| Homology vs DNA |
 Query= Contig-U11744-1 (Contig-U11744-1Q) /CSM_Contig/Contig-U11744-1Q.Seq.d
(1832 letters)
Database: ddbj_A
92,845,959 sequences; 95,242,211,685 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value N
(BJ419515) Dictyostelium discoideum cDNA clone:ddv36h11, 5' ... 502 0.0 3
(AU264398) Dictyostelium discoideum vegetative cDNA clone:VS... 735 0.0 3
(AU264396) Dictyostelium discoideum vegetative cDNA clone:VS... 735 0.0 3
(BJ365488) Dictyostelium discoideum cDNA clone:ddc35e16, 5' ... 470 0.0 3
(BJ422455) Dictyostelium discoideum cDNA clone:ddv45p24, 5' ... 412 0.0 3
(BJ438095) Dictyostelium discoideum cDNA clone:ddv36h11, 3' ... 593 0.0 3
(AU054020) Dictyostelium discoideum slug cDNA, clone SLK433. 702 0.0 2
(BJ417147) Dictyostelium discoideum cDNA clone:ddv29i17, 5' ... 274 0.0 3
(BJ441198) Dictyostelium discoideum cDNA clone:ddv45p24, 3' ... 297 e-137 3
(BJ379652) Dictyostelium discoideum cDNA clone:ddc35e16, 3' ... 315 e-136 3
(AU060566) Dictyostelium discoideum slug cDNA, clone SLK433. 454 e-123 1
(BJ381996) Dictyostelium discoideum cDNA clone:ddc43f17, 3' ... 394 e-114 2
(AC116956) Dictyostelium discoideum chromosome 2 map 1418423... 394 e-106 10
(AU264397) Dictyostelium discoideum vegetative cDNA clone:VS... 188 e-104 3
(AU264399) Dictyostelium discoideum vegetative cDNA clone:VS... 186 e-104 3
(BJ436038) Dictyostelium discoideum cDNA clone:ddv29i17, 3' ... 165 3e-41 2
(AX831100) Sequence 1820 from Patent WO03072602. 58 1e-04 2
(AX820070) Sequence 1820 from Patent EP1338608. 58 1e-04 2
(AX595852) Sequence 1506 from Patent EP1258494. 58 1e-04 2
(DJ208823) Method for identification of useful proteins deri... 58 1e-04 2
(EA376435) Sequence 25258 from patent US 7314974. 58 1e-04 2
(AR527753) Sequence 56 from patent US 6723837. 58 1e-04 2
(Z74174) S.cerevisiae chromosome IV reading frame ORF YDL126c. 58 2e-04 2
(X56956) S. cerevisiae CDC48 gene for cell cycle protein CDC... 58 3e-04 2
(DJ129740) Method for identification of useful proteins deri... 58 0.001 1
(DJ025872) Genome-wide DNA marker of Saccharomyces cerevisiae. 58 0.001 1
(EK533249) 1095516017016 Global-Ocean-Sampling_GS-32-01-01-1... 58 0.001 1
(EK315134) 1095462410229 Global-Ocean-Sampling_GS-31-01-01-1... 58 0.001 1
(CP000393) Trichodesmium erythraeum IMS101, complete genome. 58 0.001 1
(AE016877) Bacillus cereus ATCC 14579, complete genome. 58 0.001 1
(CV842827) ID0ADD5AE12RM1 ID0ADD Acyrthosiphon pisum cDNA cl... 56 0.005 1
(CP000095) Prochlorococcus marinus str. NATL2A, complete gen... 56 0.005 1
(AE017194) Bacillus cereus ATCC 10987, complete genome. 56 0.005 1
(AE014840) Plasmodium falciparum 3D7 chromosome 11 section 5... 44 0.008 14
(EK357849) 1095468732578 Global-Ocean-Sampling_GS-31-01-01-1... 44 0.009 2
(AL035475) Plasmodium falciparum MAL4P2. 54 0.019 1
(EJ722526) 1092959461672 Global-Ocean-Sampling_GS-30-02-01-1... 54 0.019 1
(EJ702920) 1092956042773 Global-Ocean-Sampling_GS-30-02-01-1... 54 0.019 1
(EJ700532) 1092956033573 Global-Ocean-Sampling_GS-30-02-01-1... 54 0.019 1
(EJ695200) 1092956016335 Global-Ocean-Sampling_GS-30-02-01-1... 54 0.019 1
(CP000061) Aster yellows witches'-broom phytoplasma AYWB, co... 46 0.027 17
(CZ285102) cp39d06.f Candida parapsilosis Random Genomic Lib... 46 0.034 2
(EJ088889) 1095460144716 Global-Ocean-Sampling_GS-26-01-01-1... 44 0.039 2
(AL401509) T3 end of clone AS0AA028C05 of library AS0AA from... 52 0.076 1
(AC209480) Saimiri boliviensis boliviensis clone CH254-163D1... 52 0.076 1
(AC208767) Saimiri boliviensis boliviensis clone CH254-407J2... 52 0.076 1
(AC201226) Strongylocentrotus purpuratus clone R3-15I24, WOR... 52 0.076 1
(AC178724) Strongylocentrotus purpuratus clone R3-12O10, WOR... 52 0.076 1
(EJ696669) 1092956021236 Global-Ocean-Sampling_GS-30-02-01-1... 52 0.076 1
(EJ648064) 1092953001073 Global-Ocean-Sampling_GS-30-02-01-1... 52 0.076 1
(EJ281063) 1095366053741 Global-Ocean-Sampling_GS-27-01-01-1... 52 0.076 1
(EJ052313) 1095456004584 Global-Ocean-Sampling_GS-26-01-01-1... 52 0.076 1
(CP000853) Alkaliphilus oremlandii OhILAs, complete genome. 52 0.076 1
(DB775146) Apis mellifera head cDNA, RIKEN full-length enric... 40 0.084 2
(CO848111) LM_GM5_005701 Locusta migratoria gregarious phase... 42 0.10 2
(ER403629) 1095353007601 Global-Ocean-Sampling_GS-34-01-01-1... 38 0.13 2
(CZ534160) SRAA-aac89f02.g1 Strongyloides ratti whole genome... 46 0.14 2
(EJ367559) 1092963712015 Global-Ocean-Sampling_GS-28-01-01-1... 46 0.15 2
(CC090623) CSU-K33r.33K14.SP6 CSU-K33r Aedes aegypti genomic... 40 0.16 2
(EF508371) Rhodomonas salina strain CCMP1319 chloroplast, co... 42 0.24 6
(EF058960) Synthetic construct Saccharomyces cerevisiae clon... 50 0.30 1
(U18796) Saccharomyces cerevisiae chromosome V cosmids 9379,... 50 0.30 1
(DJ025873) Genome-wide DNA marker of Saccharomyces cerevisiae. 50 0.30 1
(BD061520) Genome DNA of symbiotic bacteria of aphid. 50 0.30 1
(AR409405) Sequence 1 from patent US 6632935. 50 0.30 1
(L16579) Dictyostelium discoideum HIV1 TAT-binding protein h... 50 0.30 1
(AC161856) Bos taurus clone CH240-95K16, WORKING DRAFT SEQUE... 50 0.30 1
(AC179866) Strongylocentrotus purpuratus clone R3-1007D10, W... 50 0.30 1
(AC178696) Strongylocentrotus purpuratus clone R3-12G18, WOR... 50 0.30 1
(AC178679) Strongylocentrotus purpuratus clone R3-12C2, WORK... 50 0.30 1
(AC176120) Strongylocentrotus purpuratus clone R3-3023E23, W... 50 0.30 1
(EK208000) 1095460086025 Global-Ocean-Sampling_GS-31-01-01-1... 50 0.30 1
(EK052920) 1092959723828 Global-Ocean-Sampling_GS-31-01-01-1... 50 0.30 1
(EJ422407) 1093012240487 Global-Ocean-Sampling_GS-28-01-01-1... 50 0.30 1
(EI947348) akm3bj40f Km3-3010m-Ionian Sea marine metagenome ... 50 0.30 1
(DX540342) GH_MBb0061G10r GH_MBb Gossypium hirsutum genomic ... 50 0.30 1
(EH015778) USDA-FP_188345 Lysiphlebus testaceipes adult whol... 50 0.30 1
(CV844333) ID0ADD9AG10RM1 ID0ADD Acyrthosiphon pisum cDNA cl... 50 0.30 1
(CV844176) ID0ADD8DB03RM1 ID0ADD Acyrthosiphon pisum cDNA cl... 50 0.30 1
(CV842905) ID0ADD5BD08RM1 ID0ADD Acyrthosiphon pisum cDNA cl... 50 0.30 1
(CV842788) ID0ADD5AB08RM1 ID0ADD Acyrthosiphon pisum cDNA cl... 50 0.30 1
(CV841491) ID0ADD1BB09RM1 ID0ADD Acyrthosiphon pisum cDNA cl... 50 0.30 1
(CV840160) ID0ADD12CG11RM1 ID0ADD Acyrthosiphon pisum cDNA c... 50 0.30 1
(CV840023) ID0ADD12BD03RM1 ID0ADD Acyrthosiphon pisum cDNA c... 50 0.30 1
(CK724577) jab08d01.y2 Anolis sagrei limb bud 2 Anolis sagre... 50 0.30 1
(CJ403588) Molgula tectiformis cDNA, gonad clone:mtgd008a14,... 50 0.30 1
(C92801) Dictyostelium discoideum slug cDNA, clone SSF362. 50 0.30 1
(BJ436179) Dictyostelium discoideum cDNA clone:ddv30c08, 3' ... 50 0.30 1
(BJ434924) Dictyostelium discoideum cDNA clone:ddv25o09, 3' ... 50 0.30 1
(BJ434153) Dictyostelium discoideum cDNA clone:ddv16e02, 3' ... 50 0.30 1
(BJ432569) Dictyostelium discoideum cDNA clone:ddv19g05, 3' ... 50 0.30 1
(BJ432198) Dictyostelium discoideum cDNA clone:ddv18b01, 3' ... 50 0.30 1
(BJ430546) Dictyostelium discoideum cDNA clone:ddv7l16, 3' e... 50 0.30 1
(BJ430323) Dictyostelium discoideum cDNA clone:ddv6h23, 3' e... 50 0.30 1
(BJ428704) Dictyostelium discoideum cDNA clone:ddv12n20, 3' ... 50 0.30 1
(BJ414076) Dictyostelium discoideum cDNA clone:ddv18b01, 5' ... 50 0.30 1
(BJ412276) Dictyostelium discoideum cDNA clone:ddv7l16, 5' e... 50 0.30 1
(BJ400840) Dictyostelium discoideum cDNA clone:dds15f02, 3' ... 50 0.30 1
(BJ400793) Dictyostelium discoideum cDNA clone:dds14h23, 3' ... 50 0.30 1
(BJ377756) Dictyostelium discoideum cDNA clone:ddc25c21, 3' ... 50 0.30 1
>(BJ419515) Dictyostelium discoideum cDNA clone:ddv36h11, 5' end,
single read.
