strain TS1138 L... 296 7e-79 AM746676_7342(AM746676|pid:none) Sorangium cellulosum 'So ce 56'... 296 1e-78 (B0VNW2) RecName: Full=Cysteine desulfurase; EC=2.8.1.7... 294 4e-78 FP236842_1029(FP236842|pid:none) Erwinia pyrifoliae strain Ep1/9... 293 6e-78 (Q48M05) RecName: Full=Cysteine desulfurase; EC=2.8.1.7... 292 1e-77 (A4XY43) RecName: Full=Cysteine desulfurase; EC=2.8.1.7... 290 7e-77 (A4VNY2) RecName: Full=Cysteine desulfurase; EC=2.8.1.7... 290 9e-77 CP000713_1610(CP000713|pid:none) Psychrobacter sp. PRwf-1, compl... 289 2e-76 CR543861_1282(CR543861|pid:none) Acinetobacter sp. ADP1 complete... 288 2e-76 AY204370_1(AY204370|pid:none) Leptospirillum ferrooxidans NifS (... 286 8e-76 (Q3K7A5) RecName: Full=Cysteine desulfurase; EC=2.8.1.7... 286 8e-76 CP000082_1477(CP000082|pid:none) Psychrobacter arcticus 273-4, c... 286 1e-75 AF545471_1(AF545471|pid:none) Tritrichomonas foetus putative cys... 284 4e-75 AM181176_4951(AM181176|pid:none) Pseudomonas fluorescens SBW25 c... 281 2e-74 (B2VI32) RecName: Full=Cysteine desulfurase; EC=2.8.1.7... 279 1e-73 (O31269) RecName: Full=Cysteine desulfurase; EC=2.8.1.7... 278 2e-73 CP001157_3908(CP001157|pid:none) Azotobacter vinelandii DJ, comp... 278 2e-73 CP001083_2686(CP001083|pid:none) Clostridium botulinum Ba4 str. ... 273 7e-72 BA000016_1785(BA000016|pid:none) Clostridium perfringens str. 13... 271 3e-71 CP000962_2551(CP000962|pid:none) Clostridium botulinum A3 str. L... 271 4e-71 (A5I4Z9) RecName: Full=Cysteine desulfurase; EC=2.8.1.7... 271 4e-71 AM114193_1421(AM114193|pid:none) Uncultured methanogenic archaeo... 270 6e-71 CP000246_1995(CP000246|pid:none) Clostridium perfringens ATCC 13... 270 7e-71 CP000679_2167(CP000679|pid:none) Caldicellulosiruptor saccharoly... 265 2e-69 CP001393_1642(CP001393|pid:none) Anaerocellum thermophilum DSM 6... 263 1e-68 CP000382_1383(CP000382|pid:none) Clostridium novyi NT, complete ... 262 2e-68 CP000724_2364(CP000724|pid:none) Alkaliphilus metalliredigens QY... 262 2e-68 CP001277_515(CP001277|pid:none) Candidatus Hamiltonella defensa ... 261 3e-68 CP000721_1090(CP000721|pid:none) Clostridium beijerinckii NCIMB ... 261 4e-68 CP001146_1633(CP001146|pid:none) Dictyoglomus thermophilum H-6-1... 260 6e-68 CP001103_1350(CP001103|pid:none) Alteromonas macleodii 'Deep eco... 259 1e-67 CP000749_1337(CP000749|pid:none) Marinomonas sp. MWYL1, complete... 259 2e-67 CP001348_1892(CP001348|pid:none) Clostridium cellulolyticum H10,... 259 2e-67 CP001614_2317(CP001614|pid:none) Teredinibacter turnerae T7901, ... 258 2e-67 AP008232_1769(AP008232|pid:none) Sodalis glossinidius str. 'mors... 258 3e-67 AF311744_1(AF311744|pid:none) Giardia intestinalis putative cyst... 258 4e-67 AP008230_2426(AP008230|pid:none) Desulfitobacterium hafniense Y5... 258 4e-67 CP001056_1102(CP001056|pid:none) Clostridium botulinum B str. Ek... 256 1e-66 CP001078_1049(CP001078|pid:none) Clostridium botulinum E3 str. A... 256 1e-66 CP000806_278(CP000806|pid:none) Cyanothece sp. ATCC 51142 circul... 256 1e-66 CP000853_1640(CP000853|pid:none) Alkaliphilus oremlandii OhILAs,... 254 3e-66 CP000155_4245(CP000155|pid:none) Hahella chejuensis KCTC 2396, c... 254 4e-66 CP000254_2137(CP000254|pid:none) Methanospirillum hungatei JF-1,... 253 9e-66 CP001034_301(CP001034|pid:none) Natranaerobius thermophilus JW/N... 251 4e-65 AE008691_2278(AE008691|pid:none) Thermoanaerobacter tengcongensi... 250 8e-65 (O54055) RecName: Full=Cysteine desulfurase; EC=2.8.1.7... 