| Contig-U11694-1 |
| Contig ID |
Contig-U11694-1 |
| Contig update |
2002.12.18 |
| Contig sequence |
 |
| Gap |
gap included |
| Contig length |
2243 |
| Chromosome number (1..6, M) |
3 |
| Chromosome length |
6358359 |
| Start point |
717102 |
| End point |
719346 |
| Strand (PLUS/MINUS) |
PLUS |
| Number of clones |
22 |
| Number of EST |
34 |
| Link to clone list |
U11694 |
| List of clone(s) |
est1=VHB747F,1,532
est2=VHA674F,20,580
est3=VHG448F,23,451
est4=VFL190F,25,505
est5=VHN334F,29,449
est6=VHN804F,29,229
est7=CHE602F,39,199
est8=VHI728F,45,248
est9=VHP546F,45,580
est10=VHA368F,50,578
est11=VHC389F,76,452
est12=VFK504F,191,825
est13=VSA754E,244,777
est14=AFI793F,732,1344
est15=VHB747Z,1345,2147
est16=VHA674Z,1356,2155
est17=CHL239Z,1369,2156
est18=CHE602Z,1442,2167
est19=VFK504Z,1442,2150
est20=VHI728Z,1442,2155
est21=VHA368Z,1443,2166
est22=VHM716Z,1446,2054
est23=VHN804Z,1446,2122
est24=VHP546Z,1464,2166
est25=VHC389Z,1484,2166
est26=VHG448Z,1486,2155
est27=CHP402Z,1494,2114
est28=VSK138E,1513,2158
est29=VFL190Z,1517,2164
est30=VSA451Z,1643,2235
est31=VHG184Z,1817,2052
est32=VSA886Z,1819,2248
est33=VSI133F,1927,2178
est34=VSI133Z,1927,2166
|
| Translated Amino Acid sequence |
|
| Translated Amino Acid sequence (All Frames) |
|
| own update |
2004. 6.10 |
| Homology vs CSM-cDNA |
|
| dna update |
2008.11.25 |
| Homology vs DNA |
Query= Contig-U11694-1 (Contig-U11694-1Q) /CSM_Contig/Contig-U11694-1Q.Seq.d
(2253 letters)
Database: ddbj_A
92,845,959 sequences; 95,242,211,685 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value N
(BJ437494) Dictyostelium discoideum cDNA clone:ddv34n11, 3' ... 1495 0.0 1
(BJ436960) Dictyostelium discoideum cDNA clone:ddv32c20, 3' ... 1473 0.0 1
(BJ382337) Dictyostelium discoideum cDNA clone:ddc44m10, 3' ... 1439 0.0 1
(BJ441945) Dictyostelium discoideum cDNA clone:ddv48h07, 3' ... 1302 0.0 1
(BJ378451) Dictyostelium discoideum cDNA clone:ddc31c02, 3' ... 1302 0.0 1
(BJ436579) Dictyostelium discoideum cDNA clone:ddv31h17, 3' ... 1300 0.0 1
(BJ444988) Dictyostelium discoideum cDNA clone:ddv58h02, 3' ... 1255 0.0 2
(BJ433497) Dictyostelium discoideum cDNA clone:ddv22g01, 3' ... 1253 0.0 2
(BJ446332) Dictyostelium discoideum cDNA clone:ddv62k11, 3' ... 1241 0.0 1
(BJ415283) Dictyostelium discoideum cDNA clone:ddv22g01, 5' ... 1225 0.0 1
(BJ437909) Dictyostelium discoideum cDNA clone:ddv35b23, 3' ... 1219 0.0 1
(BJ440371) Dictyostelium discoideum cDNA clone:ddv43p12, 3' ... 1215 0.0 1
(BJ327024) Dictyostelium discoideum cDNA clone:dda18j23, 5' ... 1207 0.0 1
(BJ434056) Dictyostelium discoideum cDNA clone:ddv23c23, 3' ... 1156 0.0 1
(BJ383150) Dictyostelium discoideum cDNA clone:ddc52d02, 3' ... 868 0.0 2
(AU270699) Dictyostelium discoideum vegetative cDNA clone:VS... 597 0.0 2
(BJ444384) Dictyostelium discoideum cDNA clone:ddv56p03, 3' ... 438 0.0 4
(AU270700) Dictyostelium discoideum vegetative cDNA clone:VS... 500 0.0 3
(AU261484) Dictyostelium discoideum vegetative cDNA clone:VS... 906 0.0 1
(AU261712) Dictyostelium discoideum vegetative cDNA clone:VS... 858 0.0 1
(BJ418437) Dictyostelium discoideum cDNA clone:ddv32c20, 5' ... 731 0.0 1
(BJ427427) Dictyostelium discoideum cDNA clone:ddv62k11, 5' ... 678 0.0 1
(BJ418081) Dictyostelium discoideum cDNA clone:ddv31h17, 5' ... 666 0.0 1
(BJ418910) Dictyostelium discoideum cDNA clone:ddv34n11, 5' ... 624 e-174 1
(AU261811) Dictyostelium discoideum vegetative cDNA clone:VS... 553 e-152 1
(BJ415795) Dictyostelium discoideum cDNA clone:ddv23c23, 5' ... 507 e-139 1
(BJ425846) Dictyostelium discoideum cDNA clone:ddv57d09, 5' ... 448 e-121 1
(BJ419325) Dictyostelium discoideum cDNA clone:ddv35b23, 5' ... 448 e-121 1
(BJ421677) Dictyostelium discoideum cDNA clone:ddv43p12, 5' ... 446 e-120 1
(BJ440480) Dictyostelium discoideum cDNA clone:ddv43g21, 3' ... 389 e-103 1
(AU268204) Dictyostelium discoideum vegetative cDNA clone:VS... 345 5e-90 1
(AU268203) Dictyostelium discoideum vegetative cDNA clone:VS... 345 5e-90 1
(DR538672) WS0277.B21_J11 SS-IL-A-FL-14 Picea sitchensis cDN... 50 2e-19 6
(CF436628) EST672973 normalized cDNA library of onion Allium... 74 2e-17 4
(DR524403) WS02717.B21_C23 SS-IL-A-FL-14 Picea sitchensis cD... 44 3e-17 6
(EA053483) Sequence 203 from patent US 7157621. 58 4e-17 6
(DR487716) WS0287.B21_M03 SS-IB-A-FL-13 Picea sitchensis cDN... 44 1e-16 6
(DT760713) EST1194562 Aquilegia cDNA library Aquilegia formo... 50 1e-16 4
(DT759656) EST1193505 Aquilegia cDNA library Aquilegia formo... 50 2e-16 4