Length = 607
Score = 502 bits (253), Expect(3) = 0.0
Identities = 253/253 (100%)
Strand = Plus / Plus
Query: 358 gtaggacaaccaataaaagtacaagttgttcaatcaaaatttaaagtacttttatttata 417
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 355 gtaggacaaccaataaaagtacaagttgttcaatcaaaatttaaagtacttttatttata 414
Query: 418 ttggttgctggagctattatatattatttttattcaagtaaaggtaaggataagggagga 477
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 415 ttggttgctggagctattatatattatttttattcaagtaaaggtaaggataagggagga 474
Query: 478 ataatgtcaattttaacaagtaaaccattcaaaaccttggtggagagaccaaatacaaca 537
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 475 ataatgtcaattttaacaagtaaaccattcaaaaccttggtggagagaccaaatacaaca 534
Query: 538 tttgctgatgttatgggagctgaagaggcaaagggagaattacaagatttggtagatttc 597
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 535 tttgctgatgttatgggagctgaagaggcaaagggagaattacaagatttggtagatttc 594
Query: 598 ttacgtaatccag 610
|||||||||||||
Sbjct: 595 ttacgtaatccag 607
Score = 270 bits (136), Expect(3) = 0.0
Identities = 136/136 (100%)
Strand = Plus / Plus
Query: 178 acccctcacaatgatattttcagcacatcactttttaaaagaaatgaaaatattttatca 237
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 175 acccctcacaatgatattttcagcacatcactttttaaaagaaatgaaaatattttatca 234
Query: 238 ttaaacagagaattttcaacaacaaaaccattactttcatttagaaaaagagcaacttct 297
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 235 ttaaacagagaattttcaacaacaaaaccattactttcatttagaaaaagagcaacttct 294
Query: 298 atattttcaggaacag 313
||||||||||||||||
Sbjct: 295 atattttcaggaacag 310
Score = 226 bits (114), Expect(3) = 0.0
Identities = 114/114 (100%)
Strand = Plus / Plus
Query: 4 ataaattttcaacaaccacaccacacaccaaagaaatattgattggaaatgaatagatta 63
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1 ataaattttcaacaaccacaccacacaccaaagaaatattgattggaaatgaatagatta 60
Query: 64 cctattcgtatttttaataataatacaacgaaatattatgctagtaatatttct 117
||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 61 cctattcgtatttttaataataatacaacgaaatattatgctagtaatatttct 114
Lambda K H
1.37 0.711 1.31
Matrix: blastn matrix:1 -3
Number of Sequences: 92845959
Number of Hits to DB: 1,913,553,549
Number of extensions: 127083552
Number of successful extensions: 10807558
Number of sequences better than 10.0: 312
Length of query: 1832
Length of database: 95,242,211,685
Length adjustment: 24
Effective length of query: 1808
Effective length of database: 97,308,875,965
Effective search space: 175934447744720
Effective search space used: 175934447744720
X1: 11 (21.8 bits)
S2: 22 (44.1 bits)
|
| Homology vs Protein |
Query= Contig-U11744-1 (Contig-U11744-1Q) /CSM_Contig/Contig-U11744-1Q.Seq.d
(1832 letters)
Database: nrp_B
3,236,559 sequences; 1,051,180,864 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
CP000362_1964(CP000362|pid:none) Roseobacter denitrificans OCh 1... 128 8e-28
CP000539_2288(CP000539|pid:none) Acidovorax sp. JS42, complete g... 127 1e-27
CP000555_1268(CP000555|pid:none) Methylibium petroleiphilum PM1,... 127 1e-27
CP000512_2571(CP000512|pid:none) Acidovorax citrulli AAC00-1, co... 127 1e-27
CP000697_362(CP000697|pid:none) Acidiphilium cryptum JF-5, compl... 126 2e-27
CP000304_3240(CP000304|pid:none) Pseudomonas stutzeri A1501, com... 126 3e-27
CP000284_780(CP000284|pid:none) Methylobacillus flagellatus KT, ... 125 4e-27
CP000749_1008(CP000749|pid:none) Marinomonas sp. MWYL1, complete... 125 5e-27
CP000901_3635(CP000901|pid:none) Yersinia pestis Angola, complet... 125 5e-27
CP000744_5397(CP000744|pid:none) Pseudomonas aeruginosa PA7, com... 125 5e-27
CP001103_1646(CP001103|pid:none) Alteromonas macleodii 'Deep eco... 125 5e-27
CP001157_4143(CP001157|pid:none) Azotobacter vinelandii DJ, comp... 125 5e-27
AG0425(AG0425) cell division protein (EC 3.4.24.-) [imported] - ... 125 5e-27
AE009952_674(AE009952|pid:none) Yersinia pestis KIM, complete ge... 125 5e-27
AB032368_6(AB032368|pid:none) Thermus thermophilus clpB, dafA, d... 125 7e-27
CP000529_2586(CP000529|pid:none) Polaromonas naphthalenivorans C... 125 7e-27
CP000830_1108(CP000830|pid:none) Dinoroseobacter shibae DFL 12, ... 125 7e-27
CP000542_210(CP000542|pid:none) Verminephrobacter eiseniae EF01-... 125 7e-27
AC116956_58(AC116956|pid:none) Dictyostelium discoideum chromoso... 125 7e-27
AE017221_1122(AE017221|pid:none) Thermus thermophilus HB27, comp... 125 7e-27
CP001013_2806(CP001013|pid:none) Leptothrix cholodnii SP-6, comp... 125 7e-27
CP000524_167(CP000524|pid:none) Bartonella bacilliformis KC583, ... 124 9e-27
CP000687_553(CP000687|pid:none) Actinobacillus pleuropneumoniae ... 124 9e-27
CP001091_641(CP001091|pid:none) Actinobacillus pleuropneumoniae ... 124 9e-27
CP000382_157(CP000382|pid:none) Clostridium novyi NT, complete g... 124 1e-26
CP000143_2271(CP000143|pid:none) Rhodobacter sphaeroides 2.4.1 c... 124 1e-26
CP000661_560(CP000661|pid:none) Rhodobacter sphaeroides ATCC 170... 124 1e-26
BA000031_2463(BA000031|pid:none) Vibrio parahaemolyticus RIMD 22... 124 1e-26
CP001276_442(CP001276|pid:none) Thermomicrobium roseum DSM 5159 ... 124 1e-26
CP001150_2021(CP001150|pid:none) Rhodobacter sphaeroides KD131 c... 124 1e-26
CP000789_3288(CP000789|pid:none) Vibrio harveyi ATCC BAA-1116 ch... 124 1e-26
CP000783_3471(CP000783|pid:none) Enterobacter sakazakii ATCC BAA... 124 1e-26
CP001614_2863(CP001614|pid:none) Teredinibacter turnerae T7901, ... 124 2e-26
CP001601_2236(CP001601|pid:none) Corynebacterium aurimucosum ATC... 124 2e-26
AP009385_929(AP009385|pid:none) Burkholderia multivorans ATCC 17... 124 2e-26
CP000267_1974(CP000267|pid:none) Rhodoferax ferrireducens T118, ... 124 2e-26
CP000923_772(CP000923|pid:none) Thermoanaerobacter sp. X514, com... 124 2e-26
CP000462_3219(CP000462|pid:none) Aeromonas hydrophila subsp. hyd... 123 2e-26
CR522870_3097(CR522870|pid:none) Desulfotalea psychrophila LSv54... 123 2e-26
AE017340_971(AE017340|pid:none) Idiomarina loihiensis L2TR, comp... 123 2e-26
CP000521_2946(CP000521|pid:none) Acinetobacter baumannii ATCC 17... 123 2e-26
CP000312_2375(CP000312|pid:none) Clostridium perfringens SM101, ... 123 2e-26
CU468230_742(CU468230|pid:none) Acinetobacter baumannii str. SDF... 123 2e-26
CP000246_2683(CP000246|pid:none) Clostridium perfringens ATCC 13... 123 2e-26