249 1e-64 CP000780_352(CP000780|pid:none) Candidatus Methanoregula boonei ... 248 4e-64 CP000923_752(CP000923|pid:none) Thermoanaerobacter sp. X514, com... 247 5e-64 AP009049_989(AP009049|pid:none) Clostridium kluyveri NBRC 12016 ... 246 9e-64 CP001344_3147(CP001344|pid:none) Cyanothece sp. PCC 7425, comple... 244 4e-63 CP000282_1411(CP000282|pid:none) Saccharophagus degradans 2-40, ... 243 7e-63 CP000559_264(CP000559|pid:none) Methanocorpusculum labreanum Z, ... 243 1e-62 CP001287_1031(CP001287|pid:none) Cyanothece sp. PCC 8801, comple... 243 1e-62 AE017354_1717(AE017354|pid:none) Legionella pneumophila subsp. p... 243 1e-62 AF321005_1(AF321005|pid:none) Trichomonas vaginalis IscS/NifS-li... 242 2e-62 CR628337_1719(CR628337|pid:none) Legionella pneumophila str. Len... 242 2e-62 BA000022_2141(BA000022|pid:none) Synechocystis sp. PCC 6803 DNA,... 241 5e-62 CP001107_300(CP001107|pid:none) Eubacterium rectale ATCC 33656, ... 240 6e-62 AE009952_2147(AE009952|pid:none) Yersinia pestis KIM, complete g... 240 8e-62 CP000720_1973(CP000720|pid:none) Yersinia pseudotuberculosis IP ... 240 8e-62 CP000950_2087(CP000950|pid:none) Yersinia pseudotuberculosis YPI... 240 8e-62 CP001020_877(CP001020|pid:none) Coxiella burnetii CbuK_Q154, com... 239 1e-61 CP000099_2350(CP000099|pid:none) Methanosarcina barkeri str. Fus... 238 4e-61 CP000678_264(CP000678|pid:none) Methanobrevibacter smithii ATCC ... 237 5e-61 (B8DZS1) RecName: Full=Cysteine desulfurase; EC=2.8.1.7... 237 7e-61 CP000612_750(CP000612|pid:none) Desulfotomaculum reducens MI-1, ... 237 7e-61 AM286690_1872(AM286690|pid:none) Alcanivorax borkumensis SK2, co... 236 1e-60 CP000252_2482(CP000252|pid:none) Syntrophus aciditrophicus SB, c... 236 2e-60 AY728386_12(AY728386|pid:none) Cyanothece sp. ATCC 51142, genomi... 235 3e-60 CP000473_1193(CP000473|pid:none) Solibacter usitatus Ellin6076, ... 232 2e-59 CP000142_2000(CP000142|pid:none) Pelobacter carbinolicus DSM 238... 232 2e-59 CP000394_1943(CP000394|pid:none) Granulibacter bethesdensis CGDN... 232 2e-59 CP001146_552(CP001146|pid:none) Dictyoglomus thermophilum H-6-12... 232 2e-59 C34443(C34443;B32361) nitrogenase cofactor synthesis protein nif... 231 3e-59 CP000885_2874(CP000885|pid:none) Clostridium phytofermentans ISD... 231 5e-59 (Q43884) RecName: Full=Cysteine desulfurase; EC=2.8.1.7... 231 5e-59 CP000875_3866(CP000875|pid:none) Herpetosiphon aurantiacus ATCC ... 230 6e-59 CP001037_5935(CP001037|pid:none) Nostoc punctiforme PCC 73102, c... 229 1e-58 CP001390_1959(CP001390|pid:none) Geobacter sp. FRC-32, complete ... 229 1e-58 BA000039_115(BA000039|pid:none) Thermosynechococcus elongatus BP... 228 3e-58 AE008384_109(AE008384|pid:none) Methanosarcina mazei strain Goe1... 228 4e-58 CP001037_394(CP001037|pid:none) Nostoc punctiforme PCC 73102, co... 227 5e-58 CP000478_2657(CP000478|pid:none) Syntrophobacter fumaroxidans MP... 227 7e-58 CP001087_4047(CP001087|pid:none) Desulfobacterium autotrophicum ... 226 1e-57 AP010904_1711(AP010904|pid:none) Desulfovibrio magneticus RS-1 D... 224 4e-57 CP000866_337(CP000866|pid:none) Nitrosopumilus maritimus SCM1, c... 224 4e-57 FJ170277_17(FJ170277|pid:none) Uncultured cyanobacterium group A... 224 5e-57 CP001124_1554(CP001124|pid:none) Geobacter bemidjiensis Bem, com... 224 5e-57 CP001055_426(CP001055|pid:none) Elusimicrobium minutum Pei191, c... 224 5e-57 CP001616_661(CP001616|pid:none) Tolumonas auensis DSM 9187, comp... 224 6e-57 CP000393_3612(CP000393|pid:none) Trichodesmium erythraeum IMS101... 