(CA071659) SCBGAM1089B11.g AM1 Saccharum officinarum cDNA cl... 64 9e-16 3
(CA075867) SCJLAM1064C05.g AM1 Saccharum officinarum cDNA cl... 64 2e-15 3
(BJ423182) Dictyostelium discoideum cDNA clone:ddv48h07, 5' ... 98 2e-15 1
(EY081348) CAZI14773.fwd CAZI Artemisia annua normalized lea... 78 2e-15 2
(CA157078) SCEQRZ3022G05.g RZ3 Saccharum officinarum cDNA cl... 64 7e-15 3
(CA173286) SCUTSB1074C02.g SB1 Saccharum officinarum cDNA cl... 64 2e-14 2
(CA253200) SCJLFL4098H06.g FL4 Saccharum officinarum cDNA cl... 64 3e-14 2
(CA199862) SCRLFL1013B05.g FL1 Saccharum officinarum cDNA cl... 64 3e-14 2
(EL404072) CFFS2003.b1_E21.ab1 CFF(LMS) safflower Carthamus ... 94 3e-14 1
(EL392154) CFFM3718.b1_K18.ab1 CFF(LMS) safflower Carthamus ... 94 3e-14 1
(EX922853) la71f12.g2 Cycas ovule - normalized (NYBG) Cycas ... 72 3e-14 4
(ES872940) WS02839.CR_M04 SS-IB-A-FL-13 Picea sitchensis cDN... 50 5e-14 5
(BT002736) Arabidopsis thaliana clone C105116 putative ATP c... 56 5e-14 4
(CA177470) SCQGST1033C01.g ST1 Saccharum officinarum cDNA cl... 60 6e-14 3
(AY050858) Arabidopsis thaliana At3g06650 mRNA sequence. 56 8e-14 4
(EA053488) Sequence 213 from patent US 7157621. 66 9e-14 4
(FE537277) 1341 Library from leaves trichomes of Salvia frut... 74 1e-13 3
(AK099208) Oryza sativa Japonica Group cDNA clone:J013055I05... 66 1e-13 4
(DR498781) WS02916.C21_K21 SS-IB-A-FL-15 Picea sitchensis cD... 44 1e-13 5
(AK070568) Oryza sativa Japonica Group cDNA clone:J023057I24... 66 1e-13 4
(BQ998939) QGG20K18.yg.ab1 QG_EFGHJ lettuce serriola Lactuca... 56 2e-13 3
(CA289719) SCAGFL8008C06.g FL8 Saccharum officinarum cDNA cl... 64 2e-13 3
(EL395361) CFFM671.b1_M24.ab1 CFF(LMS) safflower Carthamus t... 66 3e-13 3
(EL377310) CFFM14635.b1_E11.ab1 CFF(LMS) safflower Carthamus... 66 3e-13 3
(EL393904) CFFM536.b1_P13.ab1 CFF(LMS) safflower Carthamus t... 66 3e-13 3
(AK062011) Oryza sativa Japonica Group cDNA clone:001-043-E0... 66 3e-13 3
(EL510677) CFFY663.b1_M22.ab1 CFF(XYZ) safflower Carthamus t... 66 3e-13 3
(EA053482) Sequence 201 from patent US 7157621. 58 7e-13 4
(EL392218) CFFM3783.b1_N10.ab1 CFF(LMS) safflower Carthamus ... 66 9e-13 3
(EH695256) CCIM7118.b1_K04.ab1 CCI(LMS) chicory Cichorium in... 80 1e-12 3
(EY756039) CS13-C1-001-002-H07-CT.F Sweet orange leaf, field... 60 1e-12 3
(AY062956) Arabidopsis thaliana putative ATP citrate lyase (... 62 1e-12 3
(BX830770) Arabidopsis thaliana Full-length cDNA Complete se... 62 2e-12 3
(AY035067) Arabidopsis thaliana putative ATP citrate lyase (... 62 2e-12 3
(DY284401) IC0AAA61BB03RM1 CitNFL Citrus clementina cDNA 5',... 60 2e-12 3
(AY056594) Arabidopsis thaliana ATP-citrate lyase subunit B ... 62 2e-12 3
(CQ799182) Sequence 11 from Patent EP1411125. 62 2e-12 3
(AR716148) Sequence 11 from patent US 6942994. 62 2e-12 3
(AR564933) Sequence 11 from patent US 6764851. 62 2e-12 3
(DW125799) CLSX2299.b1_F24.ab1 CLS(XYZ) lettuce sativa Lactu... 52 5e-12 3
(CA205030) SCSFSB1100C09.g SB1 Saccharum officinarum cDNA cl... 64 5e-12 2
(BT008930) Triticum aestivum clone wde1f.pk003.h2:fis, full ... 58 5e-12 4
(EA053495) Sequence 227 from patent US 7157621. 58 5e-12 4
(CA213250) SCQGSB1139C10.g SB1 Saccharum officinarum cDNA cl... 64 6e-12 2
(DV175367) CV04002X1G06.f1 CV04-normalized library Cirsium a... 86 7e-12 2
(CA195483) SCEZSB1094G03.g SB1 Saccharum officinarum cDNA cl... 64 7e-12 2
(EH742014) CNMS1689.b1_B15.ab1 CNM(LMS) spotted knapweed Cen... 86 7e-12 1
(DR921931) EST1113470 Aquilegia cDNA library Aquilegia formo... 50 1e-11 4
(DR526703) WS02722.C21_K13 SS-IL-A-FL-14 Picea sitchensis cD... 44 2e-11 5
(DR527923) WS02726.C21_C24 SS-IL-A-FL-14 Picea sitchensis cD... 44 2e-11 5
(EB660291) 1Z6III_JF_G12 pAPO Cenchrus ciliaris cDNA 3', mRN... 58 3e-11 2
(DR521792) WS0271.B21_P12 SS-IL-A-FL-14 Picea sitchensis cDN... 44 3e-11 5
(EE047412) ZM_BFc0120D09.r ZM_BFc Zea mays cDNA clone ZM_BFc... 58 3e-11 2
(DW164848) CLVY3391.b1_N08.ab1 CLV(XYZ) lettuce virosa Lactu... 54 4e-11 3
(DW155345) CLVX7379.b1_E21.ab1 CLV(XYZ) lettuce virosa Lactu... 54 5e-11 3
(DW106431) CLRX4180.b1_H14.ab1 CLR(XYZ) lettuce serriola Lac... 54 5e-11 3
(DV486424) 5502_F12_K24RZ_086 Brachypodium distachyon root E... 66 5e-11 2
(EE089799) S6B05258 Fruits 7-9 mm (VvS6) Vitis vinifera cDNA... 58 5e-11 3
(DW104577) CLRX2384.b1_O19.ab1 CLR(XYZ) lettuce serriola Lac... 54 6e-11 3
(DW160255) CLVY12337.b1_A13.ab1 CLV(XYZ) lettuce virosa Lact... 54 6e-11 3
(DW108399) CLRX5738.b1_D20.ab1 CLR(XYZ) lettuce serriola Lac... 54 7e-11 3
>(BJ437494) Dictyostelium discoideum cDNA clone:ddv34n11, 3' end,
single read.