CP000471_434(CP000471|pid:none) Magnetococcus sp. MC-1, complete... 123 3e-26
CP000094_771(CP000094|pid:none) Pseudomonas fluorescens Pf0-1, c... 123 3e-26
AE001825_280(AE001825|pid:none) Deinococcus radiodurans R1 chrom... 123 3e-26
CP000826_481(CP000826|pid:none) Serratia proteamaculans 568, com... 123 3e-26
CU468135_341(CU468135|pid:none) Erwinia tasmaniensis strain ET1/... 123 3e-26
CP000926_4689(CP000926|pid:none) Pseudomonas putida GB-1, comple... 123 3e-26
AM181176_5143(AM181176|pid:none) Pseudomonas fluorescens SBW25 c... 123 3e-26
CP001114_116(CP001114|pid:none) Deinococcus deserti VCD115, comp... 123 3e-26
AE017220_3234(AE017220|pid:none) Salmonella enterica subsp. ente... 122 3e-26
CP000680_3588(CP000680|pid:none) Pseudomonas mendocina ymp, comp... 122 3e-26
CP000822_4451(CP000822|pid:none) Citrobacter koseri ATCC BAA-895... 122 3e-26
CP000970_3333(CP000970|pid:none) Escherichia coli SMS-3-5, compl... 122 3e-26
CP001600_435(CP001600|pid:none) Edwardsiella ictaluri 93-146, co... 122 3e-26
CP000034_3115(CP000034|pid:none) Shigella dysenteriae Sd197, com... 122 3e-26
CP001144_3313(CP001144|pid:none) Salmonella enterica subsp. ente... 122 3e-26
(P63343) RecName: Full=Cell division protease ftsH; EC=... 122 3e-26
FN314700_1(FN314700|pid:none) Schistosoma japonicum isolate Anhu... 122 3e-26
BA000037_2715(BA000037|pid:none) Vibrio vulnificus YJ016 DNA, ch... 122 3e-26
CP000507_949(CP000507|pid:none) Shewanella amazonensis SB2B, com... 122 3e-26
AE014299_1180(AE014299|pid:none) Shewanella oneidensis MR-1, com... 122 4e-26
CP000444_1077(CP000444|pid:none) Shewanella sp. MR-7, complete g... 122 4e-26
BX248583_93(BX248583|pid:none) Blochmannia floridanus complete g... 122 4e-26
BX897700_1126(BX897700|pid:none) Bartonella quintana str. Toulou... 122 4e-26
CP001252_1094(CP001252|pid:none) Shewanella baltica OS223, compl... 122 4e-26
CP000681_2824(CP000681|pid:none) Shewanella putrefaciens CN-32, ... 122 4e-26
CP000487_1283(CP000487|pid:none) Campylobacter fetus subsp. fetu... 122 4e-26
CU207211_1100(CU207211|pid:none) Herminiimonas arsenicoxydans ch... 122 4e-26
CP000514_3354(CP000514|pid:none) Marinobacter aquaeolei VT8, com... 122 4e-26
BA000021_231(BA000021|pid:none) Wigglesworthia glossinidia endos... 122 4e-26
AE003852_625(AE003852|pid:none) Vibrio cholerae O1 biovar eltor ... 122 4e-26
CP000563_3189(CP000563|pid:none) Shewanella baltica OS155, compl... 122 4e-26
CP000446_1017(CP000446|pid:none) Shewanella sp. MR-4, complete g... 122 4e-26
CP000934_2610(CP000934|pid:none) Cellvibrio japonicus Ueda107, c... 122 6e-26
CP000089_941(CP000089|pid:none) Dechloromonas aromatica RCB, com... 122 6e-26
CP001145_874(CP001145|pid:none) Coprothermobacter proteolyticus ... 122 6e-26
BX571874_76(BX571874|pid:none) Photorhabdus luminescens subsp. l... 122 6e-26
CP000964_525(CP000964|pid:none) Klebsiella pneumoniae 342, compl... 122 6e-26
FM211050_37(FM211050|pid:none) Photorhabdus asymbiotica subsp. a... 122 6e-26
CP000544_1739(CP000544|pid:none) Halorhodospira halophila SL1, c... 122 6e-26
AF323913_1(AF323913|pid:none) Neurospora crassa intermembrane sp... 122 6e-26
AM286690_322(AM286690|pid:none) Alcanivorax borkumensis SK2, com... 121 7e-26
CP000123_15(CP000123|pid:none) Mycoplasma capricolum subsp. capr... 121 7e-26
BX897699_1419(BX897699|pid:none) Bartonella henselae strain Hous... 121 7e-26
CP000491_308(CP000491|pid:none) Paracoccus denitrificans PD1222 ... 121 7e-26
CP000937_151(CP000937|pid:none) Francisella philomiragia subsp. ... 121 7e-26
FM954972_2365(FM954972|pid:none) Vibrio splendidus LGP32 chromos... 121 7e-26
AM286415_409(AM286415|pid:none) Yersinia enterocolitica subsp. e... 121 7e-26
CP000760_9(CP000760|pid:none) Ochrobactrum anthropi ATCC 49188 p... 121 7e-26
AJ749949_1310(AJ749949|pid:none) Francisella tularensis subsp. t... 121 1e-25
CP000510_783(CP000510|pid:none) Psychromonas ingrahamii 37, comp... 121 1e-25
AE004439_438(AE004439|pid:none) Pasteurella multocida subsp. mul... 121 1e-25
CP000679_1148(CP000679|pid:none) Caldicellulosiruptor saccharoly... 121 1e-25
CP000439_649(CP000439|pid:none) Francisella tularensis subsp. no... 121 1e-25
CP001393_600(CP001393|pid:none) Anaerocellum thermophilum DSM 67... 121 1e-25
CP000608_1184(CP000608|pid:none) Francisella tularensis subsp. t... 121 1e-25
CP000915_1049(CP000915|pid:none) Francisella tularensis subsp. m... 121 1e-25
CP001562_1546(CP001562|pid:none) Bartonella grahamii as4aup, com... 121 1e-25
AM233362_1463(AM233362|pid:none) Francisella tularensis subsp. h... 121 1e-25
AM260525_1861(AM260525|pid:none) Bartonella tribocorum CIP 10547... 121 1e-25
CP000776_455(CP000776|pid:none) Campylobacter hominis ATCC BAA-3... 120 1e-25
AE017263_672(AE017263|pid:none) Mesoplasma florum L1 complete ge... 120 1e-25
CP000416_504(CP000416|pid:none) Lactobacillus brevis ATCC 367, c... 120 1e-25
CP000238_582(CP000238|pid:none) Baumannia cicadellinicola str. H... 120 1e-25
CU234118_5630(CU234118|pid:none) Bradyrhizobium sp. ORS278,compl... 120 1e-25
CP000083_3344(CP000083|pid:none) Colwellia psychrerythraea 34H, ... 120 1e-25
CR543861_2582(CR543861|pid:none) Acinetobacter sp. ADP1 complete... 120 1e-25
CP001281_1686(CP001281|pid:none) Thauera sp. MZ1T, complete geno... 120 1e-25
CP000975_1139(CP000975|pid:none) Methylacidiphilum infernorum V4... 120 1e-25
CP000394_1110(CP000394|pid:none) Granulibacter bethesdensis CGDN... 120 1e-25
CP000821_3387(CP000821|pid:none) Shewanella sediminis HAW-EB3, c... 120 2e-25
CP000127_2468(CP000127|pid:none) Nitrosococcus oceani ATCC 19707... 120 2e-25
CP001078_147(CP001078|pid:none) Clostridium botulinum E3 str. Al... 120 2e-25
AE000513_569(AE000513|pid:none) Deinococcus radiodurans R1 chrom... 120 2e-25
AE017143_1271(AE017143|pid:none) Haemophilus ducreyi strain 3500... 120 2e-25
CP001056_154(CP001056|pid:none) Clostridium botulinum B str. Ekl... 120 2e-25
CP001010_725(CP001010|pid:none) Polynucleobacter necessarius sub... 120 2e-25
CP000961_3531(CP000961|pid:none) Shewanella woodyi ATCC 51908, c... 120 2e-25
AE016827_964(AE016827|pid:none) Mannheimia succiniciproducens MB... 120 2e-25
BX640441_160(BX640441|pid:none) Bordetella bronchiseptica strain... 120 2e-25
BX640414_77(BX640414|pid:none) Bordetella pertussis strain Toham... 120 2e-25