224 6e-57 CP001358_1061(CP001358|pid:none) Desulfovibrio desulfuricans sub... 223 8e-57 AF167538_2(AF167538|pid:none) Trichodesmium sp. IMS101 nif gene ... 222 2e-56 CT573071_1170(CT573071|pid:none) Kuenenia stuttgartiensis genome... 221 4e-56 M17349_2(M17349|pid:none) A.vinelandii nitrogen fixation genes U... 221 4e-56 (Q44482) RecName: Full=Cysteine desulfurase 2; EC=2.8.1... 221 4e-56 (P05341) RecName: Full=Cysteine desulfurase; EC=2.8.1.7... 221 4e-56 CP001276_109(CP001276|pid:none) Thermomicrobium roseum DSM 5159 ... 219 1e-55 U49859_2(U49859|pid:none) Anabaena variabilis Mo-nitrogenase ope... 219 1e-55 EU016637_19(EU016637|pid:none) Uncultured Group I marine crenarc... 219 1e-55 AY682470_1(AY682470|pid:none) Debaryomyces hansenii tRNA splicin... 219 2e-55 CP000685_4173(CP000685|pid:none) Flavobacterium johnsoniae UW101... 219 2e-55 AE015927_1301(AE015927|pid:none) Clostridium tetani E88, complet... 218 3e-55 AM180252_265(AM180252|pid:none) Lawsonia intracellularis PHE/MN1... 218 3e-55 CP001275_1578(CP001275|pid:none) Thermomicrobium roseum DSM 5159... 218 4e-55 BX571662_335(BX571662|pid:none) Wolinella succinogenes, complete... 218 4e-55 EU742820_1(EU742820|pid:none) Amphidinium carterae strain CCMP13... 217 6e-55 CP000859_2237(CP000859|pid:none) Desulfococcus oleovorans Hxd3, ... 217 7e-55 CP000482_1982(CP000482|pid:none) Pelobacter propionicus DSM 2379... 216 1e-54 CP000698_1474(CP000698|pid:none) Geobacter uraniireducens Rf4, c... 216 1e-54 CP000240_413(CP000240|pid:none) Synechococcus sp. JA-2-3B'a(2-13... 215 2e-54 CP000089_1505(CP000089|pid:none) Dechloromonas aromatica RCB, co... 214 5e-54 CP000153_2000(CP000153|pid:none) Sulfurimonas denitrificans DSM ... 213 8e-54 CT573073_792(CT573073|pid:none) Kuenenia stuttgartiensis genome ... 213 8e-54 CP000923_1973(CP000923|pid:none) Thermoanaerobacter sp. X514, co... 213 8e-54 CP000909_1419(CP000909|pid:none) Chloroflexus aurantiacus J-10-f... 213 8e-54 BX842649_75(BX842649|pid:none) Bdellovibrio bacteriovorus comple... 213 1e-53 BX950851_2921(BX950851|pid:none) Erwinia carotovora subsp. atros... 213 1e-53 (B2US50) RecName: Full=Cysteine desulfurase; EC=2.8.1.7... 213 1e-53 AE017125_564(AE017125|pid:none) Helicobacter hepaticus ATCC 5144... 211 4e-53 CP000439_1215(CP000439|pid:none) Francisella tularensis subsp. n... 211 4e-53 AY967157_1(AY967157|pid:none) Synthetic construct isolate FTT122... 211 5e-53 CP000607_294(CP000607|pid:none) Chlorobium phaeovibrioides DSM 2... 211 5e-53 CP001357_802(CP001357|pid:none) Brachyspira hyodysenteriae WA1, ... 211 5e-53 AM233362_717(AM233362|pid:none) Francisella tularensis subsp. ho... 210 7e-53 AP009179_7(AP009179|pid:none) Sulfurovum sp. NBC37-1 genomic DNA... 210 7e-53 AX876368_1(AX876368|pid:none) Sequence 11273 from Patent EP10746... 210 9e-53 BA000021_284(BA000021|pid:none) Wigglesworthia glossinidia endos... 210 9e-53 CP000781_108(CP000781|pid:none) Xanthobacter autotrophicus Py2, ... 210 9e-53 CP001344_2127(CP001344|pid:none) Cyanothece sp. PCC 7425, comple... 209 1e-52 CT978603_2259(CT978603|pid:none) Synechococcus sp. RCC307 genomi... 209 2e-52 (Q52069) RecName: Full=Cysteine desulfurase; EC=2.8.1.7... 209 2e-52 (O25008) RecName: Full=Cysteine desulfurase; EC=2.8.1.7... 208 3e-52 CP001173_192(CP001173|pid:none) Helicobacter pylori G27, complet... 208 3e-52 CP000728_1161(CP000728|pid:none) Clostridium botulinum F str. La... 208 3e-52 CP000386_107(CP000386|pid:none) Rubrobacter xylanophilus DSM 994... 