Length = 803
Score = 1495 bits (754), Expect = 0.0
Identities = 754/754 (100%)
Strand = Plus / Minus
Query: 1354 tgtgatgatcgtggtgatgaactttccttatgcaggtgtaccaattagtgaagtatgtaa 1413
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 803 tgtgatgatcgtggtgatgaactttccttatgcaggtgtaccaattagtgaagtatgtaa 744
Query: 1414 agagcaatataatatgggtgatgtgattggcttactttggttcaagagaaagttaccacc 1473
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 743 agagcaatataatatgggtgatgtgattggcttactttggttcaagagaaagttaccacc 684
Query: 1474 atacgcttccaagttctttgaaatgtgtttgaaactagttgccgatcatggtccatgtgt 1533
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 683 atacgcttccaagttctttgaaatgtgtttgaaactagttgccgatcatggtccatgtgt 624
Query: 1534 tagtggtgctcataatacaatcgttgctgctcgtgctggtaaggatttagtatcaagtct 1593
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 623 tagtggtgctcataatacaatcgttgctgctcgtgctggtaaggatttagtatcaagtct 564
Query: 1594 tgtttcaggtttattaacaattggaccacgttttggtggtgccatcgatgatagtgctcg 1653
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 563 tgtttcaggtttattaacaattggaccacgttttggtggtgccatcgatgatagtgctcg 504
Query: 1654 tgtattccaagatgcagtcgataacaatttacaaccatcacaatttgttgaaggtatgaa 1713
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 503 tgtattccaagatgcagtcgataacaatttacaaccatcacaatttgttgaaggtatgaa 444
Query: 1714 atcaaagggtaaaagaattccaggtattggtcatttaattaaatctgccgatgaaatcga 1773
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 443 atcaaagggtaaaagaattccaggtattggtcatttaattaaatctgccgatgaaatcga 384
Query: 1774 taaaagagtagtattattaaaagattatgctttcactcatttctcatcaacaaaatattt 1833
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 383 taaaagagtagtattattaaaagattatgctttcactcatttctcatcaacaaaatattt 324
Query: 1834 agaatacgcattggaagttgaaaaatatacccttcaaaaagcaaataatttaattttaaa 1893
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 323 agaatacgcattggaagttgaaaaatatacccttcaaaaagcaaataatttaattttaaa 264
Query: 1894 tgttgatggttgtattggtgtattatttttagatttattacattcatccggtttattcac 1953
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 263 tgttgatggttgtattggtgtattatttttagatttattacattcatccggtttattcac 204
Query: 1954 tcaacatgaaattaaagaaattatagatgttggttatttaaatggtttctttattgttgg 2013
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 203 tcaacatgaaattaaagaaattatagatgttggttatttaaatggtttctttattgttgg 144
Query: 2014 tagaagtgttggtttaatcggtcacgcattagatcaacgtagaaataaacaaggacttta 2073
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 143 tagaagtgttggtttaatcggtcacgcattagatcaacgtagaaataaacaaggacttta 84
Query: 2074 tagacaccaagctgatgatgttcattatgccctt 2107
||||||||||||||||||||||||||||||||||
Sbjct: 83 tagacaccaagctgatgatgttcattatgccctt 50
Score = 56.0 bits (28), Expect = 0.006
Identities = 28/28 (100%)
Strand = Plus / Minus
Query: 1316 tgtgatgatcgtggtgatgaactttcct 1343
||||||||||||||||||||||||||||
Sbjct: 803 tgtgatgatcgtggtgatgaactttcct 776
Lambda K H
1.37 0.711 1.31
Matrix: blastn matrix:1 -3
Number of Sequences: 92845959
Number of Hits to DB: 2,126,435,625
Number of extensions: 122615839
Number of successful extensions: 9808650
Number of sequences better than 10.0: 828
Length of query: 2253
Length of database: 95,242,211,685
Length adjustment: 24
Effective length of query: 2229
Effective length of database: 97,308,875,965
Effective search space: 216901484525985
Effective search space used: 216901484525985
X1: 11 (21.8 bits)
S2: 23 (46.1 bits)
|
| protein update |
2009. 6.30 |
| Homology vs Protein |
Query= Contig-U11694-1 (Contig-U11694-1Q) /CSM_Contig/Contig-U11694-1Q.Seq.d
(2253 letters)
Database: nrp_B
3,236,559 sequences; 1,051,180,864 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
(Q54YA0) RecName: Full=Probable ATP-citrate synthase; E... 1125 0.0
AP002883_22(AP002883|pid:none) Oryza sativa Japonica Group genom... 760 0.0
AJ243483_1(AJ243483|pid:none) Cyanophora paradoxa mRNA for ATP c... 752 0.0
EF571302_1(EF571302|pid:none) Glycyrrhiza uralensis ATP citrate ... 751 0.0
AC020580_2(AC020580|pid:none) Arabidopsis thaliana chromosome 3 ... 749 0.0
AB023034_12(AB023034|pid:none) Arabidopsis thaliana genomic DNA,... 748 0.0
AJ344107_1(AJ344107|pid:none) Lupinus albus mRNA for ATP citrate... 747 0.0
AF290958_1(AF290958|pid:none) Capsicum annuum ATP:citrate lyase ... 735 0.0
AJ851548_1(AJ851548|pid:none) Gallus gallus mRNA for hypothetica... 635 e-180
AJ243439_1(AJ243439|pid:none) Cyanophora paradoxa acly gene, exo... 632 e-179
(Q91V92) RecName: Full=ATP-citrate synthase; EC=2.3.3.8... 630 e-179
BC100618_1(BC100618|pid:none) Rattus norvegicus ATP citrate lyas... 630 e-179
L47319_1(L47319|pid:none) Rattus norvegicus ATP-citrate lyase (A... 630 e-179
BC080908_1(BC080908|pid:none) Xenopus tropicalis acly protein, m... 629 e-178
AK095084_1(AK095084|pid:none) Homo sapiens cDNA FLJ37765 fis, cl... 629 e-178
(P53396) RecName: Full=ATP-citrate synthase; EC=2.3.3.8... 629 e-178
BC084253_1(BC084253|pid:none) Xenopus laevis hypothetical LOC495... 629 e-178
AK295675_1(AK295675|pid:none) Homo sapiens cDNA FLJ56442 complet... 629 e-178
AK304802_1(AK304802|pid:none) Homo sapiens cDNA FLJ55447 complet... 629 e-178
BC099037_1(BC099037|pid:none) Xenopus laevis hypothetical LOC495... 629 e-178
(Q32PF2) RecName: Full=ATP-citrate synthase; EC=2.3.3.8... 625 e-177
BC076484_1(BC076484|pid:none) Danio rerio ATP citrate lyase, mRN... 624 e-177
BC084776_1(BC084776|pid:none) Xenopus laevis hypothetical LOC495... 624 e-177
AF132166_1(AF132166|pid:none) Drosophila melanogaster LD21334 fu... 619 e-175
EU073662_1(EU073662|pid:none) Sus scrofa ATP citrate lyase (ACL)... 612 e-173
(Q8X097) RecName: Full=Probable ATP-citrate synthase subunit 1; ... 611 e-173