CP001157_804(CP001157|pid:none) Azotobacter vinelandii DJ, compl... 120 2e-25
CP000606_2827(CP000606|pid:none) Shewanella loihica PV-4, comple... 120 2e-25
BA000045_1917(BA000045|pid:none) Gloeobacter violaceus PCC 7421 ... 120 2e-25
CP000472_1156(CP000472|pid:none) Shewanella piezotolerans WP3, c... 119 3e-25
CP000116_1133(CP000116|pid:none) Thiobacillus denitrificans ATCC... 119 3e-25
AP009178_1409(AP009178|pid:none) Nitratiruptor sp. SB155-2 genom... 119 3e-25
AE014291_1639(AE014291|pid:none) Brucella suis 1330 chromosome I... 119 4e-25
CP000872_1630(CP000872|pid:none) Brucella canis ATCC 23365 chrom... 119 4e-25
CP001158_349(CP001158|pid:none) Buchnera aphidicola str. Tuc7 (A... 119 4e-25
CP001146_698(CP001146|pid:none) Dictyoglomus thermophilum H-6-12... 119 4e-25
CP000359_2167(CP000359|pid:none) Deinococcus geothermalis DSM 11... 119 4e-25
AM902716_3543(AM902716|pid:none) Bordetella petrii strain DSM 12... 119 4e-25
(P57462) RecName: Full=Cell division protease ftsH; EC=... 119 4e-25
CP000529_388(CP000529|pid:none) Polaromonas naphthalenivorans CJ... 119 4e-25
CP001161_351(CP001161|pid:none) Buchnera aphidicola str. 5A (Acy... 119 4e-25
CP000082_1738(CP000082|pid:none) Psychrobacter arcticus 273-4, c... 119 4e-25
CP000721_100(CP000721|pid:none) Clostridium beijerinckii NCIMB 8... 119 4e-25
CP000020_471(CP000020|pid:none) Vibrio fischeri ES114 chromosome... 119 4e-25
CP000769_4348(CP000769|pid:none) Anaeromyxobacter sp. Fw109-5, c... 119 4e-25
CP000758_1208(CP000758|pid:none) Ochrobactrum anthropi ATCC 4918... 119 4e-25
CP000155_1181(CP000155|pid:none) Hahella chejuensis KCTC 2396, c... 119 5e-25
AE008917_342(AE008917|pid:none) Brucella melitensis 16M chromoso... 119 5e-25
CP001344_4643(CP001344|pid:none) Cyanothece sp. PCC 7425, comple... 119 5e-25
CP000481_158(CP000481|pid:none) Acidothermus cellulolyticus 11B ... 119 5e-25
CP001108_117(CP001108|pid:none) Prosthecochloris aestuarii DSM 2... 119 5e-25
CP000851_3055(CP000851|pid:none) Shewanella pealeana ATCC 700345... 119 5e-25
CP001616_2220(CP001616|pid:none) Tolumonas auensis DSM 9187, com... 119 5e-25
AM167904_930(AM167904|pid:none) Bordetella avium 197N complete g... 118 6e-25
EF531339_90(EF531339|pid:none) Candidatus Chloracidobacterium th... 118 6e-25
CP000027_381(CP000027|pid:none) Dehalococcoides ethenogenes 195,... 118 6e-25
AM849034_97(AM849034|pid:none) Clavibacter michiganensis subsp. ... 118 6e-25
(Q8K9G8) RecName: Full=Cell division protease ftsH; EC=... 118 6e-25
AJ965256_277(AJ965256|pid:none) Dehalococcoides sp. CBDB1 comple... 118 6e-25
CP000688_363(CP000688|pid:none) Dehalococcoides sp. BAV1, comple... 118 6e-25
CP001099_72(CP001099|pid:none) Chlorobaculum parvum NCIB 8327, c... 118 6e-25
BX293980_39(BX293980|pid:none) Mycoplasma mycoides subsp. mycoid... 118 6e-25
CP000270_3153(CP000270|pid:none) Burkholderia xenovorans LB400 c... 118 8e-25
AE015927_138(AE015927|pid:none) Clostridium tetani E88, complete... 118 8e-25
AP008230_201(AP008230|pid:none) Desulfitobacterium hafniense Y51... 118 8e-25
(Q9TJ83) RecName: Full=Cell division protease ftsH homolog; ... 118 8e-25
CP001052_2803(CP001052|pid:none) Burkholderia phytofirmans PsJN ... 118 8e-25
BX842653_132(BX842653|pid:none) Bdellovibrio bacteriovorus compl... 118 8e-25
CP000733_1304(CP000733|pid:none) Coxiella burnetii Dugway 5J108-... 118 8e-25
CP001503_1100(CP001503|pid:none) Burkholderia glumae BGR1 chromo... 118 8e-25
CP001336_143(CP001336|pid:none) Desulfitobacterium hafniense DCB... 118 8e-25
AL111168_1052(AL111168|pid:none) Campylobacter jejuni subsp. jej... 118 8e-25
AE016828_1168(AE016828|pid:none) Coxiella burnetii RSA 493, comp... 118 8e-25
CP000554_1902(CP000554|pid:none) Prochlorococcus marinus str. MI... 118 8e-25
CP000768_499(CP000768|pid:none) Campylobacter jejuni subsp. doyl... 118 8e-25
CP000454_151(CP000454|pid:none) Arthrobacter sp. FB24, complete ... 118 8e-25
CU695239_399(CU695239|pid:none) Ralstonia solanacearum strain Mo... 118 8e-25
CP000633_2652(CP000633|pid:none) Agrobacterium vitis S4 chromoso... 118 8e-25
CP001068_1996(CP001068|pid:none) Ralstonia pickettii 12J chromos... 118 8e-25
AP010904_3125(AP010904|pid:none) Desulfovibrio magneticus RS-1 D... 118 8e-25
CP000304_3590(CP000304|pid:none) Pseudomonas stutzeri A1501, com... 118 8e-25
CP001074_3647(CP001074|pid:none) Rhizobium etli CIAT 652, comple... 117 1e-24
AJ720816_1(AJ720816|pid:none) Gallus gallus mRNA for hypothetica... 117 1e-24
CP000618_240(CP000618|pid:none) Burkholderia vietnamiensis G4 pl... 117 1e-24
CT971583_1689(CT971583|pid:none) Synechococcus WH7803 complete g... 117 1e-24
CT978603_2193(CT978603|pid:none) Synechococcus sp. RCC307 genomi... 117 1e-24
CP001154_2883(CP001154|pid:none) Laribacter hongkongensis HLHK9,... 117 1e-24
CP000352_2181(CP000352|pid:none) Ralstonia metallidurans CH34, c... 117 1e-24
CP000133_3410(CP000133|pid:none) Rhizobium etli CFN 42, complete... 117 1e-24
AM711867_860(AM711867|pid:none) Clavibacter michiganensis subsp.... 117 1e-24
CP000554_2360(CP000554|pid:none) Prochlorococcus marinus str. MI... 117 1e-24
CP000675_2968(CP000675|pid:none) Legionella pneumophila str. Cor... 117 1e-24
CP000589_264(CP000589|pid:none) Ostreococcus lucimarinus CCE9901... 117 1e-24
BX548175_2332(BX548175|pid:none) Prochlorococcus marinus MIT9313... 117 1e-24
AP009044_2650(AP009044|pid:none) Corynebacterium glutamicum R DN... 117 1e-24
CP000551_248(CP000551|pid:none) Prochlorococcus marinus str. AS9... 117 1e-24
CP000111_238(CP000111|pid:none) Prochlorococcus marinus str. MIT... 117 1e-24
AP009552_6206(AP009552|pid:none) Microcystis aeruginosa NIES-843... 117 1e-24
CP000096_1684(CP000096|pid:none) Pelodictyon luteolum DSM 273, c... 117 1e-24
CP000096_76(CP000096|pid:none) Pelodictyon luteolum DSM 273, com... 117 1e-24
BX548175_462(BX548175|pid:none) Prochlorococcus marinus MIT9313 ... 117 1e-24
CP001321_465(CP001321|pid:none) Haemophilus parasuis SH0165, com... 117 1e-24
BX927156_44(BX927156|pid:none) Corynebacterium glutamicum ATCC 1... 117 1e-24
BA000036_2696(BA000036|pid:none) Corynebacterium glutamicum ATCC... 117 1e-24
AE017354_2737(AE017354|pid:none) Legionella pneumophila subsp. p... 117 1e-24
CP000551_1459(CP000551|pid:none) Prochlorococcus marinus str. AS... 117 2e-24