208 3e-52 (B6JKF2) RecName: Full=Cysteine desulfurase; EC=2.8.1.7... 208 3e-52 CR522870_2229(CR522870|pid:none) Desulfotalea psychrophila LSv54... 208 3e-52 AE009951_651(AE009951|pid:none) Fusobacterium nucleatum subsp. n... 207 8e-52 CP000110_2379(CP000110|pid:none) Synechococcus sp. CC9605, compl... 206 1e-51 AP009510_520(AP009510|pid:none) Uncultured Termite group 1 bacte... 206 1e-51 CP000613_460(CP000613|pid:none) Rhodospirillum centenum SW, comp... 206 1e-51 CP001390_2481(CP001390|pid:none) Geobacter sp. FRC-32, complete ... 206 1e-51 CP001101_2148(CP001101|pid:none) Chlorobium phaeobacteroides BS1... 206 1e-51 CP001581_1227(CP001581|pid:none) Clostridium botulinum A2 str. K... 206 2e-51 CP000934_1429(CP000934|pid:none) Cellvibrio japonicus Ueda107, c... 206 2e-51 BX569695_100(BX569695|pid:none) Synechococcus sp. WH8102 complet... 205 3e-51 CP001076_262(CP001076|pid:none) Rhizobium etli CIAT 652 plasmid ... 205 3e-51 CP000108_205(CP000108|pid:none) Chlorobium chlorochromatii CaD3,... 205 3e-51 CP001390_2499(CP001390|pid:none) Geobacter sp. FRC-32, complete ... 204 7e-51 CP000435_2593(CP000435|pid:none) Synechococcus sp. CC9311, compl... 204 7e-51 CP000096_231(CP000096|pid:none) Pelodictyon luteolum DSM 273, co... 203 9e-51 CP000095_225(CP000095|pid:none) Prochlorococcus marinus str. NAT... 203 9e-51 (O30052) RecName: Full=Probable cysteine desulfurase 1; ... 202 1e-50 CP000011_366(CP000011|pid:none) Burkholderia mallei ATCC 23344 c... 202 2e-50 CP000573_2849(CP000573|pid:none) Burkholderia pseudomallei 1106a... 202 2e-50 CP000125_1223(CP000125|pid:none) Burkholderia pseudomallei 1710b... 202 2e-50 CP001337_1881(CP001337|pid:none) Chloroflexus aggregans DSM 9485... 202 2e-50 CP001280_3520(CP001280|pid:none) Methylocella silvestris BL2, co... 201 4e-50 BX571966_2159(BX571966|pid:none) Burkholderia pseudomallei strai... 201 6e-50 CT573072_963(CT573072|pid:none) Kuenenia stuttgartiensis genome ... 200 7e-50 CU207366_439(CU207366|pid:none) Gramella forsetii KT0803 complet... 200 7e-50 CT573071_2225(CT573071|pid:none) Kuenenia stuttgartiensis genome... 199 1e-49 CU234118_5127(CU234118|pid:none) Bradyrhizobium sp. ORS278,compl... 198 4e-49 CP000494_5544(CP000494|pid:none) Bradyrhizobium sp. BTAi1, compl... 197 6e-49 CP000878_189(CP000878|pid:none) Prochlorococcus marinus str. MIT... 197 6e-49 CP001229_1432(CP001229|pid:none) Sulfurihydrogenibium azorense A... 197 8e-49 (O29689) RecName: Full=Probable cysteine desulfurase 2; ... 196 1e-48 DQ780244_1(DQ780244|pid:none) Endoriftia persephone 'Hot96_1+Hot... 196 1e-48 CP000097_2092(CP000097|pid:none) Synechococcus sp. CC9902, compl... 195 2e-48 AE006470_1968(AE006470|pid:none) Chlorobium tepidum TLS, complet... 195 2e-48 CP001099_239(CP001099|pid:none) Chlorobaculum parvum NCIB 8327, ... 195 3e-48 CP001390_1671(CP001390|pid:none) Geobacter sp. FRC-32, complete ... 194 4e-48 CP001147_1268(CP001147|pid:none) Thermodesulfovibrio yellowstoni... 194 7e-48 CP000478_2782(CP000478|pid:none) Syntrophobacter fumaroxidans MP... 193 9e-48 CP000577_2165(CP000577|pid:none) Rhodobacter sphaeroides ATCC 17... 193 1e-47 CP000360_2271(CP000360|pid:none) Acidobacteria bacterium Ellin34... 193 1e-47 CP001150_1865(CP001150|pid:none) Rhodobacter sphaeroides KD131 c... 193 1e-47 AP009510_268(AP009510|pid:none) Uncultured Termite group 1 bacte... 192 2e-47 AB112427_1(AB112427|pid:none) Entamoeba histolytica EhnifS mRNA ... 