AP007157_187(AP007157|pid:none) Aspergillus oryzae RIB40 genomic... 611 e-173
CR382131_1449(CR382131|pid:none) Yarrowia lipolytica strain CLIB... 610 e-173
CP001230_1680(CP001230|pid:none) Persephonella marina EX-H1, com... 610 e-173
CU638743_785(CU638743|pid:none) Podospora anserina genomic DNA c... 608 e-172
AM270218_51(AM270218|pid:none) Aspergillus niger contig An11c001... 606 e-171
(P53585) RecName: Full=Probable ATP-citrate synthase; E... 604 e-171
AM920436_2048(AM920436|pid:none) Penicillium chrysogenum Wiscons... 603 e-171
AE013599_2272(AE013599|pid:none) Drosophila melanogaster chromos... 602 e-170
(Q9P7W3) RecName: Full=Probable ATP-citrate synthase subunit 1; ... 598 e-169
CP001229_516(CP001229|pid:none) Sulfurihydrogenibium azorense Az... 598 e-169
CP001080_1022(CP001080|pid:none) Sulfurihydrogenibium sp. YO3AOP... 597 e-169
CP001279_683(CP001279|pid:none) Nautilia profundicola AmH, compl... 577 e-163
FN357308_19(FN357308|pid:none) Schistosoma mansoni genome sequen... 571 e-161
EU038296_1(EU038296|pid:none) Toxoplasma gondii strain RH ATP ci... 567 e-160
AB036847_1(AB036847|pid:none) Ciona intestinalis Ci-ACL mRNA for... 564 e-159
DQ853419_2(DQ853419|pid:none) Desulfurobacterium thermolithotrop... 552 e-155
DQ853421_2(DQ853421|pid:none) Thermovibrio ruber ATP citrate lya... 552 e-155
DQ853422_2(DQ853422|pid:none) Sulfurihydrogenibium subterraneum ... 540 e-151
AK136812_1(AK136812|pid:none) Mus musculus adult male diencephal... 478 e-133
EF644662_1(EF644662|pid:none) Enrichment culture clone BSaclA26 ... 391 e-107
DQ853420_1(DQ853420|pid:none) Thermovibrio ammonificans ATP citr... 390 e-107
EF644656_1(EF644656|pid:none) Enrichment culture clone BSaclA1 A... 373 e-101
EF644658_1(EF644658|pid:none) Enrichment culture clone BSaclA17 ... 368 e-100
EF644685_1(EF644685|pid:none) Enrichment culture clone BSEaclA5 ... 346 2e-93
EF644761_1(EF644761|pid:none) Lebetimonas acidiphila ATP citrate... 337 1e-90
EF644759_1(EF644759|pid:none) Caminibacter hydrogeniphilus ATP c... 336 2e-90
EF644682_1(EF644682|pid:none) Enrichment culture clone BSEaclA2 ... 334 9e-90
EF644684_1(EF644684|pid:none) Enrichment culture clone BSEaclA4 ... 332 5e-89
EZ000517_1(EZ000517|pid:none) TSA: Culex tarsalis Ctar-396 ATP-c... 329 2e-88
EF644683_1(EF644683|pid:none) Enrichment culture clone BSEaclA3 ... 327 9e-88
CP001108_1059(CP001108|pid:none) Prosthecochloris aestuarii DSM ... 325 3e-87
AE006470_1078(AE006470|pid:none) Chlorobium tepidum TLS, complet... 325 4e-87
CP001099_988(CP001099|pid:none) Chlorobaculum parvum NCIB 8327, ... 325 6e-87
AB054670_1(AB054670|pid:none) Chlorobium limicola aclA gene for ... 324 7e-87
CP001097_1190(CP001097|pid:none) Chlorobium limicola DSM 245, co... 323 2e-86
D89194_1(D89194|pid:none) Schizosaccharomyces pombe mRNA, partia... 321 8e-86
CP001101_1292(CP001101|pid:none) Chlorobium phaeobacteroides BS1... 312 3e-83
CP000607_852(CP000607|pid:none) Chlorobium phaeovibrioides DSM 2... 309 2e-82
EF644760_1(EF644760|pid:none) Hydrogenimonas thermophila ATP cit... 308 6e-82
CP000096_1032(CP000096|pid:none) Pelodictyon luteolum DSM 273, c... 305 5e-81
EF644763_1(EF644763|pid:none) Sulfurovum lithotrophicum ATP citr... 287 1e-75
EF644660_1(EF644660|pid:none) Enrichment culture clone BSaclA20 ... 281 6e-74
AK220717_1(AK220717|pid:none) Arabidopsis thaliana mRNA for ATP-... 252 5e-65
AY885678_1(AY885678|pid:none) Candidatus Arcobacter sulfidicus A... 249 3e-64
BC005533_1(BC005533|pid:none) Mus musculus ATP citrate lyase, mR... 227 1e-57
EU481293_1(EU481293|pid:none) Caenorhabditis remanei strain PB20... 213 2e-53
EU481305_1(EU481305|pid:none) Caenorhabditis remanei strain PB25... 211 1e-52
AJ245664_1(AJ245664|pid:none) Gallus gallus partial mRNA for ATP... 182 6e-44
DQ897533_1(DQ897533|pid:none) Caenorhabditis remanei strain CR10... 152 5e-35
DQ897543_1(DQ897543|pid:none) Caenorhabditis remanei strain PB21... 152 5e-35
DQ897562_1(DQ897562|pid:none) Caenorhabditis remanei strain PB27... 152 5e-35
DQ897550_1(DQ897550|pid:none) Caenorhabditis remanei strain PB24... 152 5e-35
DQ897534_1(DQ897534|pid:none) Caenorhabditis remanei strain CR14... 152 5e-35
DQ897536_1(DQ897536|pid:none) Caenorhabditis remanei strain JU82... 152 5e-35
DQ147961_1(DQ147961|pid:none) Macaca mulatta clone dl2_l03_t7_08... 151 9e-35
DQ897547_1(DQ897547|pid:none) Caenorhabditis remanei strain PB23... 151 1e-34
BC065805_1(BC065805|pid:none) Mus musculus ATP citrate lyase, mR... 134 1e-29
A72707(A72707)probable succinyl-CoA synthetase alpha chain APE10... 115 9e-24
BA000002_733(BA000002|pid:none) Aeropyrum pernix K1 DNA, complet... 115 9e-24
CP000493_193(CP000493|pid:none) Hyperthermus butylicus DSM 5456,... 107 2e-21
CP000816_85(CP000816|pid:none) Ignicoccus hospitalis KIN4/I, com... 106 3e-21
DQ231609_1(DQ231609|pid:none) Caenorhabditis elegans strain ED30... 99 7e-19
DQ231719_1(DQ231719|pid:none) Caenorhabditis elegans strain CB48... 99 9e-19
DQ231723_1(DQ231723|pid:none) Caenorhabditis elegans strain N2 h... 97 2e-18
CP000505_513(CP000505|pid:none) Thermofilum pendens Hrk 5, compl... 96 4e-18
CP001230_1122(CP001230|pid:none) Persephonella marina EX-H1, com... 95 1e-17
CP000102_561(CP000102|pid:none) Methanosphaera stadtmanae DSM 30... 94 2e-17
(O28733) RecName: Full=Succinyl-CoA ligase [ADP-forming] subunit... 94 2e-17
CP001400_273(CP001400|pid:none) Sulfolobus islandicus M.14.25, c... 94 2e-17
CP001080_604(CP001080|pid:none) Sulfurihydrogenibium sp. YO3AOP1... 93 4e-17
CP000159_650(CP000159|pid:none) Salinibacter ruber DSM 13855, co... 93 5e-17
