| Homology vs DNA |
 Query= Contig-U11768-1 (Contig-U11768-1Q) /CSM_Contig/Contig-U11768-1Q.Seq.d
(1724 letters)
Database: ddbj_A
92,845,959 sequences; 95,242,211,685 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value N
(BJ444684) Dictyostelium discoideum cDNA clone:ddv57l03, 3' ... 1358 0.0 2
(BJ385938) Dictyostelium discoideum cDNA clone:ddc56k15, 3' ... 1281 0.0 2
(BJ380697) Dictyostelium discoideum cDNA clone:ddc39c05, 3' ... 1279 0.0 2
(BJ347430) Dictyostelium discoideum cDNA clone:dda27h01, 3' ... 1279 0.0 2
(BJ384749) Dictyostelium discoideum cDNA clone:ddc50g18, 3' ... 1098 0.0 1
(BJ380215) Dictyostelium discoideum cDNA clone:ddc37m10, 3' ... 1005 0.0 1
(C90457) Dictyostelium discoideum slug cDNA, clone SSI556. 704 0.0 3
(BJ426101) Dictyostelium discoideum cDNA clone:ddv57l03, 5' ... 325 0.0 5
(AU261792) Dictyostelium discoideum vegetative cDNA clone:VS... 678 0.0 2
(BJ366451) Dictyostelium discoideum cDNA clone:ddc39c05, 5' ... 220 0.0 6
(BJ371093) Dictyostelium discoideum cDNA clone:ddc56k15, 5' ... 220 0.0 6
(BJ369439) Dictyostelium discoideum cDNA clone:ddc50g18, 5' ... 226 0.0 5
(BJ366008) Dictyostelium discoideum cDNA clone:ddc37m10, 5' ... 527 0.0 2
(AU036992) Dictyostelium discoideum slug cDNA, clone SSA716. 363 e-153 3
(AU072732) Dictyostelium discoideum slug cDNA, clone SSA716. 476 e-129 1
(BJ330014) Dictyostelium discoideum cDNA clone:dda27h01, 5' ... 210 e-124 3
(EK000390) 1093025044752 Global-Ocean-Sampling_GS-30-02-01-1... 48 4e-07 2
(EJ999536) 1093025022826 Global-Ocean-Sampling_GS-30-02-01-1... 48 4e-07 2
(EJ601491) 1092961190304 Global-Ocean-Sampling_GS-29-01-01-1... 50 4e-07 2
(AE014821) Plasmodium falciparum 3D7 chromosome 14 section 6... 38 6e-07 12
(EJ727947) 1092959692474 Global-Ocean-Sampling_GS-30-02-01-1... 40 5e-06 3
(EK107811) 1092963069619 Global-Ocean-Sampling_GS-31-01-01-1... 46 2e-05 2
(EJ276951) 1095366025521 Global-Ocean-Sampling_GS-27-01-01-1... 40 5e-05 3
(EJ217273) 1092351128836 Global-Ocean-Sampling_GS-27-01-01-1... 42 6e-05 3
(EJ940694) 1093018863227 Global-Ocean-Sampling_GS-30-02-01-1... 34 8e-05 3
(EJ991421) 1093023052256 Global-Ocean-Sampling_GS-30-02-01-1... 36 8e-05 3
(AC116960) Dictyostelium discoideum chromosome 2 map complem... 42 2e-04 15
(EJ017626) 1095439020381 Global-Ocean-Sampling_GS-26-01-01-1... 52 2e-04 2
(AC117176) Dictyostelium discoideum chromosome 2 map 5018074... 32 4e-04 15
(CP000361) Arcobacter butzleri RM4018, complete genome. 46 7e-04 19
(FC639915) CAXU4492.rev CAXU Lottia gigantea from female gon... 40 0.001 3
(FC639916) CAXU4492.fwd CAXU Lottia gigantea from female gon... 40 0.002 3
(AC141709) Apis mellifera clone CH224-56H6, WORKING DRAFT SE... 50 0.002 5
(EJ088196) 1095460133977 Global-Ocean-Sampling_GS-26-01-01-1... 42 0.002 2
(EJ983632) 1093022170778 Global-Ocean-Sampling_GS-30-02-01-1... 40 0.003 3
(EK427165) 1095516039443 Global-Ocean-Sampling_GS-31-01-01-1... 44 0.004 2
(EJ389366) 1092963893635 Global-Ocean-Sampling_GS-28-01-01-1... 38 0.004 2
(EJ717062) 1092959427404 Global-Ocean-Sampling_GS-30-02-01-1... 40 0.004 2
(ER464195) 1092963912635 Global-Ocean-Sampling_GS-35-01-01-1... 34 0.005 4
(AC005505) Plasmodium falciparum chromosome 12 clone 3D7, **... 46 0.012 9
(AC117070) Dictyostelium discoideum chromosome 2 map 2097701... 36 0.013 12
(CP001078) Clostridium botulinum E3 str. Alaska E43, complet... 38 0.013 20
(EK232442) 1095460184445 Global-Ocean-Sampling_GS-31-01-01-1... 36 0.015 2
(FC798219) CBGC25288.fwd CBGC Lottia gigantea 15h 18h embryo... 40 0.018 3
(AL844509) Plasmodium falciparum chromosome 13. 46 0.019 8
(FC748847) CBBI4173.fwd CBBI Lottia gigantea 26h,37h,61h Lar... 40 0.020 3
(FC749898) CBBI4799.fwd CBBI Lottia gigantea 26h,37h,61h Lar... 40 0.021 3
(FC794007) CBGC22643.fwd CBGC Lottia gigantea 15h 18h embryo... 40 0.022 3
(FC743598) CBBI13801.fwd CBBI Lottia gigantea 26h,37h,61h La... 40 0.023 3
(AC115599) Dictyostelium discoideum chromosome 2 map 4229098... 36 0.023 11
(FC565892) CAWF6268.fwd CAWF Lottia gigantea from mantle (H)... 40 0.023 3
(EK329686) 1095467018969 Global-Ocean-Sampling_GS-31-01-01-1... 38 0.023 3
(AE017332) Mycoplasma hyopneumoniae 232, complete genome. 40 0.023 19
(FC718698) CBBG12305.fwd CBBG Lottia gigantea 12,15,18h embr... 40 0.024 3
(FC757202) CBBI9896.rev CBBI Lottia gigantea 26h,37h,61h Lar... 40 0.024 3
(FC754228) CBBI7859.fwd CBBI Lottia gigantea 26h,37h,61h Lar... 40 0.024 3
(FC751784) CBBI5978.fwd CBBI Lottia gigantea 26h,37h,61h Lar... 40 0.024 3
(FC681167) CAXX14934.fwd CAXX Lottia gigantea from male gona... 40 0.024 3
(FC722750) CBBG14880.fwd CBBG Lottia gigantea 12,15,18h embr... 40 0.024 3
(FC559227) CAWF2182.fwd CAWF Lottia gigantea from mantle (H)... 40 0.024 3
(FC750385) CBBI5100.fwd CBBI Lottia gigantea 26h,37h,61h Lar... 40 0.024 3
(FC757203) CBBI9896.fwd CBBI Lottia gigantea 26h,37h,61h Lar... 40 0.024 3
(FC729267) CBBG5290.fwd CBBG Lottia gigantea 12,15,18h embry... 40 0.025 3
(FC702276) CAXX9897.fwd CAXX Lottia gigantea from male gonad... 40 0.025 3
(FC769846) CBBN530.fwd CBBN Lottia gigantea 3,4,5,6.5d Larva... 40 0.025 3
(FC719847) CBBG1303.fwd CBBG Lottia gigantea 12,15,18h embry... 40 0.025 3
(FC725486) CBBG2856.fwd CBBG Lottia gigantea 12,15,18h embry... 40 0.026 3
(FC750470) CBBI5158.fwd CBBI Lottia gigantea 26h,37h,61h Lar... 40 0.026 3
(FC717809) CBBG11737.fwd CBBG Lottia gigantea 12,15,18h embr... 40 0.026 3
(FC709971) CAXY609.fwd CAXY Lottia gigantea from male gonad ... 40 0.027 3
(FC723564) CBBG1551.fwd CBBG Lottia gigantea 12,15,18h embry... 40 0.027 3
(FC735719) CBBG9859.fwd CBBG Lottia gigantea 12,15,18h embry... 40 0.027 3
(FC751482) CBBI5781.fwd CBBI Lottia gigantea 26h,37h,61h Lar... 40 0.028 3
(FC620038) CAXT10314.fwd CAXT Lottia gigantea from mantle Lo... 40 0.028 3
(FC619290) CAXS9918.fwd CAXS Lottia gigantea from head, foot... 40 0.028 3
(FC715590) CBBG10228.fwd CBBG Lottia gigantea 12,15,18h embr... 40 0.028 3
(FC713647) CAXY8453.fwd CAXY Lottia gigantea from male gonad... 40 0.028 3
(EJ207237) 1092344362584 Global-Ocean-Sampling_GS-27-01-01-1... 40 0.029 3
(FC704844) CAXY2810.fwd CAXY Lottia gigantea from male gonad... 40 0.029 3
(FC745303) CBBI14836.fwd CBBI Lottia gigantea 26h,37h,61h La... 40 0.029 3
(FC646109) CAXU8189.fwd CAXU Lottia gigantea from female gon... 40 0.029 3
(BX936413) Zebrafish DNA sequence from clone CH211-48M9 in l... 44 0.030 6
(FC744957) CBBI14620.fwd CBBI Lottia gigantea 26h,37h,61h La... 40 0.030 3
(FC609621) CAXS4540.fwd CAXS Lottia gigantea from head, foot... 40 0.030 3
(FC641806) CAXU5611.fwd CAXU Lottia gigantea from female gon... 40 0.030 3
(CP000061) Aster yellows witches'-broom phytoplasma AYWB, co... 38 0.031 21
(EK368190) 1095469406165 Global-Ocean-Sampling_GS-31-01-01-1... 46 0.033 2
(ER525008) 1093015627203 Global-Ocean-Sampling_GS-35-01-01-1... 40 0.033 2
(ER369927) 1093023021537 Global-Ocean-Sampling_GS-34-01-01-1... 46 0.034 2
(AC116963) Dictyostelium discoideum chromosome 2 map 4657875... 44 0.044 10
(EJ312847) 1095403240862 Global-Ocean-Sampling_GS-27-01-01-1... 36 0.056 2
(EK427754) 1095516044317 Global-Ocean-Sampling_GS-31-01-01-1... 36 0.057 2
(EJ517247) 1092955105597 Global-Ocean-Sampling_GS-29-01-01-1... 36 0.057 2
(ER319316) 1092344165591 Global-Ocean-Sampling_GS-34-01-01-1... 38 0.057 2
(AE014850) Plasmodium falciparum 3D7 chromosome 12, section ... 46 0.059 9
(AC116986) Dictyostelium discoideum chromosome 2 map 2234041... 38 0.063 15
(AE001419) Plasmodium falciparum 3D7 chromosome 2 section 56... 40 0.064 5
(ER390134) 1094428835957 Global-Ocean-Sampling_GS-34-01-01-1... 52 0.072 1
(EJ965301) 1093022037638 Global-Ocean-Sampling_GS-30-02-01-1... 52 0.072 1
(EJ954376) 1093018965191 Global-Ocean-Sampling_GS-30-02-01-1... 52 0.072 1
>(BJ444684) Dictyostelium discoideum cDNA clone:ddv57l03, 3' end,
single read.