192 2e-47 BX548175_2626(BX548175|pid:none) Prochlorococcus marinus MIT9313... 192 3e-47 CP000099_1685(CP000099|pid:none) Methanosarcina barkeri str. Fus... 192 3e-47 (P23120) RecName: Full=Cysteine desulfurase; EC=2.8.1.7... 192 3e-47 CP001322_5180(CP001322|pid:none) Desulfatibacillum alkenivorans ... 191 3e-47 AF001780_4(AF001780|pid:none) Cyanothece PCC 8801 NifP (nifP), n... 191 4e-47 AE017180_2556(AE017180|pid:none) Geobacter sulfurreducens PCA, c... 191 4e-47 AM420293_2545(AM420293|pid:none) Saccharopolyspora erythraea NRR... 191 6e-47 CP001230_1053(CP001230|pid:none) Persephonella marina EX-H1, com... 190 1e-46 CP000463_4480(CP000463|pid:none) Rhodopseudomonas palustris BisA... 189 1e-46 CP001068_1970(CP001068|pid:none) Ralstonia pickettii 12J chromos... 189 1e-46 AP006840_2390(AP006840|pid:none) Symbiobacterium thermophilum IA... 189 2e-46 CP000860_851(CP000860|pid:none) Candidatus Desulforudis audaxvia... 188 3e-46 CP000230_1064(CP000230|pid:none) Rhodospirillum rubrum ATCC 1117... 188 4e-46 (P55690) RecName: Full=Cysteine desulfurase; EC=2.8.1.7... 186 1e-45 CP000698_2432(CP000698|pid:none) Geobacter uraniireducens Rf4, c... 186 1e-45 CP000853_1784(CP000853|pid:none) Alkaliphilus oremlandii OhILAs,... 186 2e-45 EU523110_1(EU523110|pid:none) Achromobacter xylosoxidans cystein... 185 2e-45 BX548174_177(BX548174|pid:none) Prochlorococcus marinus MED4 com... 185 2e-45 CP001130_1337(CP001130|pid:none) Hydrogenobaculum sp. Y04AAS1, c... 185 3e-45 CP000949_3049(CP000949|pid:none) Pseudomonas putida W619, comple... 184 4e-45 AF000116_1(AF000116|pid:none) Candida maltosa strain L4 tRNA spl... 184 5e-45 CP000301_4395(CP000301|pid:none) Rhodopseudomonas palustris BisB... 184 5e-45 CP000392_6(CP000392|pid:none) Mesorhizobium sp. BNC1 plasmid 3, ... 184 7e-45 CP000119_300(CP000119|pid:none) Anabaena variabilis ATCC 29413 p... 184 7e-45 AP008226_456(AP008226|pid:none) Thermus thermophilus HB8 genomic... 184 7e-45 CP001279_773(CP001279|pid:none) Nautilia profundicola AmH, compl... 184 7e-45 CP001472_1536(CP001472|pid:none) Acidobacterium capsulatum ATCC ... 183 9e-45 CP000776_42(CP000776|pid:none) Campylobacter hominis ATCC BAA-38... 183 9e-45 CP000142_1981(CP000142|pid:none) Pelobacter carbinolicus DSM 238... 183 1e-44 CP000075_3219(CP000075|pid:none) Pseudomonas syringae pv. syring... 183 1e-44 CP000812_711(CP000812|pid:none) Thermotoga lettingae TMO, comple... 183 1e-44 CT971583_2311(CT971583|pid:none) Synechococcus WH7803 complete g... 182 2e-44 CP000283_1083(CP000283|pid:none) Rhodopseudomonas palustris BisB... 182 2e-44 AP009384_3411(AP009384|pid:none) Azorhizobium caulinodans ORS 57... 182 2e-44 AP009049_732(AP009049|pid:none) Clostridium kluyveri NBRC 12016 ... 182 3e-44 DQ981517_1(DQ981517|pid:none) Uncultured bacterium clone OIP 1B9... 182 3e-44 AI2191(AI2191) class-V aminotransferase [imported] - Nostoc sp. ... 180 8e-44 CP001096_5015(CP001096|pid:none) Rhodopseudomonas palustris TIE-... 180 8e-44 AE016853_260(AE016853|pid:none) Pseudomonas syringae pv. tomato ... 180 1e-43 AY941099_6(AY941099|pid:none) Leptospirillum ferrooxidans plasmi... 180 1e-43 CT573326_3103(CT573326|pid:none) Pseudomonas entomophila str. L4... 179 2e-43 CP000764_2957(CP000764|pid:none) Bacillus cereus subsp. cytotoxi... 179 2e-43 CP000094_3907(CP000094|pid:none) Pseudomonas fluorescens Pf0-1, ... 179 2e-43 AP006840_641(AP006840|pid:none) Symbiobacterium thermophilum IAM... 179 2e-43 CP000117_4827(CP000117|pid:none) Anabaena variabilis ATCC 29413,... 