AM910994_406(AM910994|pid:none) Plasmodium knowlesi strain H chr... 117 2e-24
CP000825_1484(CP000825|pid:none) Prochlorococcus marinus str. MI... 117 2e-24
CP000103_1786(CP000103|pid:none) Nitrosospira multiformis ATCC 2... 117 2e-24
CP000110_905(CP000110|pid:none) Synechococcus sp. CC9605, comple... 117 2e-24
AE014187_614(AE014187|pid:none) Plasmodium falciparum 3D7 chromo... 117 2e-24
AP009385_1197(AP009385|pid:none) Burkholderia multivorans ATCC 1... 117 2e-24
CP000825_247(CP000825|pid:none) Prochlorococcus marinus str. MIT... 117 2e-24
CP000086_2728(CP000086|pid:none) Burkholderia thailandensis E264... 117 2e-24
CP000378_810(CP000378|pid:none) Burkholderia cenocepacia AU 1054... 117 2e-24
AE008312_4(AE008312|pid:none) Agrobacterium tumefaciens str. C58... 117 2e-24
AM747720_1264(AM747720|pid:none) Burkholderia cenocepacia J2315 ... 117 2e-24
(Q8LQJ9) RecName: Full=Cell division protease ftsH homolog 4, mi... 117 2e-24
AE005673_3200(AE005673|pid:none) Caulobacter crescentus CB15, co... 117 2e-24
CP000111_1480(CP000111|pid:none) Prochlorococcus marinus str. MI... 117 2e-24
CP000667_4251(CP000667|pid:none) Salinispora tropica CNB-440, co... 117 2e-24
CP000614_1232(CP000614|pid:none) Burkholderia vietnamiensis G4 c... 117 2e-24
BA000035_2538(BA000035|pid:none) Corynebacterium efficiens YS-31... 117 2e-24
CP000435_800(CP000435|pid:none) Synechococcus sp. CC9311, comple... 117 2e-24
CP000440_1169(CP000440|pid:none) Burkholderia ambifaria AMMD chr... 117 2e-24
CP001279_131(CP001279|pid:none) Nautilia profundicola AmH, compl... 116 2e-24
(Q9FH02) RecName: Full=Cell division protease ftsH homolog 5, ch... 116 2e-24
CP000142_1333(CP000142|pid:none) Pelobacter carbinolicus DSM 238... 116 2e-24
BX569693_166(BX569693|pid:none) Synechococcus sp. WH8102 complet... 116 2e-24
CP000941_62(CP000941|pid:none) Xylella fastidiosa M12, complete ... 116 2e-24
CP000932_1213(CP000932|pid:none) Campylobacter lari RM2100, comp... 116 2e-24
AL954747_907(AL954747|pid:none) Nitrosomonas europaea ATCC 19718... 116 2e-24
CP000927_4405(CP000927|pid:none) Caulobacter sp. K31, complete g... 116 2e-24
AL939124_94(AL939124|pid:none) Streptomyces coelicolor A3(2) com... 116 2e-24
CP001615_1667(CP001615|pid:none) Exiguobacterium sp. AT1b, compl... 116 2e-24
AM778940_41(AM778940|pid:none) Microcystis aeruginosa PCC 7806 g... 116 2e-24
CP000962_3530(CP000962|pid:none) Clostridium botulinum A3 str. L... 116 2e-24
AM412317_3531(AM412317|pid:none) Clostridium botulinum A str. AT... 116 2e-24
CP000728_3510(CP000728|pid:none) Clostridium botulinum F str. La... 116 2e-24
(O82150) RecName: Full=Cell division protease ftsH homolog, chlo... 116 2e-24
AP009552_5137(AP009552|pid:none) Microcystis aeruginosa NIES-843... 116 2e-24
AE001437_3151(AE001437|pid:none) Clostridium acetobutylicum ATCC... 116 2e-24
AK317572_1(AK317572|pid:none) Arabidopsis thaliana AT5G42270 mRN... 116 2e-24
(Q89AF2) RecName: Full=Cell division protease ftsH; EC=... 116 3e-24
CP000252_1527(CP000252|pid:none) Syntrophus aciditrophicus SB, c... 116 3e-24
CP000853_424(CP000853|pid:none) Alkaliphilus oremlandii OhILAs, ... 116 3e-24
CP000850_4561(CP000850|pid:none) Salinispora arenicola CNS-205, ... 116 3e-24
CP001620_1577(CP001620|pid:none) Corynebacterium kroppenstedtii ... 116 3e-24
(Q39444) RecName: Full=Cell division protease ftsH homolog, chlo... 115 4e-24
CP000553_307(CP000553|pid:none) Prochlorococcus marinus str. NAT... 115 4e-24
CU459003_807(CU459003|pid:none) Magnetospirillum gryphiswaldense... 115 4e-24
AE008692_1659(AE008692|pid:none) Zymomonas mobilis subsp. mobili... 115 4e-24
AM260479_2384(AM260479|pid:none) Ralstonia eutropha H16 chromoso... 115 4e-24
CP000539_1443(CP000539|pid:none) Acidovorax sp. JS42, complete g... 115 4e-24
CP000090_2152(CP000090|pid:none) Ralstonia eutropha JMP134 chrom... 115 4e-24
CP000885_139(CP000885|pid:none) Clostridium phytofermentans ISDg... 115 4e-24
(P71377) RecName: Full=Cell division protease ftsH homolog 1; ... 115 4e-24
AE017283_254(AE017283|pid:none) Propionibacterium acnes KPA17120... 115 4e-24
CR954209_288(CR954209|pid:none) Ostreococcus tauri strain OTTH05... 115 4e-24
CR382125_291(CR382125|pid:none) Kluyveromyces lactis strain NRRL... 115 5e-24
AF151782_1(AF151782|pid:none) Homo sapiens ATP-dependent metallo... 115 5e-24
CP000596_9(CP000596|pid:none) Ostreococcus lucimarinus CCE9901 c... 115 5e-24
CP000712_2415(CP000712|pid:none) Pseudomonas putida F1, complete... 115 5e-24
CP000774_2117(CP000774|pid:none) Parvibaculum lavamentivorans DS... 115 5e-24
CP000435_348(CP000435|pid:none) Synechococcus sp. CC9311, comple... 115 5e-24
CP000478_3405(CP000478|pid:none) Syntrophobacter fumaroxidans MP... 115 5e-24
CR860283_1(CR860283|pid:none) Pongo abelii mRNA; cDNA DKFZp459F0... 115 5e-24
AM180252_188(AM180252|pid:none) Lawsonia intracellularis PHE/MN1... 115 5e-24
BC081751_1(BC081751|pid:none) Rattus norvegicus YME1-like 1 (S. ... 115 5e-24
CP000552_259(CP000552|pid:none) Prochlorococcus marinus str. MIT... 115 5e-24
(Q96TA2) RecName: Full=ATP-dependent metalloprotease YME1L1; ... 115 5e-24
CP000249_4265(CP000249|pid:none) Frankia sp. CcI3, complete geno... 115 5e-24
AB384745_1(AB384745|pid:none) Synthetic construct DNA, clone: pF... 115 5e-24
BA000045_3141(BA000045|pid:none) Gloeobacter violaceus PCC 7421 ... 115 5e-24
BA000012_2998(BA000012|pid:none) Mesorhizobium loti MAFF303099 D... 115 5e-24
AP009389_198(AP009389|pid:none) Pelotomaculum thermopropionicum ... 115 5e-24
AB169750_1(AB169750|pid:none) Macaca fascicularis brain cDNA, cl... 115 5e-24
CP000386_2148(CP000386|pid:none) Rubrobacter xylanophilus DSM 99... 115 5e-24
(Q1XDF9) RecName: Full=Cell division protease ftsH homolog; ... 115 7e-24
CP001358_1695(CP001358|pid:none) Desulfovibrio desulfuricans sub... 115 7e-24
CP001390_1866(CP001390|pid:none) Geobacter sp. FRC-32, complete ... 115 7e-24
BX548174_1451(BX548174|pid:none) Prochlorococcus marinus MED4 co... 115 7e-24
(O59824) RecName: Full=Protein YME1 homolog; EC=3.4.24.... 115 7e-24
AM743169_1635(AM743169|pid:none) Stenotrophomonas maltophilia K2... 115 7e-24
AF080002_29(AF080002|pid:none) Heliobacillus mobilis exopolyphos... 115 7e-24
CP000849_1436(CP000849|pid:none) Rickettsia bellii OSU 85-389, c... 115 7e-24