Length = 753
Score = 1358 bits (685), Expect(2) = 0.0
Identities = 688/689 (99%)
Strand = Plus / Minus
Query: 819 tgccgatttatcaaatcttatcaatactgccggctattaaagccgttcaaaatggtaaag 878
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 752 tgccgatttatcaaatcttatcaatactgccggctattaaagccgttcaaaatggtaaag 693
Query: 879 aaaccattagtatcaaacaaatcgatgatgcaagagatgatattttaatgggtcgtgctc 938
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 692 aaaccattagtatcaaacaaatcgatgatgcaagagatgatattttaatgggtcgtgctc 633
Query: 939 gtttgaatgctgtaatgagtgaagaagcaagacgtaacactgcctatcatgaagctggtc 998
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 632 gtttgaatgctgtaatgagtgaagaagcaagacgtaacactgcctatcatgaagctggtc 573
Query: 999 atgctttggtagcagcaatgactgaagccgccgacccaattcataaagccactatcgttc 1058
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 572 atgctttggtagcagcaatgactgaagccgccgacccaattcataaagccactatcgttc 513
Query: 1059 aaagaggtcaagctttaggtatggtttcacaattgccagagatggatcatgtccaatata 1118
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 512 aaagaggtcaagctttaggtatggtttcacaattgccagagatggatcatgtccaatata 453
Query: 1119 ctcgtaaacaaatgatggctcgtcttgcaatttgtttggctggtcgtgccgctgaagaaa 1178
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 452 ctcgtaaacaaatgatggctcgtcttgcaatttgtttggctggtcgtgccgctgaagaaa 393
Query: 1179 tctttttcggtgtcgatggtgttacaagcggtgcatcatccgatttccaacaagcttctt 1238
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 392 tctttttcggtgtcgatggtgttacaagcggtgcatcatccgatttccaacaagcttctt 333
Query: 1239 ctttggctttctctatgattaccaaatggggtatgtccgataaagttggtttcatctatc 1298
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 332 ctttggctttctctatgattaccaaatggggtatgtccgataaagttggtttcatctatc 273
Query: 1299 ataaagataaaacttcaccagaggttcaaaagatcatcgaagatgaagttaaagatcttt 1358
|||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||
Sbjct: 272 ataaagataaaacttcaccagaggtttaaaagatcatcgaagatgaagttaaagatcttt 213
Query: 1359 tagataaacaatatcaatactctaaagaattaatcattaaaaatagagataacatggaga 1418
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 212 tagataaacaatatcaatactctaaagaattaatcattaaaaatagagataacatggaga 153
Query: 1419 aattagtcggccaattattggagaaagaaactttaactggtgaagaaattttaaagattt 1478
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 152 aattagtcggccaattattggagaaagaaactttaactggtgaagaaattttaaagattt 93
Query: 1479 taaatccaaaagtaactttaccaattcaa 1507
|||||||||||||||||||||||||||||
Sbjct: 92 taaatccaaaagtaactttaccaattcaa 64
Score = 61.9 bits (31), Expect(2) = 0.0
Identities = 31/31 (100%)
Strand = Plus / Minus
Query: 1530 tttctgttccatcttcaccatcttcatcatc 1560
|||||||||||||||||||||||||||||||
Sbjct: 41 tttctgttccatcttcaccatcttcatcatc 11
Lambda K H
1.37 0.711 1.31
Matrix: blastn matrix:1 -3
Number of Sequences: 92845959
Number of Hits to DB: 1,952,650,292
Number of extensions: 158437711
Number of successful extensions: 12412960
Number of sequences better than 10.0: 511
Length of query: 1724
Length of database: 95,242,211,685
Length adjustment: 24
Effective length of query: 1700
Effective length of database: 97,308,875,965
Effective search space: 165425089140500
Effective search space used: 165425089140500
X1: 11 (21.8 bits)
S2: 22 (44.1 bits)
|
| Homology vs Protein |
Query= Contig-U11768-1 (Contig-U11768-1Q) /CSM_Contig/Contig-U11768-1Q.Seq.d
(1724 letters)
Database: nrp_B
3,236,559 sequences; 1,051,180,864 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AJ635223_1(AJ635223|pid:none) Pisum sativum mRNA for ftsH-like p... 211 7e-53
(Q8LQJ8) RecName: Full=Cell division protease ftsH homolog 5, mi... 209 3e-52
CP001391_1040(CP001391|pid:none) Wolbachia sp. wRi, complete gen... 208 6e-52
BT063337_1(BT063337|pid:none) Zea mays full-length cDNA clone ZM... 206 3e-51
(Q8LQJ9) RecName: Full=Cell division protease ftsH homolog 4, mi... 205 5e-51
CR954217_1(CR954217|pid:none) Ostreococcus tauri strain OTTH0595... 204 6e-51
AE017196_1130(AE017196|pid:none) Wolbachia endosymbiont of Droso... 204 8e-51
CP000596_9(CP000596|pid:none) Ostreococcus lucimarinus CCE9901 c... 204 1e-50
(O80983) RecName: Full=Cell division protease ftsH homolog 4, mi... 203 2e-50
CP000236_1047(CP000236|pid:none) Ehrlichia chaffeensis str. Arka... 203 2e-50
DQ308538_1(DQ308538|pid:none) Triticum monococcum cultivar DV92 ... 202 2e-50
CR767821_870(CR767821|pid:none) Ehrlichia ruminantium strain Wel... 199 3e-49
CP000107_859(CP000107|pid:none) Ehrlichia canis str. Jake, compl... 199 3e-49
CP000248_76(CP000248|pid:none) Novosphingobium aromaticivorans D... 198 4e-49
AC133572_5(AC133572|pid:none) Medicago truncatula clone mth2-10o... 196 2e-48
(Q9FGM0) RecName: Full=Cell division protease ftsH homolog 11, c... 196 2e-48
AP008207_1861(AP008207|pid:none) Oryza sativa (japonica cultivar... 193 1e-47
AC133572_7(AC133572|pid:none) Medicago truncatula clone mth2-10o... 193 1e-47
CP000774_2117(CP000774|pid:none) Parvibaculum lavamentivorans DS... 191 7e-47
CP000237_406(CP000237|pid:none) Neorickettsia sennetsu strain Mi... 190 2e-46
AM910996_571(AM910996|pid:none) Plasmodium knowlesi strain H chr... 189 4e-46
CP001196_3238(CP001196|pid:none) Oligotropha carboxidovorans OM5... 187 8e-46
AE014188_382(AE014188|pid:none) Plasmodium falciparum 3D7 chromo... 187 1e-45
AP009384_528(AP009384|pid:none) Azorhizobium caulinodans ORS 571... 187 1e-45
CP000390_3134(CP000390|pid:none) Mesorhizobium sp. BNC1, complet... 187 1e-45
(Q92JJ9) RecName: Full=Cell division protease ftsH homolog; ... 186 2e-45
CP000683_36(CP000683|pid:none) Rickettsia massiliae MTU5, comple... 186 2e-45
CP000758_1208(CP000758|pid:none) Ochrobactrum anthropi ATCC 4918... 186 2e-45
CP000847_68(CP000847|pid:none) Rickettsia akari str. Hartford, c... 186 3e-45
CP000781_3054(CP000781|pid:none) Xanthobacter autotrophicus Py2,... 185 4e-45
CP000872_1630(CP000872|pid:none) Brucella canis ATCC 23365 chrom... 185 5e-45
AE008917_342(AE008917|pid:none) Brucella melitensis 16M chromoso... 185 5e-45
BA000012_2998(BA000012|pid:none) Mesorhizobium loti MAFF303099 D... 185 5e-45
CP000409_41(CP000409|pid:none) Rickettsia canadensis str. McKiel... 184 7e-45
CP000463_4657(CP000463|pid:none) Rhodopseudomonas palustris BisA... 184 9e-45
(Q1RGP0) RecName: Full=Cell division protease ftsH homolog; ... 184 1e-44
(Q68XR9) RecName: Full=Cell division protease ftsH homolog; ... 184 1e-44
(A2ZVG7) RecName: Full=Cell division protease ftsH homolog 9, ch... 184 1e-44