179 2e-43 CP000922_732(CP000922|pid:none) Anoxybacillus flavithermus WK1, ... 178 3e-43 CP000384_1862(CP000384|pid:none) Mycobacterium sp. MCS, complete... 178 4e-43 CP000058_4824(CP000058|pid:none) Pseudomonas syringae pv. phaseo... 178 4e-43 CP000386_1335(CP000386|pid:none) Rubrobacter xylanophilus DSM 99... 177 5e-43 AP009386_134(AP009386|pid:none) Burkholderia multivorans ATCC 17... 177 7e-43 CP000959_901(CP000959|pid:none) Burkholderia cenocepacia MC0-3 c... 177 9e-43 CP000075_134(CP000075|pid:none) Pseudomonas syringae pv. syringa... 176 1e-42 AM747721_463(AM747721|pid:none) Burkholderia cenocepacia J2315 c... 176 1e-42 CU466930_1609(CU466930|pid:none) Candidatus Cloacamonas acidamin... 175 2e-42 AE016879_4272(AE016879|pid:none) Bacillus anthracis str. Ames, c... 174 4e-42 CP000926_2065(CP000926|pid:none) Pseudomonas putida GB-1, comple... 174 4e-42 CP000353_1602(CP000353|pid:none) Ralstonia metallidurans CH34 me... 174 4e-42 CP000246_1631(CP000246|pid:none) Clostridium perfringens ATCC 13... 174 6e-42 CP000521_1795(CP000521|pid:none) Acinetobacter baumannii ATCC 17... 174 6e-42 CP001103_123(CP001103|pid:none) Alteromonas macleodii 'Deep ecot... 174 6e-42 CP000612_984(CP000612|pid:none) Desulfotomaculum reducens MI-1, ... 174 7e-42 CP000557_2455(CP000557|pid:none) Geobacillus thermodenitrificans... 174 7e-42 CP000975_2470(CP000975|pid:none) Methylacidiphilum infernorum V4... 173 9e-42 CP000447_2075(CP000447|pid:none) Shewanella frigidimarina NCIMB ... 173 9e-42 CP001132_1229(CP001132|pid:none) Acidithiobacillus ferrooxidans ... 173 9e-42 AE000516_3216(AE000516|pid:none) Mycobacterium tuberculosis CDC1... 173 1e-41 CP001338_1588(CP001338|pid:none) Candidatus Methanosphaerula pal... 172 2e-41 CP000511_2069(CP000511|pid:none) Mycobacterium vanbaalenii PYR-1... 172 2e-41 CP001132_185(CP001132|pid:none) Acidithiobacillus ferrooxidans A... 172 2e-41 BA000016_1413(BA000016|pid:none) Clostridium perfringens str. 13... 172 2e-41 AP008955_4115(AP008955|pid:none) Brevibacillus brevis NBRC 10059... 172 2e-41 CP001107_1834(CP001107|pid:none) Eubacterium rectale ATCC 33656,... 172 2e-41 CP000615_628(CP000615|pid:none) Burkholderia vietnamiensis G4 ch... 172 2e-41 BA000028_2015(BA000028|pid:none) Oceanobacillus iheyensis HTE831... 172 3e-41 CP000702_977(CP000702|pid:none) Thermotoga petrophila RKU-1, com... 172 3e-41 CP000828_4654(CP000828|pid:none) Acaryochloris marina MBIC11017,... 171 4e-41 AE017282_207(AE017282|pid:none) Methylococcus capsulatus str. Ba... 171 4e-41 BX571869_140(BX571869|pid:none) Photorhabdus luminescens subsp. ... 171 5e-41 CP000750_3531(CP000750|pid:none) Kineococcus radiotolerans SRS30... 171 5e-41 CP001078_2550(CP001078|pid:none) Clostridium botulinum E3 str. A... 171 6e-41 CP000969_1125(CP000969|pid:none) Thermotoga sp. RQ2, complete ge... 170 8e-41 CP000454_2707(CP000454|pid:none) Arthrobacter sp. FB24, complete... 170 8e-41 CP000479_3731(CP000479|pid:none) Mycobacterium avium 104, comple... 170 1e-40 CP000481_685(CP000481|pid:none) Acidothermus cellulolyticus 11B ... 169 1e-40 CP000001_815(CP000001|pid:none) Bacillus cereus E33L, complete g... 169 1e-40 BX294149_52(BX294149|pid:none) Rhodopirellula baltica SH 1 compl... 169 2e-40 EF210454_79(EF210454|pid:none) Streptomyces lividans strain 66 g... 169 2e-40 CP000471_3025(CP000471|pid:none) Magnetococcus sp. MC-1, complet... 