CP001402_292(CP001402|pid:none) Sulfolobus islandicus M.16.4, co... 93 5e-17
(O26663) RecName: Full=Succinyl-CoA ligase [ADP-forming] subunit... 92 6e-17
AE016822_1578(AE016822|pid:none) Leifsonia xyli subsp. xyli str.... 92 6e-17
CP000252_2416(CP000252|pid:none) Syntrophus aciditrophicus SB, c... 92 8e-17
CP000304_1845(CP000304|pid:none) Pseudomonas stutzeri A1501, com... 92 8e-17
AB221128_2(AB221128|pid:none) Pelotomaculum thermopropionicum mm... 91 1e-16
CP000388_1790(CP000388|pid:none) Pseudoalteromonas atlantica T6c... 91 2e-16
CP000285_1211(CP000285|pid:none) Chromohalobacter salexigens DSM... 91 2e-16
CP000607_1511(CP000607|pid:none) Chlorobium phaeovibrioides DSM ... 91 2e-16
AF128399_2(AF128399|pid:none) Pseudomonas aeruginosa succinyl-Co... 91 2e-16
AM711867_2575(AM711867|pid:none) Clavibacter michiganensis subsp... 90 3e-16
CP000968_1379(CP000968|pid:none) Candidatus Korarchaeum cryptofi... 90 3e-16
CT573326_3368(CT573326|pid:none) Pseudomonas entomophila str. L4... 90 3e-16
CP000141_890(CP000141|pid:none) Carboxydothermus hydrogenoforman... 90 3e-16
DQ231707_1(DQ231707|pid:none) Caenorhabditis elegans strain JU39... 90 3e-16
AE015451_4132(AE015451|pid:none) Pseudomonas putida KT2440 compl... 90 3e-16
EF147032_1(EF147032|pid:none) Populus trichocarpa clone WS01226_... 90 4e-16
CP000749_2765(CP000749|pid:none) Marinomonas sp. MWYL1, complete... 89 5e-16
CP000746_1536(CP000746|pid:none) Actinobacillus succinogenes 130... 89 7e-16
CR954246_1603(CR954246|pid:none) Pseudoalteromonas haloplanktis ... 89 9e-16
CP000155_4518(CP000155|pid:none) Hahella chejuensis KCTC 2396, c... 89 9e-16
CP000488_135(CP000488|pid:none) Candidatus Ruthia magnifica str.... 89 9e-16
CP001618_2995(CP001618|pid:none) Beutenbergia cavernae DSM 12333... 89 9e-16
CP000930_390(CP000930|pid:none) Heliobacterium modesticaldum Ice... 89 9e-16
CP001103_1862(CP001103|pid:none) Alteromonas macleodii 'Deep eco... 89 9e-16
DQ231724_1(DQ231724|pid:none) Caenorhabditis elegans strain RC30... 88 1e-15
CP000478_1685(CP000478|pid:none) Syntrophobacter fumaroxidans MP... 88 1e-15
DQ231706_1(DQ231706|pid:none) Caenorhabditis elegans strain JU39... 88 1e-15
(O28098) RecName: Full=Succinyl-CoA ligase [ADP-forming] subunit... 88 2e-15
CP000058_1896(CP000058|pid:none) Pseudomonas syringae pv. phaseo... 88 2e-15
(Q51567) RecName: Full=Succinyl-CoA ligase [ADP-forming] subunit... 88 2e-15
CP000510_2119(CP000510|pid:none) Psychromonas ingrahamii 37, com... 88 2e-15
(Q92I22) RecName: Full=Succinyl-CoA ligase [ADP-forming] subunit... 87 2e-15
CP000094_1617(CP000094|pid:none) Pseudomonas fluorescens Pf0-1, ... 87 2e-15
CU207366_1747(CU207366|pid:none) Gramella forsetii KT0803 comple... 87 3e-15
CP000776_1072(CP000776|pid:none) Campylobacter hominis ATCC BAA-... 87 3e-15
AP009044_2518(AP009044|pid:none) Corynebacterium glutamicum R DN... 87 3e-15
CP001034_2361(CP001034|pid:none) Natranaerobius thermophilus JW/... 87 3e-15
CP001100_2657(CP001100|pid:none) Chloroherpeton thalassium ATCC ... 87 3e-15
AY238445_1(AY238445|pid:none) Neocallimastix frontalis succinyl-... 87 3e-15
CP001227_88(CP001227|pid:none) Rickettsia peacockii str. Rustic,... 87 3e-15
AF493054_1(AF493054|pid:none) Neocallimastix patriciarum succiny... 87 3e-15
EU959743_1(EU959743|pid:none) Zea mays clone 219746 succinyl-CoA... 87 3e-15
CP000660_1467(CP000660|pid:none) Pyrobaculum arsenaticum DSM 135... 86 4e-15
AP008232_879(AP008232|pid:none) Sodalis glossinidius str. 'morsi... 86 4e-15
CP001099_1728(CP001099|pid:none) Chlorobaculum parvum NCIB 8327,... 86 4e-15
CP001614_2209(CP001614|pid:none) Teredinibacter turnerae T7901, ... 86 6e-15
CP001014_1431(CP001014|pid:none) Thermoproteus neutrophilus V24S... 86 6e-15
CP000575_466(CP000575|pid:none) Staphylothermus marinus F1, comp... 86 6e-15
CP001321_599(CP001321|pid:none) Haemophilus parasuis SH0165, com... 86 6e-15
CP000076_1696(CP000076|pid:none) Pseudomonas fluorescens Pf-5, c... 86 6e-15
AB124582_5(AB124582|pid:none) Hydrogenobacter thermophilus genes... 86 8e-15
AM286690_1492(AM286690|pid:none) Alcanivorax borkumensis SK2, co... 86 8e-15
CP001097_318(CP001097|pid:none) Chlorobium limicola DSM 245, com... 86 8e-15
AB185162_1(AB185162|pid:none) Hydrogenobacter thermophilus genes... 86 8e-15
CP000866_1120(CP000866|pid:none) Nitrosopumilus maritimus SCM1, ... 86 8e-15
CP000947_1396(CP000947|pid:none) Haemophilus somnus 2336, comple... 86 8e-15
AE017354_523(AE017354|pid:none) Legionella pneumophila subsp. pn... 86 8e-15
AM884176_194(AM884176|pid:none) Chlamydia trachomatis strain L2/... 86 8e-15
CP001108_394(CP001108|pid:none) Prosthecochloris aestuarii DSM 2... 86 8e-15
AE005674_568(AE005674|pid:none) Shigella flexneri 2a str. 301, c... 85 1e-14
CP000504_1017(CP000504|pid:none) Pyrobaculum islandicum DSM 4184... 85 1e-14
CP000675_633(CP000675|pid:none) Legionella pneumophila str. Corb... 85 1e-14
CP000025_624(CP000025|pid:none) Campylobacter jejuni RM1221, com... 85 1e-14
AM286415_2798(AM286415|pid:none) Yersinia enterocolitica subsp. ... 85 1e-14
CP000103_1074(CP000103|pid:none) Nitrosospira multiformis ATCC 2... 85 1e-14
CR378666_109(CR378666|pid:none) Photobacterium profundum SS9; se... 85 1e-14
CP000826_1264(CP000826|pid:none) Serratia proteamaculans 568, co... 85 1e-14
CP000284_1884(CP000284|pid:none) Methylobacillus flagellatus KT,... 85 1e-14
CP000057_1194(CP000057|pid:none) Haemophilus influenzae 86-028NP... 85 1e-14
AE002160_202(AE002160|pid:none) Chlamydia muridarum Nigg, comple... 85 1e-14
AE017282_1640(AE017282|pid:none) Methylococcus capsulatus str. B... 85 1e-14
(P0AGE9) RecName: Full=Succinyl-CoA ligase [ADP-forming] subunit... 84 2e-14