AE014291_1639(AE014291|pid:none) Brucella suis 1330 chromosome I... 183 1e-44
BX572596_178(BX572596|pid:none) Rhodopseudomonas palustris CGA00... 183 1e-44
AE008312_4(AE008312|pid:none) Agrobacterium tumefaciens str. C58... 183 2e-44
(Q9ZEA2) RecName: Full=Cell division protease ftsH homolog; ... 182 3e-44
CP001010_725(CP001010|pid:none) Polynucleobacter necessarius sub... 182 3e-44
CP000830_1108(CP000830|pid:none) Dinoroseobacter shibae DFL 12, ... 182 3e-44
CP000084_597(CP000084|pid:none) Candidatus Pelagibacter ubique H... 182 3e-44
CP001029_5282(CP001029|pid:none) Methylobacterium populi BJ001, ... 182 3e-44
CP000250_1814(CP000250|pid:none) Rhodopseudomonas palustris HaA2... 182 3e-44
CP001074_3647(CP001074|pid:none) Rhizobium etli CIAT 652, comple... 181 6e-44
CP000133_3410(CP000133|pid:none) Rhizobium etli CFN 42, complete... 181 6e-44
CP001349_5283(CP001349|pid:none) Methylobacterium nodulans ORS 2... 181 7e-44
CP001562_1546(CP001562|pid:none) Bartonella grahamii as4aup, com... 181 1e-43
CP000283_4120(CP000283|pid:none) Rhodopseudomonas palustris BisB... 181 1e-43
AM260525_1861(AM260525|pid:none) Bartonella tribocorum CIP 10547... 181 1e-43
AP008981_1583(AP008981|pid:none) Orientia tsutsugamushi str. Ike... 180 1e-43
AJ720816_1(AJ720816|pid:none) Gallus gallus mRNA for hypothetica... 180 1e-43
CR954210_333(CR954210|pid:none) Ostreococcus tauri strain OTTH05... 180 1e-43
BX897699_1419(BX897699|pid:none) Bartonella henselae strain Hous... 180 2e-43
CP000319_3333(CP000319|pid:none) Nitrobacter hamburgensis X14, c... 180 2e-43
BX897700_1126(BX897700|pid:none) Bartonella quintana str. Toulou... 179 2e-43
CP000301_4686(CP000301|pid:none) Rhodopseudomonas palustris BisB... 179 3e-43
CP000927_4405(CP000927|pid:none) Caulobacter sp. K31, complete g... 179 4e-43
CP000943_266(CP000943|pid:none) Methylobacterium sp. 4-46, compl... 179 4e-43
CP000699_4474(CP000699|pid:none) Sphingomonas wittichii RW1, com... 178 5e-43
CP000155_1181(CP000155|pid:none) Hahella chejuensis KCTC 2396, c... 178 6e-43
CP000849_1436(CP000849|pid:none) Rickettsia bellii OSU 85-389, c... 178 6e-43
AE008692_1659(AE008692|pid:none) Zymomonas mobilis subsp. mobili... 178 6e-43
CP000115_2695(CP000115|pid:none) Nitrobacter winogradskyi Nb-255... 177 8e-43
CP000356_1586(CP000356|pid:none) Sphingopyxis alaskensis RB2256,... 177 8e-43
CP000633_2652(CP000633|pid:none) Agrobacterium vitis S4 chromoso... 177 8e-43
CP000524_167(CP000524|pid:none) Bartonella bacilliformis KC583, ... 176 2e-42
AM494475_2168(AM494475|pid:none) Orientia tsutsugamushi Boryong ... 176 2e-42
CP000394_1110(CP000394|pid:none) Granulibacter bethesdensis CGDN... 176 2e-42
CP000494_6456(CP000494|pid:none) Bradyrhizobium sp. BTAi1, compl... 176 3e-42
CU234118_1114(CU234118|pid:none) Bradyrhizobium sp. ORS278,compl... 176 3e-42
AJ243808_2(AJ243808|pid:none) Bradyrhizobium japonicum yaeN and ... 176 3e-42
AE005673_3200(AE005673|pid:none) Caulobacter crescentus CB15, co... 176 3e-42
BC081751_1(BC081751|pid:none) Rattus norvegicus YME1-like 1 (S. ... 175 5e-42
AF151782_1(AF151782|pid:none) Homo sapiens ATP-dependent metallo... 174 9e-42
FM992691_500(FM992691|pid:none) Candida dubliniensis CD36 chromo... 174 9e-42
CR860283_1(CR860283|pid:none) Pongo abelii mRNA; cDNA DKFZp459F0... 174 9e-42
(Q96TA2) RecName: Full=ATP-dependent metalloprotease YME1L1; ... 174 9e-42
AB384745_1(AB384745|pid:none) Synthetic construct DNA, clone: pF... 174 9e-42
AB169750_1(AB169750|pid:none) Macaca fascicularis brain cDNA, cl... 174 9e-42
CP000697_362(CP000697|pid:none) Acidiphilium cryptum JF-5, compl... 173 2e-41
CP000284_780(CP000284|pid:none) Methylobacillus flagellatus KT, ... 172 3e-41
AM180252_188(AM180252|pid:none) Lawsonia intracellularis PHE/MN1... 172 4e-41
CP000362_1964(CP000362|pid:none) Roseobacter denitrificans OCh 1... 171 6e-41
CP000089_941(CP000089|pid:none) Dechloromonas aromatica RCB, com... 171 1e-40
CP001503_1100(CP001503|pid:none) Burkholderia glumae BGR1 chromo... 170 1e-40
CU207211_1100(CU207211|pid:none) Herminiimonas arsenicoxydans ch... 170 1e-40
AE013599_3710(AE013599|pid:none) Drosophila melanogaster chromos... 170 1e-40
CP000926_4689(CP000926|pid:none) Pseudomonas putida GB-1, comple... 170 1e-40
AB032368_6(AB032368|pid:none) Thermus thermophilus clpB, dafA, d... 170 2e-40
AE017221_1122(AE017221|pid:none) Thermus thermophilus HB27, comp... 170 2e-40
AB260935_7(AB260935|pid:none) Uncultured bacterium DNA, salt-str... 169 2e-40
CP000143_2271(CP000143|pid:none) Rhodobacter sphaeroides 2.4.1 c... 169 3e-40
CP001150_2021(CP001150|pid:none) Rhodobacter sphaeroides KD131 c... 169 3e-40
CP000521_2946(CP000521|pid:none) Acinetobacter baumannii ATCC 17... 169 3e-40
CP000510_783(CP000510|pid:none) Psychromonas ingrahamii 37, comp... 169 4e-40
CP000614_1232(CP000614|pid:none) Burkholderia vietnamiensis G4 c... 169 4e-40
CP000440_1169(CP000440|pid:none) Burkholderia ambifaria AMMD chr... 169 4e-40
BC150071_1(BC150071|pid:none) Bos taurus YME1-like 1 (S. cerevis... 168 5e-40
CP001614_2863(CP001614|pid:none) Teredinibacter turnerae T7901, ... 168 5e-40
CP000661_560(CP000661|pid:none) Rhodobacter sphaeroides ATCC 170... 168 5e-40
CP000378_810(CP000378|pid:none) Burkholderia cenocepacia AU 1054... 168 5e-40
AM747720_1264(AM747720|pid:none) Burkholderia cenocepacia J2315 ... 168 5e-40
AP009385_1197(AP009385|pid:none) Burkholderia multivorans ATCC 1... 168 6e-40
CU468230_742(CU468230|pid:none) Acinetobacter baumannii str. SDF... 168 6e-40
CP000086_2728(CP000086|pid:none) Burkholderia thailandensis E264... 167 8e-40
AE016820_97(AE016820|pid:none) Ashbya gossypii (= Eremothecium g... 167 8e-40
CP001154_2883(CP001154|pid:none) Laribacter hongkongensis HLHK9,... 167 8e-40
CP000270_3153(CP000270|pid:none) Burkholderia xenovorans LB400 c... 167 1e-39
CP000680_3588(CP000680|pid:none) Pseudomonas mendocina ymp, comp... 167 1e-39
CP001050_541(CP001050|pid:none) Neisseria gonorrhoeae NCCP11945,... 167 1e-39
AM421808_712(AM421808|pid:none) Neisseria meningitidis serogroup... 167 1e-39
AL157959_901(AL157959|pid:none) Neisseria meningitidis serogroup... 167 1e-39
CP001052_2803(CP001052|pid:none) Burkholderia phytofirmans PsJN ... 167 1e-39
AE002098_770(AE002098|pid:none) Neisseria meningitidis MC58, com... 167 1e-39
CR382125_291(CR382125|pid:none) Kluyveromyces lactis strain NRRL... 166 2e-39