BT063337_1(BT063337|pid:none) Zea mays full-length cDNA clone ZM... 115 7e-24
(Q1RGP0) RecName: Full=Cell division protease ftsH homolog; ... 115 7e-24
CP001111_1467(CP001111|pid:none) Stenotrophomonas maltophilia R5... 115 7e-24
(O80983) RecName: Full=Cell division protease ftsH homolog 4, mi... 115 7e-24
AE008922_1688(AE008922|pid:none) Xanthomonas campestris pv. camp... 115 7e-24
CP001037_1846(CP001037|pid:none) Nostoc punctiforme PCC 73102, c... 115 7e-24
AP009384_528(AP009384|pid:none) Azorhizobium caulinodans ORS 571... 115 7e-24
CP001022_51(CP001022|pid:none) Exiguobacterium sibiricum 255-15,... 114 9e-24
CP000576_1450(CP000576|pid:none) Prochlorococcus marinus str. MI... 114 9e-24
(Q92JJ9) RecName: Full=Cell division protease ftsH homolog; ... 114 9e-24
(Q9ZEA2) RecName: Full=Cell division protease ftsH homolog; ... 114 9e-24
CP001098_56(CP001098|pid:none) Halothermothrix orenii H 168, com... 114 9e-24
CP000580_5107(CP000580|pid:none) Mycobacterium sp. JLS, complete... 114 9e-24
CP000382_450(CP000382|pid:none) Clostridium novyi NT, complete g... 114 9e-24
AP006627_106(AP006627|pid:none) Bacillus clausii KSM-K16 DNA, co... 114 9e-24
AP006628_130(AP006628|pid:none) Onion yellows phytoplasma OY-M D... 114 9e-24
CP000110_295(CP000110|pid:none) Synechococcus sp. CC9605, comple... 114 9e-24
CP000847_68(CP000847|pid:none) Rickettsia akari str. Hartford, c... 114 9e-24
CP001197_54(CP001197|pid:none) Desulfovibrio vulgaris str. 'Miya... 114 9e-24
CP000112_1511(CP000112|pid:none) Desulfovibrio desulfuricans G20... 114 9e-24
CP000409_41(CP000409|pid:none) Rickettsia canadensis str. McKiel... 114 9e-24
CP000724_4372(CP000724|pid:none) Alkaliphilus metalliredigens QY... 114 9e-24
CR954217_1(CR954217|pid:none) Ostreococcus tauri strain OTTH0595... 114 9e-24
CP001287_1852(CP001287|pid:none) Cyanothece sp. PCC 8801, comple... 114 9e-24
AE009951_448(AE009951|pid:none) Fusobacterium nucleatum subsp. n... 114 9e-24
CP000683_36(CP000683|pid:none) Rickettsia massiliae MTU5, comple... 114 9e-24
(Q68XR9) RecName: Full=Cell division protease ftsH homolog; ... 114 9e-24
CP000975_1906(CP000975|pid:none) Methylacidiphilum infernorum V4... 114 9e-24
CP000806_2041(CP000806|pid:none) Cyanothece sp. ATCC 51142 circu... 114 9e-24
BX569689_305(BX569689|pid:none) Synechococcus sp. WH8102 complet... 114 9e-24
CP001275_287(CP001275|pid:none) Thermomicrobium roseum DSM 5159,... 114 9e-24
CP000023_12(CP000023|pid:none) Streptococcus thermophilus LMG 18... 114 9e-24
CP000488_126(CP000488|pid:none) Candidatus Ruthia magnifica str.... 114 9e-24
CP000473_6971(CP000473|pid:none) Solibacter usitatus Ellin6076, ... 114 1e-23
CT971583_355(CT971583|pid:none) Synechococcus WH7803 complete ge... 114 1e-23
CP000820_295(CP000820|pid:none) Frankia sp. EAN1pec, complete ge... 114 1e-23
AP008229_2801(AP008229|pid:none) Xanthomonas oryzae pv. oryzae M... 114 1e-23
CP000103_482(CP000103|pid:none) Nitrosospira multiformis ATCC 25... 114 1e-23
CP000390_3134(CP000390|pid:none) Mesorhizobium sp. BNC1, complet... 114 1e-23
CP000091_1720(CP000091|pid:none) Ralstonia eutropha JMP134 chrom... 114 1e-23
CP000878_249(CP000878|pid:none) Prochlorococcus marinus str. MIT... 114 1e-23
CP000393_2837(CP000393|pid:none) Trichodesmium erythraeum IMS101... 114 1e-23
CP001332_269(CP001332|pid:none) Micromonas sp. RCC299 chromosome... 114 1e-23
CP000552_1424(CP000552|pid:none) Prochlorococcus marinus str. MI... 114 1e-23
AM039952_1765(AM039952|pid:none) Xanthomonas campestris pv. vesi... 114 1e-23
CR767821_870(CR767821|pid:none) Ehrlichia ruminantium strain Wel... 114 1e-23
AE013599_3710(AE013599|pid:none) Drosophila melanogaster chromos... 114 1e-23
CP001104_1628(CP001104|pid:none) Eubacterium eligens ATCC 27750,... 114 1e-23
CP000097_2026(CP000097|pid:none) Synechococcus sp. CC9902, compl... 114 1e-23
CP000967_1642(CP000967|pid:none) Xanthomonas oryzae pv. oryzae P... 114 1e-23
AE017126_1335(AE017126|pid:none) Prochlorococcus marinus subsp. ... 114 2e-23
CP001291_3238(CP001291|pid:none) Cyanothece sp. PCC 7424, comple... 114 2e-23
AE017308_542(AE017308|pid:none) Mycoplasma mobile 163K complete ... 114 2e-23
(P51327) RecName: Full=Cell division protease ftsH homolog; ... 114 2e-23
CP000781_3054(CP000781|pid:none) Xanthobacter autotrophicus Py2,... 114 2e-23
CP000061_414(CP000061|pid:none) Aster yellows witches'-broom phy... 114 2e-23
AE1102(AE1102) cell division protein ftsH homolog ftsH [imported... 114 2e-23
CP000656_1402(CP000656|pid:none) Mycobacterium gilvum PYR-GCK, c... 114 2e-23
AP009153_1393(AP009153|pid:none) Gemmatimonas aurantiaca T-27 DN... 114 2e-23
CP000414_354(CP000414|pid:none) Leuconostoc mesenteroides subsp.... 114 2e-23
CP000612_124(CP000612|pid:none) Desulfotomaculum reducens MI-1, ... 114 2e-23
AP008971_994(AP008971|pid:none) Finegoldia magna ATCC 29328 DNA,... 113 2e-23
CP000699_4474(CP000699|pid:none) Sphingomonas wittichii RW1, com... 113 2e-23
CT978603_1754(CT978603|pid:none) Synechococcus sp. RCC307 genomi... 113 2e-23
AP007255_3206(AP007255|pid:none) Magnetospirillum magneticum AMB... 113 2e-23
CP001068_1673(CP001068|pid:none) Ralstonia pickettii 12J chromos... 113 2e-23
BC125787_1(BC125787|pid:none) Xenopus tropicalis hypothetical pr... 113 2e-23
CP001050_541(CP001050|pid:none) Neisseria gonorrhoeae NCCP11945,... 113 3e-23
AJ635223_1(AJ635223|pid:none) Pisum sativum mRNA for ftsH-like p... 113 3e-23
CP000494_7324(CP000494|pid:none) Bradyrhizobium sp. BTAi1, compl... 113 3e-23
AY334306_1(AY334306|pid:none) Solanum lycopersicum FtsH-like pro... 113 3e-23
CP000088_2888(CP000088|pid:none) Thermobifida fusca YX, complete... 113 3e-23
DQ074889_1(DQ074889|pid:none) Lactobacillus reuteri lr1227 (lr12... 113 3e-23
AL157959_901(AL157959|pid:none) Neisseria meningitidis serogroup... 113 3e-23
CP000084_597(CP000084|pid:none) Candidatus Pelagibacter ubique H... 113 3e-23
CP000930_1249(CP000930|pid:none) Heliobacterium modesticaldum Ic... 113 3e-23
CU207366_2659(CU207366|pid:none) Gramella forsetii KT0803 comple... 113 3e-23
(Q8LQJ8) RecName: Full=Cell division protease ftsH homolog 5, mi... 113 3e-23
CU928178_557(CU928178|pid:none) Zygosaccharomyces rouxii strain ... 113 3e-23
AE002098_770(AE002098|pid:none) Neisseria meningitidis MC58, com... 113 3e-23