CP000964_3762(CP000964|pid:none) Klebsiella pneumoniae 342, comp... 84 2e-14
DQ235193_1(DQ235193|pid:none) Solanum tuberosum clone 167F09 suc... 84 2e-14
AL939121_156(AL939121|pid:none) Streptomyces coelicolor A3(2) co... 84 2e-14
CP001600_2764(CP001600|pid:none) Edwardsiella ictaluri 93-146, c... 84 2e-14
(Q58643) RecName: Full=Succinyl-CoA ligase [ADP-forming] subunit... 84 2e-14
EU903998_1(EU903998|pid:none) Escherichia coli strain TB182A suc... 84 2e-14
CP000683_443(CP000683|pid:none) Rickettsia massiliae MTU5, compl... 84 2e-14
CP000487_870(CP000487|pid:none) Campylobacter fetus subsp. fetus... 84 2e-14
CP000750_3969(CP000750|pid:none) Kineococcus radiotolerans SRS30... 84 2e-14
(P45102) RecName: Full=Succinyl-CoA ligase [ADP-forming] subunit... 84 2e-14
AM933173_708(AM933173|pid:none) Salmonella enterica subsp. enter... 84 2e-14
AM942759_565(AM942759|pid:none) Proteus mirabilis strain HI4320,... 84 2e-14
AE014613_2006(AE014613|pid:none) Salmonella enterica subsp. ente... 84 3e-14
CP000934_1472(CP000934|pid:none) Cellvibrio japonicus Ueda107, c... 84 3e-14
CP000026_1868(CP000026|pid:none) Salmonella enterica subsp. ente... 84 3e-14
CP001144_752(CP001144|pid:none) Salmonella enterica subsp. enter... 84 3e-14
CP000743_764(CP000743|pid:none) Methanococcus aeolicus Nankai-3,... 84 3e-14
CP000943_6225(CP000943|pid:none) Methylobacterium sp. 4-46, comp... 83 4e-14
CP000360_3869(CP000360|pid:none) Acidobacteria bacterium Ellin34... 83 4e-14
AE006470_268(AE006470|pid:none) Chlorobium tepidum TLS, complete... 83 4e-14
CP000854_4484(CP000854|pid:none) Mycobacterium marinum M, comple... 83 4e-14
(O67547) RecName: Full=Succinyl-CoA ligase [ADP-forming] subunit... 83 4e-14
AD0137(AD0137) succinate-CoA ligase (ADP-forming) (EC 6.2.1.5) a... 83 5e-14
(P09143) RecName: Full=Succinyl-CoA ligase [ADP-forming] subunit... 83 5e-14
AP008957_4428(AP008957|pid:none) Rhodococcus erythropolis PR4 DN... 83 5e-14
CP000880_2127(CP000880|pid:none) Salmonella enterica subsp. ariz... 83 5e-14
BA000030_1823(BA000030|pid:none) Streptomyces avermitilis MA-468... 83 5e-14
(P53400) RecName: Full=Succinyl-CoA ligase [GDP-forming] subunit... 83 5e-14
CP001101_412(CP001101|pid:none) Chlorobium phaeobacteroides BS1,... 82 6e-14
X77919_6(X77919|pid:none) C.burnetti Nine Mile RSA493 phase I ge... 82 6e-14
CP001140_1037(CP001140|pid:none) Desulfurococcus kamchatkensis 1... 82 8e-14
AE016795_147(AE016795|pid:none) Vibrio vulnificus CMCP6 chromoso... 82 8e-14
CP000580_4658(CP000580|pid:none) Mycobacterium sp. JLS, complete... 82 8e-14
CP000480_5338(CP000480|pid:none) Mycobacterium smegmatis str. MC... 82 8e-14
CP001574_16(CP001574|pid:none) Micromonas sp. RCC299 chromosome ... 82 8e-14
CP000116_806(CP000116|pid:none) Thiobacillus denitrificans ATCC ... 82 8e-14
CP000020_819(CP000020|pid:none) Vibrio fischeri ES114 chromosome... 82 8e-14
CP000302_2165(CP000302|pid:none) Shewanella denitrificans OS217,... 82 8e-14
CP000394_53(CP000394|pid:none) Granulibacter bethesdensis CGDNIH... 82 8e-14
CU458896_1044(CU458896|pid:none) Mycobacterium abscessus chromos... 82 8e-14
CP000083_2165(CP000083|pid:none) Colwellia psychrerythraea 34H, ... 82 8e-14
CP000112_2330(CP000112|pid:none) Desulfovibrio desulfuricans G20... 82 1e-13
AY087899_1(AY087899|pid:none) Arabidopsis thaliana clone 39462 m... 82 1e-13
(P53596) RecName: Full=Probable succinyl-CoA ligase [GDP-forming... 82 1e-13
CP000931_2467(CP000931|pid:none) Shewanella halifaxensis HAW-EB4... 82 1e-13
AM494475_150(AM494475|pid:none) Orientia tsutsugamushi Boryong c... 82 1e-13
BX294152_4(BX294152|pid:none) Rhodopirellula baltica SH 1 comple... 81 1e-13
BA000031_850(BA000031|pid:none) Vibrio parahaemolyticus RIMD 221... 81 1e-13
CP000237_241(CP000237|pid:none) Neorickettsia sennetsu strain Mi... 81 1e-13
CP000450_584(CP000450|pid:none) Nitrosomonas eutropha C91, compl... 81 1e-13
CP001349_6805(CP001349|pid:none) Methylobacterium nodulans ORS 2... 81 1e-13
CP000671_1057(CP000671|pid:none) Haemophilus influenzae PittEE, ... 81 1e-13
AE001363_953(AE001363|pid:none) Chlamydophila pneumoniae CWL029,... 81 2e-13
AP009247_144(AP009247|pid:none) Candidatus Vesicomyosocius okuta... 81 2e-13
CP000685_2881(CP000685|pid:none) Flavobacterium johnsoniae UW101... 81 2e-13
CP000713_265(CP000713|pid:none) Psychrobacter sp. PRwf-1, comple... 81 2e-13
CP000847_592(CP000847|pid:none) Rickettsia akari str. Hartford, ... 81 2e-13
CP000562_838(CP000562|pid:none) Methanoculleus marisnigri JR1, c... 80 2e-13
EU016630_27(EU016630|pid:none) Uncultured Group I marine crenarc... 80 2e-13
CP001275_1744(CP001275|pid:none) Thermomicrobium roseum DSM 5159... 80 2e-13
CP000108_460(CP000108|pid:none) Chlorobium chlorochromatii CaD3,... 80 2e-13
(Q9AKE1) RecName: Full=Succinyl-CoA ligase [ADP-forming] subunit... 80 3e-13
CP000362_1077(CP000362|pid:none) Roseobacter denitrificans OCh 1... 80 3e-13
AP007255_3959(AP007255|pid:none) Magnetospirillum magneticum AMB... 80 3e-13
U87096_1(U87096|pid:none) Trichomonas vaginalis adhesin protein ... 80 3e-13
(P36967) RecName: Full=Succinyl-CoA ligase [GDP-forming] subunit... 80 3e-13
CR382131_987(CR382131|pid:none) Yarrowia lipolytica strain CLIB1... 80 3e-13
CP000509_3539(CP000509|pid:none) Nocardioides sp. JS614, complet... 80 3e-13
CP000890_1337(CP000890|pid:none) Coxiella burnetii RSA 331, comp... 80 3e-13
CP001029_1719(CP001029|pid:none) Methylobacterium populi BJ001, ... 80 3e-13
CP000479_1026(CP000479|pid:none) Mycobacterium avium 104, comple... 80 3e-13
AE016958_897(AE016958|pid:none) Mycobacterium avium subsp. parat... 80 3e-13