AE017180_1798(AE017180|pid:none) Geobacter sulfurreducens PCA, c... 166 2e-39
AM260479_2384(AM260479|pid:none) Ralstonia eutropha H16 chromoso... 166 2e-39
(P54813) RecName: Full=Protein YME1 homolog; EC=3.4.24.... 166 2e-39
Z49128_5(Z49128|pid:none) Caenorhabditis elegans Cosmid M03C11, ... 166 2e-39
CP000094_771(CP000094|pid:none) Pseudomonas fluorescens Pf0-1, c... 166 2e-39
CR543861_2582(CR543861|pid:none) Acinetobacter sp. ADP1 complete... 166 2e-39
CP001197_54(CP001197|pid:none) Desulfovibrio vulgaris str. 'Miya... 166 2e-39
CT005272_280(CT005272|pid:none) Leishmania major strain Friedlin... 166 3e-39
AM181176_5143(AM181176|pid:none) Pseudomonas fluorescens SBW25 c... 166 3e-39
CP000103_482(CP000103|pid:none) Nitrosospira multiformis ATCC 25... 165 4e-39
CP000082_1738(CP000082|pid:none) Psychrobacter arcticus 273-4, c... 165 4e-39
CP001600_435(CP001600|pid:none) Edwardsiella ictaluri 93-146, co... 165 5e-39
CP000090_2152(CP000090|pid:none) Ralstonia eutropha JMP134 chrom... 165 5e-39
CP000352_2181(CP000352|pid:none) Ralstonia metallidurans CH34, c... 165 5e-39
CP000148_1869(CP000148|pid:none) Geobacter metallireducens GS-15... 165 5e-39
CP001281_1686(CP001281|pid:none) Thauera sp. MZ1T, complete geno... 164 7e-39
CP001147_615(CP001147|pid:none) Thermodesulfovibrio yellowstonii... 164 7e-39
BA000037_2715(BA000037|pid:none) Vibrio vulnificus YJ016 DNA, ch... 164 9e-39
CP000512_2571(CP000512|pid:none) Acidovorax citrulli AAC00-1, co... 164 9e-39
CP000386_1784(CP000386|pid:none) Rubrobacter xylanophilus DSM 99... 164 1e-38
CP000386_2148(CP000386|pid:none) Rubrobacter xylanophilus DSM 99... 164 1e-38
BC007795_1(BC007795|pid:none) Homo sapiens YME1-like 1 (S. cerev... 163 2e-38
X81067_1(X81067|pid:none) S.cerevisiae YTA11 gene. 163 2e-38
CP000934_2610(CP000934|pid:none) Cellvibrio japonicus Ueda107, c... 163 2e-38
CU459003_807(CU459003|pid:none) Magnetospirillum gryphiswaldense... 162 3e-38
CP000116_1133(CP000116|pid:none) Thiobacillus denitrificans ATCC... 162 3e-38
CU695239_399(CU695239|pid:none) Ralstonia solanacearum strain Mo... 162 3e-38
CP000539_2288(CP000539|pid:none) Acidovorax sp. JS42, complete g... 162 4e-38
CP000450_964(CP000450|pid:none) Nitrosomonas eutropha C91, compl... 162 4e-38
CP001068_1996(CP001068|pid:none) Ralstonia pickettii 12J chromos... 162 4e-38
CP000529_2586(CP000529|pid:none) Polaromonas naphthalenivorans C... 162 5e-38
CP000744_5397(CP000744|pid:none) Pseudomonas aeruginosa PA7, com... 162 5e-38
CP000472_1156(CP000472|pid:none) Shewanella piezotolerans WP3, c... 161 6e-38
BX571874_76(BX571874|pid:none) Photorhabdus luminescens subsp. l... 161 6e-38
AE017340_971(AE017340|pid:none) Idiomarina loihiensis L2TR, comp... 161 6e-38
CP000975_1906(CP000975|pid:none) Methylacidiphilum infernorum V4... 161 6e-38
AL954747_528(AL954747|pid:none) Nitrosomonas europaea ATCC 19718... 161 8e-38
CP000749_1008(CP000749|pid:none) Marinomonas sp. MWYL1, complete... 161 8e-38
D16332_1(D16332|pid:none) Saccharomyces cerevisiae OSD1 gene, co... 161 8e-38
AP009493_4088(AP009493|pid:none) Streptomyces griseus subsp. gri... 161 8e-38
CP000252_1527(CP000252|pid:none) Syntrophus aciditrophicus SB, c... 160 1e-37
AM286415_409(AM286415|pid:none) Yersinia enterocolitica subsp. e... 160 1e-37
CP000555_1268(CP000555|pid:none) Methylibium petroleiphilum PM1,... 160 1e-37
CP001013_2806(CP001013|pid:none) Leptothrix cholodnii SP-6, comp... 160 1e-37
CP000901_3635(CP000901|pid:none) Yersinia pestis Angola, complet... 160 1e-37
BA000030_4673(BA000030|pid:none) Streptomyces avermitilis MA-468... 160 1e-37
AP009153_1393(AP009153|pid:none) Gemmatimonas aurantiaca T-27 DN... 160 1e-37
FM211050_37(FM211050|pid:none) Photorhabdus asymbiotica subsp. a... 160 1e-37
AG0425(AG0425) cell division protein (EC 3.4.24.-) [imported] - ... 160 1e-37
AE009952_674(AE009952|pid:none) Yersinia pestis KIM, complete ge... 160 1e-37
CP001124_2614(CP001124|pid:none) Geobacter bemidjiensis Bem, com... 160 2e-37
CP000507_949(CP000507|pid:none) Shewanella amazonensis SB2B, com... 160 2e-37
BA000031_2463(BA000031|pid:none) Vibrio parahaemolyticus RIMD 22... 159 2e-37
BX640441_160(BX640441|pid:none) Bordetella bronchiseptica strain... 159 2e-37
BX640414_77(BX640414|pid:none) Bordetella pertussis strain Toham... 159 2e-37
AM167904_930(AM167904|pid:none) Bordetella avium 197N complete g... 159 3e-37
CP001358_1695(CP001358|pid:none) Desulfovibrio desulfuricans sub... 159 3e-37
CP000127_2468(CP000127|pid:none) Nitrosococcus oceani ATCC 19707... 159 3e-37
AM286690_322(AM286690|pid:none) Alcanivorax borkumensis SK2, com... 159 3e-37
(O59824) RecName: Full=Protein YME1 homolog; EC=3.4.24.... 159 3e-37
AM746676_7305(AM746676|pid:none) Sorangium cellulosum 'So ce 56'... 159 3e-37
BX248583_93(BX248583|pid:none) Blochmannia floridanus complete g... 159 3e-37
CP000789_3288(CP000789|pid:none) Vibrio harveyi ATCC BAA-1116 ch... 159 3e-37
CR380957_217(CR380957|pid:none) Candida glabrata strain CBS138 c... 159 3e-37
CP000471_434(CP000471|pid:none) Magnetococcus sp. MC-1, complete... 159 4e-37
CP000088_2888(CP000088|pid:none) Thermobifida fusca YX, complete... 159 4e-37
BA000021_231(BA000021|pid:none) Wigglesworthia glossinidia endos... 159 4e-37
AY458630_32(AY458630|pid:none) Uncultured marine bacterium 106 c... 159 4e-37
CP000020_471(CP000020|pid:none) Vibrio fischeri ES114 chromosome... 158 5e-37
CP000681_2824(CP000681|pid:none) Shewanella putrefaciens CN-32, ... 158 5e-37
CP000267_1974(CP000267|pid:none) Rhodoferax ferrireducens T118, ... 158 5e-37
AE003852_625(AE003852|pid:none) Vibrio cholerae O1 biovar eltor ... 158 5e-37
CP000304_3240(CP000304|pid:none) Pseudomonas stutzeri A1501, com... 158 5e-37
CP000826_481(CP000826|pid:none) Serratia proteamaculans 568, com... 158 7e-37
AY136287_1(AY136287|pid:none) Mus musculus clone 9A metalloprote... 158 7e-37
AE014299_1180(AE014299|pid:none) Shewanella oneidensis MR-1, com... 157 9e-37
CP000444_1077(CP000444|pid:none) Shewanella sp. MR-7, complete g... 157 9e-37
CP000961_3531(CP000961|pid:none) Shewanella woodyi ATCC 51908, c... 157 9e-37
CP000112_1511(CP000112|pid:none) Desulfovibrio desulfuricans G20... 157 9e-37
CP000544_1739(CP000544|pid:none) Halorhodospira halophila SL1, c... 157 9e-37
CP000446_1017(CP000446|pid:none) Shewanella sp. MR-4, complete g... 157 9e-37