CP001071_340(CP001071|pid:none) Akkermansia muciniphila ATCC BAA... 113 3e-23
AP007281_257(AP007281|pid:none) Lactobacillus reuteri JCM 1112 D... 113 3e-23
AM180355_3651(AM180355|pid:none) Clostridium difficile 630 compl... 113 3e-23
CP000705_262(CP000705|pid:none) Lactobacillus reuteri DSM 20016,... 113 3e-23
(Q9FGM0) RecName: Full=Cell division protease ftsH homolog 11, c... 113 3e-23
CP000325_3447(CP000325|pid:none) Mycobacterium ulcerans Agy99, c... 113 3e-23
CP001185_431(CP001185|pid:none) Thermosipho africanus TCF52B, co... 113 3e-23
CP000092_279(CP000092|pid:none) Ralstonia eutropha JMP134 megapl... 113 3e-23
BA000039_1831(BA000039|pid:none) Thermosynechococcus elongatus B... 112 3e-23
CR848038_720(CR848038|pid:none) Chlamydophila abortus strain S26... 112 3e-23
CP000804_699(CP000804|pid:none) Roseiflexus castenholzii DSM 139... 112 3e-23
U97567_3(U97567|pid:none) Helicobacter pylori sress responsive o... 112 3e-23
CP001287_595(CP001287|pid:none) Cyanothece sp. PCC 8801, complet... 112 3e-23
AL954747_528(AL954747|pid:none) Nitrosomonas europaea ATCC 19718... 112 3e-23
CP000384_4752(CP000384|pid:none) Mycobacterium sp. MCS, complete... 112 3e-23
AP006628_307(AP006628|pid:none) Onion yellows phytoplasma OY-M D... 112 3e-23
(Q5Z974) RecName: Full=Cell division protease ftsH homolog 1, ch... 112 3e-23
(P46469) RecName: Full=Cell division protease ftsH homolog; ... 112 3e-23
CP001357_1320(CP001357|pid:none) Brachyspira hyodysenteriae WA1,... 112 3e-23
CP000951_341(CP000951|pid:none) Synechococcus sp. PCC 7002, comp... 112 3e-23
CP000241_379(CP000241|pid:none) Helicobacter pylori HPAG1, compl... 112 3e-23
FB781602_1(FB781602|pid:none) Sequence 875 from Patent WO2008034... 112 3e-23
AP009484_1904(AP009484|pid:none) Macrococcus caseolyticus JCSC54... 112 3e-23
CP000721_2986(CP000721|pid:none) Clostridium beijerinckii NCIMB ... 112 3e-23
CP001029_5282(CP001029|pid:none) Methylobacterium populi BJ001, ... 112 3e-23
U59452_1(U59452|pid:none) Helicobacter pylori HpFtsH (ftsH) gene... 112 3e-23
CP001072_376(CP001072|pid:none) Helicobacter pylori Shi470, comp... 112 3e-23
BC168848_1(BC168848|pid:none) Rattus norvegicus AFG3(ATPase fami... 112 3e-23
CP001217_373(CP001217|pid:none) Helicobacter pylori P12, complet... 112 3e-23
BX251410_160(BX251410|pid:none) Tropheryma whipplei TW08/27, com... 112 3e-23
Y12780_1(Y12780|pid:none) A.thaliana mRNA for ATPase, partial. 112 3e-23
CP000301_4686(CP000301|pid:none) Rhodopseudomonas palustris BisB... 112 3e-23
X81067_1(X81067|pid:none) S.cerevisiae YTA11 gene. 112 5e-23
BC150071_1(BC150071|pid:none) Bos taurus YME1-like 1 (S. cerevis... 112 5e-23
CP000828_3144(CP000828|pid:none) Acaryochloris marina MBIC11017,... 112 5e-23
(P72991) RecName: Full=Cell division protease ftsH homolog 4; ... 112 5e-23
CP000806_1951(CP000806|pid:none) Cyanothece sp. ATCC 51142 circu... 112 5e-23
CP000051_875(CP000051|pid:none) Chlamydia trachomatis A/HAR-13, ... 112 5e-23
AM420293_389(AM420293|pid:none) Saccharopolyspora erythraea NRRL... 112 5e-23
CP000480_5903(CP000480|pid:none) Mycobacterium smegmatis str. MC... 112 5e-23
AF037269_1(AF037269|pid:none) Mycobacterium smegmatis cell divis... 112 5e-23
CU234118_2662(CU234118|pid:none) Bradyrhizobium sp. ORS278,compl... 112 5e-23
CP000828_4801(CP000828|pid:none) Acaryochloris marina MBIC11017,... 112 5e-23
CP000107_859(CP000107|pid:none) Ehrlichia canis str. Jake, compl... 112 5e-23
AM884176_213(AM884176|pid:none) Chlamydia trachomatis strain L2/... 112 5e-23
D16332_1(D16332|pid:none) Saccharomyces cerevisiae OSD1 gene, co... 112 5e-23
CP000383_606(CP000383|pid:none) Cytophaga hutchinsonii ATCC 3340... 112 5e-23
(Q9BAE0) RecName: Full=Cell division protease ftsH homolog, chlo... 112 5e-23
AE002160_222(AE002160|pid:none) Chlamydia muridarum Nigg, comple... 112 5e-23
AP009356_94(AP009356|pid:none) Onion yellows phytoplasma OY-W ge... 112 5e-23
CP000879_847(CP000879|pid:none) Petrotoga mobilis SJ95, complete... 112 5e-23
CP000479_519(CP000479|pid:none) Mycobacterium avium 104, complet... 112 5e-23
AE017262_228(AE017262|pid:none) Listeria monocytogenes str. 4b F... 112 5e-23
CP001175_2391(CP001175|pid:none) Listeria monocytogenes HCC23, c... 112 5e-23
AP009552_1436(AP009552|pid:none) Microcystis aeruginosa NIES-843... 112 5e-23
CP001391_1040(CP001391|pid:none) Wolbachia sp. wRi, complete gen... 112 5e-23
CP000140_1794(CP000140|pid:none) Parabacteroides distasonis ATCC... 112 5e-23
CP000159_1774(CP000159|pid:none) Salinibacter ruber DSM 13855, c... 112 5e-23
AP009247_133(AP009247|pid:none) Candidatus Vesicomyosocius okuta... 112 5e-23
AF467001_3(AF467001|pid:none) Listeria monocytogenes YabR-like p... 112 5e-23
FM242711_219(FM242711|pid:none) Listeria monocytogenes Clip81459... 112 5e-23
(P73437) RecName: Full=Cell division protease ftsH homolog 3; ... 112 5e-23
CP000239_2612(CP000239|pid:none) Synechococcus sp. JA-3-3Ab, com... 112 6e-23
CP000359_2060(CP000359|pid:none) Deinococcus geothermalis DSM 11... 112 6e-23
BC007795_1(BC007795|pid:none) Homo sapiens YME1-like 1 (S. cerev... 112 6e-23
BX248359_300(BX248359|pid:none) Corynebacterium diphtheriae grav... 112 6e-23
CP000481_202(CP000481|pid:none) Acidothermus cellulolyticus 11B ... 112 6e-23
CP000049_759(CP000049|pid:none) Borrelia turicatae 91E135, compl... 112 6e-23
CP000450_964(CP000450|pid:none) Nitrosomonas eutropha C91, compl... 112 6e-23
AE016820_97(AE016820|pid:none) Ashbya gossypii (= Eremothecium g... 112 6e-23
AK168244_1(AK168244|pid:none) Mus musculus TIB-55 BB88 cDNA, RIK... 112 6e-23
CR380956_52(CR380956|pid:none) Candida glabrata strain CBS138 ch... 112 6e-23
AF329695_1(AF329695|pid:none) Mus musculus ATP-dependent zinc me... 112 6e-23
CP000698_3195(CP000698|pid:none) Geobacter uraniireducens Rf4, c... 112 6e-23
CP000319_3333(CP000319|pid:none) Nitrobacter hamburgensis X14, c... 112 6e-23
CP000841_233(CP000841|pid:none) Acaryochloris marina MBIC11017 p... 112 6e-23
AP006861_251(AP006861|pid:none) Chlamydophila felis Fe/C-56 DNA,... 112 6e-23
AP008937_221(AP008937|pid:none) Lactobacillus fermentum IFO 3956... 112 6e-23
(Q920A7) RecName: Full=AFG3-like protein 1; EC=3.4.24.-... 112 6e-23
AY136287_1(AY136287|pid:none) Mus musculus clone 9A metalloprote... 112 6e-23