CP000627_1635(CP000627|pid:none) Vibrio cholerae O395 chromosome... 80 4e-13
AE003852_2052(AE003852|pid:none) Vibrio cholerae O1 biovar eltor... 80 4e-13
CP000384_4309(CP000384|pid:none) Mycobacterium sp. MCS, complete... 80 4e-13
AE015928_787(AE015928|pid:none) Bacteroides thetaiotaomicron VPI... 79 5e-13
CP000613_2136(CP000613|pid:none) Rhodospirillum centenum SW, com... 79 5e-13
CP001601_2056(CP001601|pid:none) Corynebacterium aurimucosum ATC... 79 5e-13
(P68209) RecName: Full=Succinyl-CoA ligase [GDP-forming] subunit... 79 5e-13
(Q7U0Z0) RecName: Full=Succinyl-CoA ligase [ADP-forming] subunit... 79 5e-13
CP000238_92(CP000238|pid:none) Baumannia cicadellinicola str. Hc... 79 5e-13
CP000644_2186(CP000644|pid:none) Aeromonas salmonicida subsp. sa... 79 5e-13
CP000323_115(CP000323|pid:none) Psychrobacter cryohalolentis K5,... 79 7e-13
CP000507_1425(CP000507|pid:none) Shewanella amazonensis SB2B, co... 79 7e-13
CP001110_402(CP001110|pid:none) Pelodictyon phaeoclathratiforme ... 79 7e-13
CP000770_128(CP000770|pid:none) Candidatus Sulcia muelleri GWSS,... 79 7e-13
AE014299_1897(AE014299|pid:none) Shewanella oneidensis MR-1, com... 79 7e-13
FN392321_848(FN392321|pid:none) Pichia pastoris GS115 chromosome... 79 7e-13
CP000016_322(CP000016|pid:none) Candidatus Blochmannia pennsylva... 79 7e-13
(O13750) RecName: Full=Probable succinyl-CoA ligase [GDP-forming... 79 7e-13
CP001280_1679(CP001280|pid:none) Methylocella silvestris BL2, co... 79 9e-13
DQ351275_6(DQ351275|pid:none) Streptomyces sp. NRRL 30748 merida... 79 9e-13
CP000789_1274(CP000789|pid:none) Vibrio harveyi ATCC BAA-1116 ch... 79 9e-13
CP000682_1559(CP000682|pid:none) Metallosphaera sedula DSM 5348,... 79 9e-13
S65966(S65966;S65891) succinate-CoA ligase (GDP-forming) (EC 6.2... 79 9e-13
CP001131_2216(CP001131|pid:none) Anaeromyxobacter sp. K, complet... 79 9e-13
CP000822_3747(CP000822|pid:none) Citrobacter koseri ATCC BAA-895... 79 9e-13
AE004439_281(AE004439|pid:none) Pasteurella multocida subsp. mul... 79 9e-13
CP000394_2069(CP000394|pid:none) Granulibacter bethesdensis CGDN... 79 9e-13
(P53399) RecName: Full=Succinyl-CoA ligase [GDP-forming] subunit... 79 9e-13
(P71558) RecName: Full=Succinyl-CoA ligase [ADP-forming] subunit... 78 1e-12
CP001154_2397(CP001154|pid:none) Laribacter hongkongensis HLHK9,... 78 1e-12
CP000937_240(CP000937|pid:none) Francisella philomiragia subsp. ... 78 1e-12
CP001130_1372(CP001130|pid:none) Hydrogenobaculum sp. Y04AAS1, c... 78 1e-12
AM494962_170(AM494962|pid:none) Leishmania braziliensis chromoso... 78 1e-12
CP001337_2728(CP001337|pid:none) Chloroflexus aggregans DSM 9485... 78 1e-12
CP000127_672(CP000127|pid:none) Nitrosococcus oceani ATCC 19707,... 78 1e-12
AP008230_983(AP008230|pid:none) Desulfitobacterium hafniense Y51... 78 1e-12
CP000821_2805(CP000821|pid:none) Shewanella sediminis HAW-EB3, c... 78 2e-12
CP000481_379(CP000481|pid:none) Acidothermus cellulolyticus 11B ... 78 2e-12
AP009153_1645(AP009153|pid:none) Gemmatimonas aurantiaca T-27 DN... 78 2e-12
CP000961_1823(CP000961|pid:none) Shewanella woodyi ATCC 51908, c... 78 2e-12
CR382139_457(CR382139|pid:none) Debaryomyces hansenii strain CBS... 78 2e-12
AM920427_687(AM920427|pid:none) Penicillium chrysogenum Wisconsi... 78 2e-12
CP000232_393(CP000232|pid:none) Moorella thermoacetica ATCC 3907... 78 2e-12
CU928162_4631(CU928162|pid:none) Escherichia coli ED1a chromosom... 78 2e-12
CP000409_619(CP000409|pid:none) Rickettsia canadensis str. McKie... 78 2e-12
S30579(S30579) succinate-CoA ligase (GDP-forming) (EC 6.2.1.4) a... 78 2e-12
CU459003_927(CU459003|pid:none) Magnetospirillum gryphiswaldense... 78 2e-12
BA000012_1045(BA000012|pid:none) Mesorhizobium loti MAFF303099 D... 78 2e-12
CP000447_2323(CP000447|pid:none) Shewanella frigidimarina NCIMB ... 77 2e-12
FM992688_153(FM992688|pid:none) Candida dubliniensis CD36 chromo... 77 2e-12
BX842656_213(BX842656|pid:none) Bdellovibrio bacteriovorus compl... 77 2e-12
AP009493_2722(AP009493|pid:none) Streptomyces griseus subsp. gri... 77 3e-12
AP008230_1925(AP008230|pid:none) Desulfitobacterium hafniense Y5... 77 3e-12
CP000143_2581(CP000143|pid:none) Rhodobacter sphaeroides 2.4.1 c... 77 3e-12
AE004437_1183(AE004437|pid:none) Halobacterium sp. NRC-1, comple... 77 3e-12
CP000561_1635(CP000561|pid:none) Pyrobaculum calidifontis JCM 11... 77 3e-12
CP000875_4545(CP000875|pid:none) Herpetosiphon aurantiacus ATCC ... 77 3e-12
AM910991_57(AM910991|pid:none) Plasmodium knowlesi strain H chro... 77 3e-12
EU016581_5(EU016581|pid:none) Uncultured marine microorganism HF... 77 4e-12
DQ231674_1(DQ231674|pid:none) Caenorhabditis elegans strain JU31... 77 4e-12
BT040648_1(BT040648|pid:none) Zea mays full-length cDNA clone ZM... 77 4e-12
AM502243_224(AM502243|pid:none) Leishmania infantum chromosome 25. 77 4e-12
CP000512_4600(CP000512|pid:none) Acidovorax citrulli AAC00-1, co... 77 4e-12
CP000686_3168(CP000686|pid:none) Roseiflexus sp. RS-1, complete ... 77 4e-12
CT005264_221(CT005264|pid:none) Leishmania major strain Friedlin... 76 5e-12
BA000023_1040(BA000023|pid:none) Sulfolobus tokodaii str. 7 DNA,... 76 5e-12
CP001339_796(CP001339|pid:none) Thioalkalivibrio sp. HL-EbGR7, c... 76 5e-12
CP000804_3640(CP000804|pid:none) Roseiflexus castenholzii DSM 13... 76 6e-12
BT078377_1(BT078377|pid:none) Lepeophtheirus salmonis Pacific fo... 76 6e-12
CR382125_137(CR382125|pid:none) Kluyveromyces lactis strain NRRL... 76 6e-12
AJ749949_503(AJ749949|pid:none) Francisella tularensis subsp. tu... 75 8e-12
AM233362_1553(AM233362|pid:none) Francisella tularensis subsp. h... 75 8e-12