169 2e-40 DQ075322_2(DQ075322|pid:none) Streptomyces lividans sulfur DNA m... 169 2e-40 CP000076_4093(CP000076|pid:none) Pseudomonas fluorescens Pf-5, c... 169 2e-40 AE016958_3058(AE016958|pid:none) Mycobacterium avium subsp. para... 169 2e-40 CP000812_709(CP000812|pid:none) Thermotoga lettingae TMO, comple... 169 2e-40 CP001104_1115(CP001104|pid:none) Eubacterium eligens ATCC 27750,... 169 2e-40 CP000438_3021(CP000438|pid:none) Pseudomonas aeruginosa UCBPP-PA... 169 2e-40 CP000769_1086(CP000769|pid:none) Anaeromyxobacter sp. Fw109-5, c... 168 3e-40 CP000513_1139(CP000513|pid:none) Dichelobacter nodosus VCS1703A,... 168 3e-40 AP008934_1139(AP008934|pid:none) Staphylococcus saprophyticus su... 168 4e-40 CP000480_2277(CP000480|pid:none) Mycobacterium smegmatis str. MC... 168 4e-40 AP006618_4284(AP006618|pid:none) Nocardia farcinica IFM 10152 DN... 168 4e-40 CP000975_457(CP000975|pid:none) Methylacidiphilum infernorum V4,... 167 5e-40 AL646053_173(AL646053|pid:none) Ralstonia solanacearum GMI1000 m... 167 5e-40 AY914895_1(AY914895|pid:none) Schistosoma japonicum NFS1 nitroge... 167 5e-40 AP008937_785(AP008937|pid:none) Lactobacillus fermentum IFO 3956... 166 1e-39 CP000025_284(CP000025|pid:none) Campylobacter jejuni RM1221, com... 166 2e-39 DQ826153_1(DQ826153|pid:none) Lactobacillus helveticus CNRZ32 pu... 166 2e-39 CP001037_2315(CP001037|pid:none) Nostoc punctiforme PCC 73102, c... 166 2e-39 CP000517_698(CP000517|pid:none) Lactobacillus helveticus DPC 457... 165 3e-39 AL111168_214(AL111168|pid:none) Campylobacter jejuni subsp. jeju... 165 3e-39 CP000814_216(CP000814|pid:none) Campylobacter jejuni subsp. jeju... 165 3e-39 CP000474_2419(CP000474|pid:none) Arthrobacter aurescens TC1, com... 164 6e-39 CP000474_2594(CP000474|pid:none) Arthrobacter aurescens TC1, com... 164 6e-39 CP001229_1665(CP001229|pid:none) Sulfurihydrogenibium azorense A... 164 6e-39 CP000768_196(CP000768|pid:none) Campylobacter jejuni subsp. doyl... 164 7e-39 AE017333_2755(AE017333|pid:none) Bacillus licheniformis DSM 13, ... 163 1e-38 CP001341_2256(CP001341|pid:none) Arthrobacter chlorophenolicus A... 163 1e-38 CP000088_593(CP000088|pid:none) Thermobifida fusca YX, complete ... 163 1e-38 CP000480_1210(CP000480|pid:none) Mycobacterium smegmatis str. MC... 163 1e-38 CP000813_2358(CP000813|pid:none) Bacillus pumilus SAFR-032, comp... 162 2e-38 BA000039_912(BA000039|pid:none) Thermosynechococcus elongatus BP... 162 2e-38 AM778949_60(AM778949|pid:none) Microcystis aeruginosa PCC 7806 g... 162 3e-38 CU458896_1079(CU458896|pid:none) Mycobacterium abscessus chromos... 162 3e-38 CP000568_1054(CP000568|pid:none) Clostridium thermocellum ATCC 2... 161 4e-38 CP000850_1078(CP000850|pid:none) Salinispora arenicola CNS-205, ... 161 5e-38 AP006716_1297(AP006716|pid:none) Staphylococcus haemolyticus JCS... 161 5e-38 CR954247_97(CR954247|pid:none) Pseudoalteromonas haloplanktis st... 160 6e-38 AE001437_2927(AE001437|pid:none) Clostridium acetobutylicum ATCC... 160 6e-38 CP000159_1812(CP000159|pid:none) Salinibacter ruber DSM 13855, c... 160 8e-38 AL009126_2854(AL009126|pid:none) Bacillus subtilis subsp. subtil... 160 8e-38 AE017180_2770(AE017180|pid:none) Geobacter sulfurreducens PCA, c... 160 8e-38 CP000033_1105(CP000033|pid:none) Lactobacillus acidophilus NCFM,... 160 1e-37 CP000251_1045(CP000251|pid:none) Anaeromyxobacter dehalogenans 2... 159 1e-37 AP009552_1482(AP009552|pid:none) Microcystis aeruginosa NIES-843... 