CP000828_1251(CP000828|pid:none) Acaryochloris marina MBIC11017,... 112 6e-23
CP000853_2273(CP000853|pid:none) Alkaliphilus oremlandii OhILAs,... 111 8e-23
AL583917_222(AL583917|pid:none) Mycobacterium leprae strain TN c... 111 8e-23
CP000117_2226(CP000117|pid:none) Anabaena variabilis ATCC 29413,... 111 8e-23
AE015924_40(AE015924|pid:none) Porphyromonas gingivalis W83, com... 111 8e-23
CP000237_406(CP000237|pid:none) Neorickettsia sennetsu strain Mi... 111 8e-23
AH2402(AH2402) cell division protein [imported] - Nostoc sp. (st... 111 8e-23
CP001291_455(CP001291|pid:none) Cyanothece sp. PCC 7424, complet... 111 8e-23
CP000240_4(CP000240|pid:none) Synechococcus sp. JA-2-3B'a(2-13),... 111 8e-23
AP009380_43(AP009380|pid:none) Porphyromonas gingivalis ATCC 332... 111 8e-23
CP000117_2433(CP000117|pid:none) Anabaena variabilis ATCC 29413,... 111 8e-23
AE010300_3816(AE010300|pid:none) Leptospira interrogans serovar ... 111 8e-23
AY673996_64(AY673996|pid:none) Gracilaria tenuistipitata var. li... 111 8e-23
CP000356_1586(CP000356|pid:none) Sphingopyxis alaskensis RB2256,... 111 8e-23
(O78516) RecName: Full=Cell division protease ftsH homolog; ... 111 8e-23
AM260522_1070(AM260522|pid:none) Helicobacter acinonychis str. S... 111 8e-23
CR954210_333(CR954210|pid:none) Ostreococcus tauri strain OTTH05... 111 8e-23
AC133572_7(AC133572|pid:none) Medicago truncatula clone mth2-10o... 111 8e-23
AE001363_977(AE001363|pid:none) Chlamydophila pneumoniae CWL029,... 111 1e-22
BX572596_178(BX572596|pid:none) Rhodopseudomonas palustris CGA00... 111 1e-22
CP001196_3238(CP001196|pid:none) Oligotropha carboxidovorans OM5... 111 1e-22
AE015925_751(AE015925|pid:none) Chlamydophila caviae GPIC, compl... 111 1e-22
CP001069_604(CP001069|pid:none) Ralstonia pickettii 12J chromoso... 111 1e-22
DQ789030_4(DQ789030|pid:none) Paulinella chromatophora hypotheti... 111 1e-22
CP001349_5283(CP001349|pid:none) Methylobacterium nodulans ORS 2... 111 1e-22
CP000494_6456(CP000494|pid:none) Bradyrhizobium sp. BTAi1, compl... 111 1e-22
AP008231_600(AP008231|pid:none) Synechococcus elongatus PCC 6301... 111 1e-22
CP000348_476(CP000348|pid:none) Leptospira borgpetersenii serova... 111 1e-22
CU234118_1114(CU234118|pid:none) Bradyrhizobium sp. ORS278,compl... 111 1e-22
CP000115_2695(CP000115|pid:none) Nitrobacter winogradskyi Nb-255... 111 1e-22
AJ243808_2(AJ243808|pid:none) Bradyrhizobium japonicum yaeN and ... 111 1e-22
(P37476) RecName: Full=Cell division protease ftsH homolog; ... 111 1e-22
CP000350_2258(CP000350|pid:none) Leptospira borgpetersenii serov... 111 1e-22
CP001147_615(CP001147|pid:none) Thermodesulfovibrio yellowstonii... 111 1e-22
CP000463_4657(CP000463|pid:none) Rhodopseudomonas palustris BisA... 111 1e-22
CP000943_266(CP000943|pid:none) Methylobacterium sp. 4-46, compl... 111 1e-22
CP000815_511(CP000815|pid:none) Paulinella chromatophora chromat... 111 1e-22
CP000250_1814(CP000250|pid:none) Rhodopseudomonas palustris HaA2... 111 1e-22
CP000283_4120(CP000283|pid:none) Rhodopseudomonas palustris BisB... 111 1e-22
CU469464_464(CU469464|pid:none) Candidatus Phytoplasma mali stra... 110 1e-22
CP001110_430(CP001110|pid:none) Pelodictyon phaeoclathratiforme ... 110 1e-22
AE017196_1130(AE017196|pid:none) Wolbachia endosymbiont of Droso... 110 1e-22
AP009493_4088(AP009493|pid:none) Streptomyces griseus subsp. gri... 110 1e-22
CP000248_76(CP000248|pid:none) Novosphingobium aromaticivorans D... 110 1e-22
BA000004_85(BA000004|pid:none) Bacillus halodurans C-125 DNA, co... 110 1e-22
(P73179) RecName: Full=Cell division protease ftsH homolog 2; ... 110 1e-22
CP000386_1784(CP000386|pid:none) Rubrobacter xylanophilus DSM 99... 110 1e-22
CP001107_667(CP001107|pid:none) Eubacterium rectale ATCC 33656, ... 110 1e-22
(A2ZVG7) RecName: Full=Cell division protease ftsH homolog 9, ch... 110 1e-22
CP000236_1047(CP000236|pid:none) Ehrlichia chaffeensis str. Arka... 110 1e-22
AE000783_788(AE000783|pid:none) Borrelia burgdorferi B31, comple... 110 2e-22
CP000013_777(CP000013|pid:none) Borrelia garinii PBi, complete g... 110 2e-22
(P49825) RecName: Full=Cell division protease ftsH homolog; ... 110 2e-22
AM746676_7305(AM746676|pid:none) Sorangium cellulosum 'So ce 56'... 110 2e-22
(Q9SD67) RecName: Full=Cell division protease ftsH homolog 7, ch... 110 2e-22
CP001027_686(CP001027|pid:none) Burkholderia ambifaria MC40-6 ch... 110 2e-22
>CP000362_1964(CP000362|pid:none) Roseobacter denitrificans OCh 114,
complete genome.
Length = 641
Score = 128 bits (321), Expect = 8e-28
Identities = 71/141 (50%), Positives = 90/141 (63%), Gaps = 5/141 (3%)
Frame = +1
Query: 379 QVVQSKFKVLL-----FILVAGAIIYYFYSSKGKDKGGIMSILTSKPFKTLVERPNTTFA 543
Q QS F+ L F+L+ G IY+ +G KGG M SK + TF
Sbjct: 95 QQQQSGFQTFLMSLLPFLLLIGVWIYFMNRMQGGGKGGAMGFGKSKAKMLTEKHGRVTFD 154
Query: 544 DVMGAEEAKGELQDLVDFLRNPEKYYRRNIVMPKGILLVGPPGTGKTLLAKSLAGEARVS 723
DV G +EAK EL+++V+FLRNP+K+ R +PKG LL GPPGTGKTLLA+++AGEA V
Sbjct: 155 DVAGIDEAKEELEEIVEFLRNPQKFSRLGGKIPKGALLEGPPGTGKTLLARAIAGEAGVP 214
Query: 724 FITINGSEFEEAFVGVGAKRV 786
F TI+GS+F E FVGVGA RV
Sbjct: 215 FFTISGSDFVEMFVGVGASRV 235
Score = 75.9 bits (185), Expect = 5e-12
Identities = 43/126 (34%), Positives = 76/126 (60%), Gaps = 10/126 (7%)
Frame = +2
Query: 800 QMDVAMGGRAAEELILGKENISQGASSDIQKATSIAKAMVSNYGMSEKVGQI-YIQSEK- 973
++ + M G+AAE G + +S G + DI +A+ +A+AMV +GMS+KVG I Y ++ +
Sbjct: 467 RLAMTMAGKAAEIHKYGPDAVSNGPAGDIMQASGLARAMVLRWGMSDKVGNIDYSEAAEG 526
Query: 974 --------KLSSAQRELVDSEVKSLLDSSYIRATQLLKKYSKEHHLIANALLEYETLSLD 1129
+S+ +EL++ EV+ + Y A++++K+ E +A LLEYETL+ +
Sbjct: 527 YQGNTAGFSVSANTKELIEEEVQRFIQDGYEWASKIIKENEVEFERLAQGLLEYETLTGE 586
Query: 1130 EIKDII 1147
EIK ++
Sbjct: 587 EIKRVM 592
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3236559
Number of Hits to DB: 2,323,074,145
Number of extensions: 41580209
Number of successful extensions: 176585
Number of sequences better than 10.0: 3684
Number of HSP's gapped: 170877
Number of HSP's successfully gapped: 4746
Length of query: 610
Length of database: 1,051,180,864
Length adjustment: 135
Effective length of query: 475
Effective length of database: 614,245,399
Effective search space: 291766564525
Effective search space used: 291766564525
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 32 (16.9 bits)
|