AE015925_751(AE015925|pid:none) Chlamydophila caviae GPIC, compl... 157 1e-36
CP000542_210(CP000542|pid:none) Verminephrobacter eiseniae EF01-... 157 1e-36
AM884176_213(AM884176|pid:none) Chlamydia trachomatis strain L2/... 157 1e-36
CP000851_3055(CP000851|pid:none) Shewanella pealeana ATCC 700345... 157 1e-36
AE000783_788(AE000783|pid:none) Borrelia burgdorferi B31, comple... 157 1e-36
CR848038_720(CR848038|pid:none) Chlamydophila abortus strain S26... 157 1e-36
CP001144_3313(CP001144|pid:none) Salmonella enterica subsp. ente... 157 1e-36
CP000013_777(CP000013|pid:none) Borrelia garinii PBi, complete g... 156 2e-36
CP000822_4451(CP000822|pid:none) Citrobacter koseri ATCC BAA-895... 156 2e-36
FM954972_2365(FM954972|pid:none) Vibrio splendidus LGP32 chromos... 156 2e-36
AP006861_251(AP006861|pid:none) Chlamydophila felis Fe/C-56 DNA,... 156 2e-36
AE017220_3234(AE017220|pid:none) Salmonella enterica subsp. ente... 155 3e-36
AM902716_3543(AM902716|pid:none) Bordetella petrii strain DSM 12... 155 3e-36
CP000051_875(CP000051|pid:none) Chlamydia trachomatis A/HAR-13, ... 155 3e-36
CP001252_1094(CP001252|pid:none) Shewanella baltica OS223, compl... 155 3e-36
CU928178_557(CU928178|pid:none) Zygosaccharomyces rouxii strain ... 155 3e-36
AE002160_222(AE002160|pid:none) Chlamydia muridarum Nigg, comple... 155 3e-36
(P63343) RecName: Full=Cell division protease ftsH; EC=... 155 3e-36
(P71377) RecName: Full=Cell division protease ftsH homolog 1; ... 155 3e-36
CP000606_2827(CP000606|pid:none) Shewanella loihica PV-4, comple... 155 3e-36
CP000563_3189(CP000563|pid:none) Shewanella baltica OS155, compl... 155 3e-36
AE016827_964(AE016827|pid:none) Mannheimia succiniciproducens MB... 155 4e-36
CP001111_1467(CP001111|pid:none) Stenotrophomonas maltophilia R5... 155 4e-36
CP001157_4143(CP001157|pid:none) Azotobacter vinelandii DJ, comp... 155 4e-36
CP001616_2220(CP001616|pid:none) Tolumonas auensis DSM 9187, com... 155 4e-36
CP000964_525(CP000964|pid:none) Klebsiella pneumoniae 342, compl... 155 6e-36
CP000821_3387(CP000821|pid:none) Shewanella sediminis HAW-EB3, c... 154 7e-36
CP000083_3344(CP000083|pid:none) Colwellia psychrerythraea 34H, ... 154 7e-36
CP001321_465(CP001321|pid:none) Haemophilus parasuis SH0165, com... 154 7e-36
AE004439_438(AE004439|pid:none) Pasteurella multocida subsp. mul... 154 1e-35
CP000970_3333(CP000970|pid:none) Escherichia coli SMS-3-5, compl... 154 1e-35
EU016625_19(EU016625|pid:none) Uncultured marine microorganism H... 154 1e-35
AM270077_13(AM270077|pid:none) Aspergillus niger contig An04c016... 154 1e-35
CP000687_553(CP000687|pid:none) Actinobacillus pleuropneumoniae ... 154 1e-35
CP000034_3115(CP000034|pid:none) Shigella dysenteriae Sd197, com... 154 1e-35
CP000783_3471(CP000783|pid:none) Enterobacter sakazakii ATCC BAA... 154 1e-35
CP001091_641(CP001091|pid:none) Actinobacillus pleuropneumoniae ... 154 1e-35
CP000951_39(CP000951|pid:none) Synechococcus sp. PCC 7002, compl... 154 1e-35
AM743169_1635(AM743169|pid:none) Stenotrophomonas maltophilia K2... 153 2e-35
AP006840_126(AP006840|pid:none) Symbiobacterium thermophilum IAM... 153 2e-35
CP001287_271(CP001287|pid:none) Cyanothece sp. PCC 8801, complet... 153 2e-35
CU468135_341(CU468135|pid:none) Erwinia tasmaniensis strain ET1/... 153 2e-35
AP007155_929(AP007155|pid:none) Aspergillus oryzae RIB40 genomic... 153 2e-35
CP000941_62(CP000941|pid:none) Xylella fastidiosa M12, complete ... 152 3e-35
BX908798_640(BX908798|pid:none) Parachlamydia-related symbiont U... 152 3e-35
AP009552_382(AP009552|pid:none) Microcystis aeruginosa NIES-843 ... 152 3e-35
(P72991) RecName: Full=Cell division protease ftsH homolog 4; ... 152 4e-35
CP001472_1941(CP001472|pid:none) Acidobacterium capsulatum ATCC ... 152 4e-35
AM039952_1765(AM039952|pid:none) Xanthomonas campestris pv. vesi... 152 4e-35
AE008922_1688(AE008922|pid:none) Xanthomonas campestris pv. camp... 152 4e-35
CP000142_1094(CP000142|pid:none) Pelobacter carbinolicus DSM 238... 152 4e-35
CP001108_1731(CP001108|pid:none) Prosthecochloris aestuarii DSM ... 152 5e-35
CP000879_847(CP000879|pid:none) Petrotoga mobilis SJ95, complete... 152 5e-35
AP006840_3195(AP006840|pid:none) Symbiobacterium thermophilum IA... 152 5e-35
CP000148_2368(CP000148|pid:none) Geobacter metallireducens GS-15... 152 5e-35
CP001291_3491(CP001291|pid:none) Cyanothece sp. PCC 7424, comple... 151 6e-35
AP008229_2801(AP008229|pid:none) Xanthomonas oryzae pv. oryzae M... 151 6e-35
CP000967_1642(CP000967|pid:none) Xanthomonas oryzae pv. oryzae P... 151 6e-35
CP001357_1320(CP001357|pid:none) Brachyspira hyodysenteriae WA1,... 151 8e-35
CP001101_1912(CP001101|pid:none) Chlorobium phaeobacteroides BS1... 151 8e-35
CP000806_3575(CP000806|pid:none) Cyanothece sp. ATCC 51142 circu... 151 8e-35
CP001275_287(CP001275|pid:none) Thermomicrobium roseum DSM 5159,... 151 8e-35
AE001363_977(AE001363|pid:none) Chlamydophila pneumoniae CWL029,... 150 1e-34
CP000238_582(CP000238|pid:none) Baumannia cicadellinicola str. H... 150 1e-34
AE016828_1168(AE016828|pid:none) Coxiella burnetii RSA 493, comp... 150 1e-34
CT573071_924(CT573071|pid:none) Kuenenia stuttgartiensis genome ... 150 1e-34
CP000812_1518(CP000812|pid:none) Thermotoga lettingae TMO, compl... 150 2e-34
AE000513_569(AE000513|pid:none) Deinococcus radiodurans R1 chrom... 149 2e-34
AE017143_1271(AE017143|pid:none) Haemophilus ducreyi strain 3500... 149 2e-34
CP000462_3219(CP000462|pid:none) Aeromonas hydrophila subsp. hyd... 149 3e-34
(Q89AF2) RecName: Full=Cell division protease ftsH; EC=... 149 3e-34
CP000976_757(CP000976|pid:none) Borrelia duttonii Ly, complete g... 149 3e-34
AP009247_133(AP009247|pid:none) Candidatus Vesicomyosocius okuta... 149 3e-34
CP001071_340(CP001071|pid:none) Akkermansia muciniphila ATCC BAA... 149 4e-34
EF083510_1(EF083510|pid:none) Picea sitchensis clone WS02720_N07... 148 5e-34
BT068136_1(BT068136|pid:none) Zea mays full-length cDNA clone ZM... 148 7e-34
CP000777_225(CP000777|pid:none) Leptospira biflexa serovar Patoc... 148 7e-34
CP000159_1774(CP000159|pid:none) Salinibacter ruber DSM 13855, c... 148 7e-34
CP000233_1335(CP000233|pid:none) Lactobacillus salivarius UCC118... 147 9e-34
CP000551_803(CP000551|pid:none) Prochlorococcus marinus str. AS9... 147 1e-33
CP001390_1866(CP001390|pid:none) Geobacter sp. FRC-32, complete ... 147 1e-33
CP000675_2968(CP000675|pid:none) Legionella pneumophila str. Cor... 147 1e-33