159 2e-37 AY458647_84(AY458647|pid:none) Uncultured marine bacterium 580 c... 159 2e-37 CP001359_1159(CP001359|pid:none) Anaeromyxobacter dehalogenans 2... 159 2e-37 AP007281_583(AP007281|pid:none) Lactobacillus reuteri JCM 1112 D... 159 2e-37 EU636774_1(EU636774|pid:none) Debaryomyces polymorphus strain VK... 159 2e-37 AE016877_4195(AE016877|pid:none) Bacillus cereus ATCC 14579, com... 158 3e-37 CP001098_2187(CP001098|pid:none) Halothermothrix orenii H 168, c... 158 3e-37 CP001341_2419(CP001341|pid:none) Arthrobacter chlorophenolicus A... 158 3e-37 CP001230_215(CP001230|pid:none) Persephonella marina EX-H1, comp... 158 4e-37 CP001291_2243(CP001291|pid:none) Cyanothece sp. PCC 7424, comple... 158 4e-37 BA000033_1572(BA000033|pid:none) Staphylococcus aureus subsp. au... 158 4e-37 AP009324_1610(AP009324|pid:none) Staphylococcus aureus subsp. au... 157 7e-37 AP009153_1131(AP009153|pid:none) Gemmatimonas aurantiaca T-27 DN... 157 7e-37 CP000413_1143(CP000413|pid:none) Lactobacillus gasseri ATCC 3332... 157 9e-37 CP001472_3039(CP001472|pid:none) Acidobacterium capsulatum ATCC ... 156 2e-36 AL583923_51(AL583923|pid:none) Mycobacterium leprae strain TN co... 155 2e-36 CP001348_1647(CP001348|pid:none) Clostridium cellulolyticum H10,... 155 3e-36 AP010904_3710(AP010904|pid:none) Desulfovibrio magneticus RS-1 D... 155 3e-36 CP000949_3652(CP000949|pid:none) Pseudomonas putida W619, comple... 154 5e-36 CP000764_2993(CP000764|pid:none) Bacillus cereus subsp. cytotoxi... 154 5e-36 CP001287_3873(CP001287|pid:none) Cyanothece sp. PCC 8801, comple... 154 5e-36
>AJ720039_1(AJ720039|pid:none) Gallus gallus mRNA for hypothetical protein, clone 9m12. Length = 445
Score = 401 bits (1031), Expect = e-110 Identities = 196/312 (62%), Positives = 245/312 (78%) Frame = +2
Query: 146 KEKPIITTVTEHKCILDSCRHLEMEGFKVTYLPVGENGLVDLELLKNTITPQTSLVTIMA 325 ++K IITT TEHKC+LDSCR LE EGF++TYLPV +NGL+DL+ L+ P TSLV++MA Sbjct: 133 RKKHIITTQTEHKCVLDSCRSLEAEGFQITYLPVQKNGLIDLKELEAAFQPDTSLVSVMA 192
Query: 326 VNNEIGVVQPIKEIGKICRENGVFFHTDAAQAVGKIPIDVNDMNIDLLSISGHKIYGPKG 505 VNNEIGV QPI++IG+ICR VFFHTDAAQAVGKIP+DVND IDL+SISGHKIYGPKG Sbjct: 193 VNNEIGVKQPIRDIGEICRARQVFFHTDAAQAVGKIPLDVNDSKIDLMSISGHKIYGPKG 252
Query: 506 VGALFXXXXXXXXXXXXXXGGGQERGIRSGTVPSTLAVGLGAACDIALKEMNHDAAWVKY 685 VGA++ GGGQERG+RSGTVP+ LAVGLGAAC++A +EM +D + Sbjct: 253 VGAIYVRRRPRVRLEPLQSGGGQERGLRSGTVPTPLAVGLGAACEVAQEEMEYDHKRISQ 312
Query: 686 LYDRLLKGITDNIPNVKVNGDLNARYYGNLNISFSYVEGESLLMAIKDVXXXXXXXXXXX 865 L +RL+ I +P+V +NGD RY G +N+SF+YVEGESLLMA+KDV Sbjct: 313 LAERLVTKILSEVPDVVMNGDREHRYPGCINLSFAYVEGESLLMALKDVALSSGSACTSA 372
Query: 866 XLEPSYVLRSLGVEEDMAHSSIRFGIGRFTTEQEIDYTIEILKKNVQRLRDMSPLWEMVQ 1045 LEPSYVLR++G +ED+AHSSIRFGIGRFTTE+EIDYT++ ++V+RLR+MSPLWEMVQ Sbjct: 373 SLEPSYVLRAIGADEDLAHSSIRFGIGRFTTEEEIDYTVQKCIQHVKRLREMSPLWEMVQ 432
Query: 1046 EGIDIKTIEWSQ 1081 +GID+K+I+WSQ Sbjct: 433 DGIDLKSIKWSQ 444
Lambda K H 0.318 0.134 0.401
Gapped Lambda K H 0.267 0.0410 0.140
Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 3236559 Number of Hits to DB: 1,698,525,015 Number of extensions: 34222376 Number of successful extensions: 86484 Number of sequences better than 10.0: 1882 Number of HSP's gapped: 84927 Number of HSP's successfully gapped: 1885 Length of query: 396 Length of database: 1,051,180,864 Length adjustment: 131 Effective length of query: 265 Effective length of database: 627,191,635 Effective search space: 166205783275 Effective search space used: 166205783275 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 32 (16.9 bits)
|