CP000820_295(CP000820|pid:none) Frankia sp. EAN1pec, complete ge... 147 1e-33
CP000096_1684(CP000096|pid:none) Pelodictyon luteolum DSM 273, c... 147 1e-33
AE017354_2737(AE017354|pid:none) Legionella pneumophila subsp. p... 147 1e-33
CP001097_343(CP001097|pid:none) Chlorobium limicola DSM 245, com... 147 2e-33
(Q9FH02) RecName: Full=Cell division protease ftsH homolog 5, ch... 147 2e-33
CP000679_1148(CP000679|pid:none) Caldicellulosiruptor saccharoly... 147 2e-33
CP000733_1304(CP000733|pid:none) Coxiella burnetii Dugway 5J108-... 147 2e-33
CP000916_84(CP000916|pid:none) Thermotoga neapolitana DSM 4359, ... 147 2e-33
AE009951_448(AE009951|pid:none) Fusobacterium nucleatum subsp. n... 147 2e-33
AK317572_1(AK317572|pid:none) Arabidopsis thaliana AT5G42270 mRN... 147 2e-33
CP000111_804(CP000111|pid:none) Prochlorococcus marinus str. MIT... 147 2e-33
CP000488_126(CP000488|pid:none) Candidatus Ruthia magnifica str.... 147 2e-33
AJ749949_1310(AJ749949|pid:none) Francisella tularensis subsp. t... 146 2e-33
(Q5Z974) RecName: Full=Cell division protease ftsH homolog 1, ch... 146 2e-33
AE000512_571(AE000512|pid:none) Thermotoga maritima MSB8, comple... 146 2e-33
CP000608_1184(CP000608|pid:none) Francisella tularensis subsp. t... 146 2e-33
CP000915_1049(CP000915|pid:none) Francisella tularensis subsp. m... 146 2e-33
CP001390_424(CP001390|pid:none) Geobacter sp. FRC-32, complete g... 146 2e-33
CP000702_338(CP000702|pid:none) Thermotoga petrophila RKU-1, com... 146 3e-33
CP000937_151(CP000937|pid:none) Francisella philomiragia subsp. ... 146 3e-33
CP000552_840(CP000552|pid:none) Prochlorococcus marinus str. MIT... 146 3e-33
BX548174_842(BX548174|pid:none) Prochlorococcus marinus MED4 com... 146 3e-33
CP000473_6971(CP000473|pid:none) Solibacter usitatus Ellin6076, ... 145 3e-33
CP001146_698(CP001146|pid:none) Dictyoglomus thermophilum H-6-12... 145 3e-33
CP001107_3394(CP001107|pid:none) Eubacterium rectale ATCC 33656,... 145 3e-33
CP000095_914(CP000095|pid:none) Prochlorococcus marinus str. NAT... 145 3e-33
AB1964(AB1964) cell division protein [imported] - Nostoc sp. (st... 145 3e-33
CP000969_350(CP000969|pid:none) Thermotoga sp. RQ2, complete gen... 145 3e-33
AY334306_1(AY334306|pid:none) Solanum lycopersicum FtsH-like pro... 145 4e-33
AP010904_2574(AP010904|pid:none) Desulfovibrio magneticus RS-1 D... 145 4e-33
CP000481_202(CP000481|pid:none) Acidothermus cellulolyticus 11B ... 145 4e-33
CP001276_442(CP001276|pid:none) Thermomicrobium roseum DSM 5159 ... 145 6e-33
CP000439_649(CP000439|pid:none) Francisella tularensis subsp. no... 145 6e-33
CP000049_759(CP000049|pid:none) Borrelia turicatae 91E135, compl... 145 6e-33
AE1102(AE1102) cell division protein ftsH homolog ftsH [imported... 145 6e-33
AE017262_228(AE017262|pid:none) Listeria monocytogenes str. 4b F... 145 6e-33
CP001175_2391(CP001175|pid:none) Listeria monocytogenes HCC23, c... 145 6e-33
AM233362_1463(AM233362|pid:none) Francisella tularensis subsp. h... 145 6e-33
AF467001_3(AF467001|pid:none) Listeria monocytogenes YabR-like p... 145 6e-33
FM242711_219(FM242711|pid:none) Listeria monocytogenes Clip81459... 145 6e-33
CP000553_960(CP000553|pid:none) Prochlorococcus marinus str. NAT... 144 8e-33
CP001393_600(CP001393|pid:none) Anaerocellum thermophilum DSM 67... 144 8e-33
CP000113_4246(CP000113|pid:none) Myxococcus xanthus DK 1622, com... 144 8e-33
CP000142_1333(CP000142|pid:none) Pelobacter carbinolicus DSM 238... 144 1e-32
AP006627_106(AP006627|pid:none) Bacillus clausii KSM-K16 DNA, co... 144 1e-32
BX842620_16(BX842620|pid:none) Neurospora crassa DNA linkage gro... 144 1e-32
(Q9HGM3) RecName: Full=Mitochondrial respiratory chain complexes... 144 1e-32
CP000359_2060(CP000359|pid:none) Deinococcus geothermalis DSM 11... 144 1e-32
BX548175_2332(BX548175|pid:none) Prochlorococcus marinus MIT9313... 144 1e-32
CP000108_385(CP000108|pid:none) Chlorobium chlorochromatii CaD3,... 144 1e-32
AE014295_1600(AE014295|pid:none) Bifidobacterium longum NCC2705,... 143 2e-32
CP001634_1529(CP001634|pid:none) Kosmotoga olearia TBF 19.5.1, c... 143 2e-32
CP000771_153(CP000771|pid:none) Fervidobacterium nodosum Rt17-B1... 143 2e-32
AH2402(AH2402) cell division protein [imported] - Nostoc sp. (st... 143 2e-32
CP000348_476(CP000348|pid:none) Leptospira borgpetersenii serova... 143 2e-32
CP000825_834(CP000825|pid:none) Prochlorococcus marinus str. MIT... 143 2e-32
CP001095_526(CP001095|pid:none) Bifidobacterium longum subsp. in... 143 2e-32
CP000350_2258(CP000350|pid:none) Leptospira borgpetersenii serov... 143 2e-32
CP000698_3195(CP000698|pid:none) Geobacter uraniireducens Rf4, c... 143 2e-32
CP000097_2026(CP000097|pid:none) Synechococcus sp. CC9902, compl... 143 2e-32
CP001098_56(CP001098|pid:none) Halothermothrix orenii H 168, com... 142 3e-32
(Q8K9G8) RecName: Full=Cell division protease ftsH; EC=... 142 3e-32
CP000240_616(CP000240|pid:none) Synechococcus sp. JA-2-3B'a(2-13... 142 3e-32
(Q9BAE0) RecName: Full=Cell division protease ftsH homolog, chlo... 142 3e-32
CP000249_4265(CP000249|pid:none) Frankia sp. CcI3, complete geno... 142 3e-32
(Q1PDW5) RecName: Full=Cell division protease ftsH homolog 6, ch... 142 4e-32
CP000117_2433(CP000117|pid:none) Anabaena variabilis ATCC 29413,... 142 4e-32
CP000312_541(CP000312|pid:none) Clostridium perfringens SM101, c... 142 5e-32
AP009484_1904(AP009484|pid:none) Macrococcus caseolyticus JCSC54... 142 5e-32
(O82150) RecName: Full=Cell division protease ftsH homolog, chlo... 142 5e-32
CP001344_3975(CP001344|pid:none) Cyanothece sp. PCC 7425, comple... 142 5e-32
CT971583_355(CT971583|pid:none) Synechococcus WH7803 complete ge... 141 8e-32
CP000239_2612(CP000239|pid:none) Synechococcus sp. JA-3-3Ab, com... 140 1e-31
AM412317_3345(AM412317|pid:none) Clostridium botulinum A str. AT... 140 1e-31
CP001158_349(CP001158|pid:none) Buchnera aphidicola str. Tuc7 (A... 140 1e-31
CP000097_1051(CP000097|pid:none) Synechococcus sp. CC9902, compl... 140 1e-31
(P57462) RecName: Full=Cell division protease ftsH; EC=... 140 1e-31
CP000951_341(CP000951|pid:none) Synechococcus sp. PCC 7002, comp... 140 1e-31
CP000939_3341(CP000939|pid:none) Clostridium botulinum B1 str. O... 140 1e-31
BA000045_1917(BA000045|pid:none) Gloeobacter violaceus PCC 7421 ... 140 1e-31
CP001581_3554(CP001581|pid:none) Clostridium botulinum A2 str. K... 140 1e-31
AE010300_3816(AE010300|pid:none) Leptospira interrogans serovar ... 140 1e-31
AB217916_1(AB217916|pid:none) Solanum lycopersicum LeftsH6 mRNA ... 140 1e-31
CP001287_595(CP001287|pid:none) Cyanothece sp. PCC 8801, complet... 140 1e-31
CP000110_295(CP000110|pid:none) Synechococcus sp. CC9605, comple... 140 1e-31
CP001104_1628(CP001104|pid:none) Eubacterium eligens ATCC 27750,... 140 1e-31
(P37476) RecName: Full=Cell division protease ftsH homolog; ... 140 1e-31
CP000482_2840(CP000482|pid:none) Pelobacter propionicus DSM 2379... 140 1e-31
CU179680_748(CU179680|pid:none) Mycoplasma agalactiae PG2 chromo... 140 1e-31
CP000605_1847(CP000605|pid:none) Bifidobacterium longum DJO10A, ... 140 2e-31
CP001291_3238(CP001291|pid:none) Cyanothece sp. PCC 7424, comple... 140 2e-31
CP000721_2986(CP000721|pid:none) Clostridium beijerinckii NCIMB ... 140 2e-31
CP001055_1304(CP001055|pid:none) Elusimicrobium minutum Pei191, ... 140 2e-31
CP000554_2360(CP000554|pid:none) Prochlorococcus marinus str. MI... 139 2e-31
CT971583_1216(CT971583|pid:none) Synechococcus WH7803 complete g... 139 2e-31
AC007592_22(AC007592|pid:none) Genomic sequence for Arabidopsis ... 139 2e-31
CP001638_64(CP001638|pid:none) Geobacillus sp. WCH70, complete g... 139 2e-31
CP000817_80(CP000817|pid:none) Lysinibacillus sphaericus C3-41, ... 139 2e-31
CP000878_249(CP000878|pid:none) Prochlorococcus marinus str. MIT... 139 2e-31
(Q8W585) RecName: Full=Cell division protease ftsH homolog 8, ch... 139 2e-31
AY045951_1(AY045951|pid:none) Arabidopsis thaliana putative FtsH... 139 2e-31
AM778940_41(AM778940|pid:none) Microcystis aeruginosa PCC 7806 g... 139 2e-31
AP007281_257(AP007281|pid:none) Lactobacillus reuteri JCM 1112 D... 139 2e-31
BX569689_305(BX569689|pid:none) Synechococcus sp. WH8102 complet... 139 2e-31
CP000705_262(CP000705|pid:none) Lactobacillus reuteri DSM 20016,... 139 2e-31
CP001185_431(CP001185|pid:none) Thermosipho africanus TCF52B, co... 139 2e-31
CP000422_1455(CP000422|pid:none) Pediococcus pentosaceus ATCC 25... 139 3e-31
CP001161_351(CP001161|pid:none) Buchnera aphidicola str. 5A (Acy... 139 4e-31
AP007255_3206(AP007255|pid:none) Magnetospirillum magneticum AMB... 139 4e-31
AP003635_19(AP003635|pid:none) Oryza sativa Japonica Group genom... 139 4e-31
CP001083_3462(CP001083|pid:none) Clostridium botulinum Ba4 str. ... 139 4e-31
AE017283_254(AE017283|pid:none) Propionibacterium acnes KPA17120... 139 4e-31
AE015927_2211(AE015927|pid:none) Clostridium tetani E88, complet... 139 4e-31
CP000764_59(CP000764|pid:none) Bacillus cereus subsp. cytotoxis ... 138 5e-31
CP000825_247(CP000825|pid:none) Prochlorococcus marinus str. MIT... 138 5e-31
CP000551_248(CP000551|pid:none) Prochlorococcus marinus str. AS9... 138 5e-31
AE006470_296(AE006470|pid:none) Chlorobium tepidum TLS, complete... 138 5e-31
EF495211_82(EF495211|pid:none) Arthrobacter sp. AK-1 plasmid pSI... 138 5e-31
AP009552_5137(AP009552|pid:none) Microcystis aeruginosa NIES-843... 138 5e-31
AF323913_1(AF323913|pid:none) Neurospora crassa intermembrane sp... 138 5e-31
CP000612_124(CP000612|pid:none) Desulfotomaculum reducens MI-1, ... 138 5e-31
CP000127_246(CP000127|pid:none) Nitrosococcus oceani ATCC 19707,... 138 7e-31
CP000557_62(CP000557|pid:none) Geobacillus thermodenitrificans N... 138 7e-31
CP000454_151(CP000454|pid:none) Arthrobacter sp. FB24, complete ... 138 7e-31
CP000023_12(CP000023|pid:none) Streptococcus thermophilus LMG 18... 138 7e-31
CP000382_450(CP000382|pid:none) Clostridium novyi NT, complete g... 137 9e-31
EU257691_1(EU257691|pid:none) Zea mays filamentation temperature... 137 9e-31
EU961437_1(EU961437|pid:none) Zea mays clone 235438 FtsH6 - Zea ... 137 9e-31
CP000725_2036(CP000725|pid:none) Streptococcus gordonii str. Cha... 137 9e-31
AP009152_1927(AP009152|pid:none) Kocuria rhizophila DC2201 DNA, ... 137 9e-31
CT978603_2193(CT978603|pid:none) Synechococcus sp. RCC307 genomi... 137 9e-31
CP000423_2397(CP000423|pid:none) Lactobacillus casei ATCC 334, c... 137 1e-30
CP000435_348(CP000435|pid:none) Synechococcus sp. CC9311, comple... 137 1e-30
CP000607_1486(CP000607|pid:none) Chlorobium phaeovibrioides DSM ... 137 1e-30
CP000951_1157(CP000951|pid:none) Synechococcus sp. PCC 7002, com... 137 1e-30
(Q39444) RecName: Full=Cell division protease ftsH homolog, chlo... 137 2e-30
AJ012165_1(AJ012165|pid:none) Capsicum annuum mRNA for chloropla... 137 2e-30
BT033676_1(BT033676|pid:none) Zea mays full-length cDNA clone ZM... 137 2e-30
AE009948_16(AE009948|pid:none) Streptococcus agalactiae 2603V/R,... 137 2e-30
CP000552_259(CP000552|pid:none) Prochlorococcus marinus str. MIT... 137 2e-30
BX294138_22(BX294138|pid:none) Rhodopirellula baltica SH 1 compl... 137 2e-30
A96974(A96974) ATP-dependent zinc metallopeptidase FtsH (cell di... 136 2e-30
EU257690_1(EU257690|pid:none) Zea mays filamentation temperature... 136 2e-30
CP000027_381(CP000027|pid:none) Dehalococcoides ethenogenes 195,... 136 3e-30
CU469464_464(CU469464|pid:none) Candidatus Phytoplasma mali stra... 136 3e-30
CP000360_64(CP000360|pid:none) Acidobacteria bacterium Ellin345,... 136 3e-30
CU469464_34(CU469464|pid:none) Candidatus Phytoplasma mali strai... 136 3e-30
AC2261(AC2261) cell division protein [imported] - Nostoc sp. (st... 136 3e-30
BX548175_818(BX548175|pid:none) Prochlorococcus marinus MIT9313 ... 136 3e-30
CP001110_430(CP001110|pid:none) Pelodictyon phaeoclathratiforme ... 136 3e-30
CP000111_238(CP000111|pid:none) Prochlorococcus marinus str. MIT... 136 3e-30
BX842651_107(BX842651|pid:none) Bdellovibrio bacteriovorus compl... 136 3e-30
CP001287_1852(CP001287|pid:none) Cyanothece sp. PCC 8801, comple... 136 3e-30
CP000261_14(CP000261|pid:none) Streptococcus pyogenes MGAS2096, ... 135 4e-30
AE009949_11(AE009949|pid:none) Streptococcus pyogenes MGAS8232, ... 135 4e-30
CP000673_570(CP000673|pid:none) Clostridium kluyveri DSM 555, co... 135 4e-30
BA000028_79(BA000028|pid:none) Oceanobacillus iheyensis HTE831 D... 135 4e-30
CP000312_2375(CP000312|pid:none) Clostridium perfringens SM101, ... 135 4e-30
CP000056_13(CP000056|pid:none) Streptococcus pyogenes MGAS6180, ... 135 4e-30
AP009049_532(AP009049|pid:none) Clostridium kluyveri NBRC 12016 ... 135 4e-30
CP000804_699(CP000804|pid:none) Roseiflexus castenholzii DSM 139... 135 5e-30
AM920433_540(AM920433|pid:none) Penicillium chrysogenum Wisconsi... 135 5e-30
BT070452_1(BT070452|pid:none) Picea sitchensis clone WS02730_B15... 135 5e-30
AP008231_600(AP008231|pid:none) Synechococcus elongatus PCC 6301... 135 5e-30
CP000110_1410(CP000110|pid:none) Synechococcus sp. CC9605, compl... 135 5e-30
CP001332_269(CP001332|pid:none) Micromonas sp. RCC299 chromosome... 135 5e-30
AE014296_3046(AE014296|pid:none) Drosophila melanogaster chromos... 135 5e-30
CP000246_2683(CP000246|pid:none) Clostridium perfringens ATCC 13... 135 5e-30
AM747721_315(AM747721|pid:none) Burkholderia cenocepacia J2315 c... 135 5e-30
(Q1XDF9) RecName: Full=Cell division protease ftsH homolog; ... 135 6e-30
FB781602_1(FB781602|pid:none) Sequence 875 from Patent WO2008034... 135 6e-30
Y12780_1(Y12780|pid:none) A.thaliana mRNA for ATPase, partial. 135 6e-30
(P46508) RecName: Full=Protein YME1 homolog; EC=3.4.24.... 134 8e-30
CP000853_2273(CP000853|pid:none) Alkaliphilus oremlandii OhILAs,... 134 8e-30
AE014187_614(AE014187|pid:none) Plasmodium falciparum 3D7 chromo... 134 8e-30
CP000554_1533(CP000554|pid:none) Prochlorococcus marinus str. MI... 134 8e-30
CR522870_3097(CR522870|pid:none) Desulfotalea psychrophila LSv54... 134 8e-30
CT978603_1402(CT978603|pid:none) Synechococcus sp. RCC307 genomi... 134 8e-30
CP000806_1951(CP000806|pid:none) Cyanothece sp. ATCC 51142 circu... 134 1e-29
AJ965256_277(AJ965256|pid:none) Dehalococcoides sp. CBDB1 comple... 134 1e-29
CP000688_363(CP000688|pid:none) Dehalococcoides sp. BAV1, comple... 134 1e-29
AE001437_3151(AE001437|pid:none) Clostridium acetobutylicum ATCC... 134 1e-29
CP001056_3203(CP001056|pid:none) Clostridium botulinum B str. Ek... 134 1e-29
CP000589_264(CP000589|pid:none) Ostreococcus lucimarinus CCE9901... 134 1e-29
AM424788_1(AM424788|pid:none) Vitis vinifera contig VV78X230546.... 134 1e-29
(P51327) RecName: Full=Cell division protease ftsH homolog; ... 134 1e-29
CP000815_166(CP000815|pid:none) Paulinella chromatophora chromat... 133 2e-29
CP000656_1402(CP000656|pid:none) Mycobacterium gilvum PYR-GCK, c... 133 2e-29
CP001102_214(CP001102|pid:none) Candidatus Amoebophilus asiaticu... 133 2e-29
FN314700_1(FN314700|pid:none) Schistosoma japonicum isolate Anhu... 133 2e-29
AB236793_1(AB236793|pid:none) Trifolium pratense RNA for putativ... 133 2e-29
AK317643_1(AK317643|pid:none) Arabidopsis thaliana AT2G30950 mRN... 133 2e-29
CP000553_307(CP000553|pid:none) Prochlorococcus marinus str. NAT... 133 2e-29
AJ938182_460(AJ938182|pid:none) Staphylococcus aureus RF122 comp... 133 2e-29
CP001615_1667(CP001615|pid:none) Exiguobacterium sp. AT1b, compl... 133 2e-29
CP000435_1384(CP000435|pid:none) Synechococcus sp. CC9311, compl... 133 2e-29
AM180355_3651(AM180355|pid:none) Clostridium difficile 630 compl... 133 2e-29
(O80860) RecName: Full=Cell division protease ftsH homolog 2, ch... 133 2e-29
BA000035_2538(BA000035|pid:none) Corynebacterium efficiens YS-31... 133 2e-29
AK317614_1(AK317614|pid:none) Arabidopsis thaliana AT2G30950 mRN... 133 2e-29
CP000092_279(CP000092|pid:none) Ralstonia eutropha JMP134 megapl... 133 2e-29
AF117339_1(AF117339|pid:none) Nicotiana tabacum FtsH-like protei... 132 3e-29
AM946015_15(AM946015|pid:none) Streptococcus uberis 0140J comple... 132 4e-29
AE016830_245(AE016830|pid:none) Enterococcus faecalis V583, comp... 132 4e-29
CP000923_772(CP000923|pid:none) Thermoanaerobacter sp. X514, com... 132 4e-29
AM711867_860(AM711867|pid:none) Clavibacter michiganensis subsp.... 132 5e-29
CP000382_157(CP000382|pid:none) Clostridium novyi NT, complete g... 132 5e-29
CP000480_5903(CP000480|pid:none) Mycobacterium smegmatis str. MC... 132 5e-29
AM270137_1(AM270137|pid:none) Aspergillus niger contig An07c0200... 132 5e-29
AE002110_9(AE002110|pid:none) Ureaplasma parvum serovar 3 str. A... 132 5e-29
CP000918_13(CP000918|pid:none) Streptococcus pneumoniae 70585, c... 131 7e-29
AM910994_406(AM910994|pid:none) Plasmodium knowlesi strain H chr... 131 7e-29
FM864216_299(FM864216|pid:none) Mycoplasma conjunctivae HRC/581T... 131 7e-29
CP000580_5107(CP000580|pid:none) Mycobacterium sp. JLS, complete... 131 7e-29
(O19922) RecName: Full=Cell division protease ftsH homolog; ... 131 7e-29
CP001027_686(CP001027|pid:none) Burkholderia ambifaria MC40-6 ch... 131 7e-29
(P59652) RecName: Full=Cell division protease ftsH homolog; ... 131 7e-29
CP000384_4752(CP000384|pid:none) Mycobacterium sp. MCS, complete... 131 7e-29
>AJ635223_1(AJ635223|pid:none) Pisum sativum mRNA for ftsH-like
protease (ftsh4 gene). &FB781638_1(FB781638|pid:none)
&FB805861_1(FB805861|pid:none)
&FB815273_1(FB815273|pid:none)
&FB822834_1(FB822834|pid:none)
&FB825410_1(FB825410|pid:none)
&FB840418_1(FB840418|pid:none)
&FB854955_1(FB854955|pid:none)
&FB861929_1(FB861929|pid:none)
&FB869904_1(FB869904|pid:none)
&FB873551_1(FB873551|pid:none)
&FB876498_1(FB876498|pid:none)
&FB882307_1(FB882307|pid:none)
&FB894402_1(FB894402|pid:none)
Length = 706
Score = 211 bits (537), Expect = 7e-53
Identities = 108/215 (50%), Positives = 149/215 (69%), Gaps = 5/215 (2%)
Frame = +2
Query: 851 AIKAVQNGKETISIKQIDDARDDILMGRARLNAVMSEEARRNTAYHEAGHALVAAMTEAA 1030
A++A NG + +S+ ++ ARD I+MG R +AV+SEE+R+ TA+HE GHALVA T+ A
Sbjct: 440 ALRAAMNGSKAVSMHDLEFARDKIMMGSERKSAVISEESRKTTAFHEGGHALVAVHTDGA 499
Query: 1031 DPIHKATIVQRGQALGMVSQLPEMDHVQYTRKQMMARLAICLAGRAAEEIFFGVDGVTSG 1210
P+HKATIV RG ALGMVSQLP+ D ++RKQM+ARL +C+ GR AEE+ FG VTSG
Sbjct: 500 LPVHKATIVPRGMALGMVSQLPDKDQTSHSRKQMLARLDVCMGGRVAEELIFGESEVTSG 559
Query: 1211 ASSDFQQASSLAFSMITKWGMSDKVGFIYHK-----DKTSPEVQKIIEDEVKDLLDKQYQ 1375
ASSD QA+SLA M+TK+GMS +VG + H S E + +IE EVK+LL++ Y
Sbjct: 560 ASSDLSQATSLAREMVTKYGMSTEVGPVTHNYYDNGRSMSSETRLLIEKEVKNLLERAYN 619
Query: 1376 YSKELIIKNRDNMEKLVGQLLEKETLTGEEILKIL 1480
+K ++ + + L LLE+ETLTG +I ++L
Sbjct: 620 NAKTILTTHEKELHALANALLEQETLTGSQINELL 654
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3236559
Number of Hits to DB: 2,004,700,751
Number of extensions: 35962976
Number of successful extensions: 101739
Number of sequences better than 10.0: 895
Number of HSP's gapped: 100353
Number of HSP's successfully gapped: 896
Length of query: 574
Length of database: 1,051,180,864
Length adjustment: 134
Effective length of query: 440
Effective length of database: 617,481,958
Effective search space: 271692061520
Effective search space used: 271692061520
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 32 (16.9 bits)
|