(Q58DR8) RecName: Full=Succinyl-CoA ligase [GDP-forming] subunit... 75 8e-12
(O19069) RecName: Full=Succinyl-CoA ligase [GDP-forming] subunit... 75 8e-12
CP000513_1239(CP000513|pid:none) Dichelobacter nodosus VCS1703A,... 75 1e-11
CP000077_1180(CP000077|pid:none) Sulfolobus acidocaldarius DSM 6... 75 1e-11
AP006840_2532(AP006840|pid:none) Symbiobacterium thermophilum IA... 75 1e-11
CP000941_1923(CP000941|pid:none) Xylella fastidiosa M12, complet... 75 1e-11
AM999887_959(AM999887|pid:none) Wolbachia endosymbiont of Culex ... 75 1e-11
CP000583_582(CP000583|pid:none) Ostreococcus lucimarinus CCE9901... 75 1e-11
DQ231658_1(DQ231658|pid:none) Caenorhabditis elegans strain JU29... 75 1e-11
CP000527_1091(CP000527|pid:none) Desulfovibrio vulgaris subsp. v... 75 1e-11
FJ185156_1(FJ185156|pid:none) Histomonas meleagridis alpha-succi... 75 1e-11
CR954203_584(CR954203|pid:none) Ostreococcus tauri strain OTTH05... 75 1e-11
AE009442_1853(AE009442|pid:none) Xylella fastidiosa Temecula1, c... 75 1e-11
DQ231660_1(DQ231660|pid:none) Caenorhabditis elegans strain JU30... 75 1e-11
CP001322_3761(CP001322|pid:none) Desulfatibacillum alkenivorans ... 74 2e-11
(Q1RH56) RecName: Full=Succinyl-CoA ligase [ADP-forming] subunit... 74 2e-11
AE000657_1306(AE000657|pid:none) Aquifex aeolicus VF5, complete ... 74 2e-11
FJ607869_1(FJ607869|pid:none) Oncorhynchus mykiss succinate-CoA ... 74 2e-11
BT071979_1(BT071979|pid:none) Salmo salar clone ssal-rgf-506-036... 74 2e-11
AP009152_1816(AP009152|pid:none) Kocuria rhizophila DC2201 DNA, ... 74 2e-11
AE014186_82(AE014186|pid:none) Plasmodium falciparum 3D7 chromos... 74 2e-11
AF035393_1(AF035393|pid:none) Columba livia ATP-specific succiny... 74 2e-11
CP000473_3334(CP000473|pid:none) Solibacter usitatus Ellin6076, ... 74 2e-11
CU640366_483(CU640366|pid:none) Podospora anserina genomic DNA c... 74 2e-11
CP000362_1501(CP000362|pid:none) Roseobacter denitrificans OCh 1... 74 2e-11
DQ666366_1(DQ666366|pid:none) Penicillium marneffei ScsA (scsA) ... 74 2e-11
AB124579_2(AB124579|pid:none) Hydrogenobacter thermophilus genes... 74 2e-11
CP001230_1028(CP001230|pid:none) Persephonella marina EX-H1, com... 74 3e-11
AM039952_3348(AM039952|pid:none) Xanthomonas campestris pv. vesi... 74 3e-11
CU928158_3980(CU928158|pid:none) Escherichia fergusonii ATCC 354... 74 3e-11
CP000767_972(CP000767|pid:none) Campylobacter curvus 525.92, com... 74 3e-11
DQ231662_1(DQ231662|pid:none) Caenorhabditis elegans strain JU30... 74 3e-11
CP000830_2477(CP000830|pid:none) Dinoroseobacter shibae DFL 12, ... 74 3e-11
AM270389_20(AM270389|pid:none) Aspergillus niger contig An17c007... 73 4e-11
AE008922_3045(AE008922|pid:none) Xanthomonas campestris pv. camp... 73 4e-11
AE013598_1569(AE013598|pid:none) Xanthomonas oryzae pv. oryzae K... 73 4e-11
DQ231696_1(DQ231696|pid:none) Caenorhabditis elegans strain JU36... 73 4e-11
CP000813_1491(CP000813|pid:none) Bacillus pumilus SAFR-032, comp... 73 4e-11
CP001389_2578(CP001389|pid:none) Rhizobium sp. NGR234, complete ... 73 4e-11
BC081520_1(BC081520|pid:none) Danio rerio succinate-CoA ligase, ... 73 4e-11
CP000031_1537(CP000031|pid:none) Ruegeria pomeroyi DSS-3, comple... 73 4e-11
FN318645_1(FN318645|pid:none) Schistosoma japonicum isolate Anhu... 73 5e-11
CP001013_2689(CP001013|pid:none) Leptothrix cholodnii SP-6, comp... 73 5e-11
CU928171_92(CU928171|pid:none) Kluyveromyces thermotolerans stra... 73 5e-11
AE008923_3187(AE008923|pid:none) Xanthomonas axonopodis pv. citr... 73 5e-11
BT075294_1(BT075294|pid:none) Osmerus mordax clone omor-eva-506-... 73 5e-11
CR555306_680(CR555306|pid:none) Azoarcus sp. EbN1 complete genome. 73 5e-11
AY811391_1(AY811391|pid:none) Schistosoma japonicum SJCHGC04909 ... 73 5e-11
CR860980_1(CR860980|pid:none) Pongo abelii mRNA; cDNA DKFZp459A0... 72 7e-11
AE008692_567(AE008692|pid:none) Zymomonas mobilis subsp. mobilis... 72 7e-11
DQ231690_1(DQ231690|pid:none) Caenorhabditis elegans strain JU36... 72 7e-11
AK002754_1(AK002754|pid:none) Mus musculus adult male kidney cDN... 72 7e-11
DQ231714_1(DQ231714|pid:none) Caenorhabditis elegans strain JU44... 72 9e-11
(Q9P727) RecName: Full=Probable succinyl-CoA ligase [GDP-forming... 72 9e-11
AE009439_732(AE009439|pid:none) Methanopyrus kandleri AV19, comp... 72 9e-11
CP000031_336(CP000031|pid:none) Ruegeria pomeroyi DSS-3, complet... 72 1e-10
CP000148_2236(CP000148|pid:none) Geobacter metallireducens GS-15... 72 1e-10
CP000655_1821(CP000655|pid:none) Polynucleobacter necessarius su... 72 1e-10
CP000769_2165(CP000769|pid:none) Anaeromyxobacter sp. Fw109-5, c... 72 1e-10
CP000780_720(CP000780|pid:none) Candidatus Methanoregula boonei ... 72 1e-10
CP001089_2692(CP001089|pid:none) Geobacter lovleyi SZ, complete ... 72 1e-10
CP001071_1683(CP001071|pid:none) Akkermansia muciniphila ATCC BA... 72 1e-10
CP001050_888(CP001050|pid:none) Neisseria gonorrhoeae NCCP11945,... 72 1e-10
CP000381_857(CP000381|pid:none) Neisseria meningitidis 053442, c... 72 1e-10
AE004969_835(AE004969|pid:none) Neisseria gonorrhoeae FA 1090, c... 72 1e-10
AB170866_1(AB170866|pid:none) Macaca fascicularis brain cDNA clo... 72 1e-10
CP000264_827(CP000264|pid:none) Jannaschia sp. CCS1, complete ge... 72 1e-10
CP000771_1353(CP000771|pid:none) Fervidobacterium nodosum Rt17-B... 71 1e-10
AK005080_1(AK005080|pid:none) Mus musculus adult male cerebellum... 71 1e-10
DQ440261_1(DQ440261|pid:none) Aedes aegypti clone AET-319 succin... 71 1e-10
CP000698_154(CP000698|pid:none) Geobacter uraniireducens Rf4, co... 71 1e-10
CP000975_1041(CP000975|pid:none) Methylacidiphilum infernorum V4... 71 1e-10
AF144101_1(AF144101|pid:none) Mus musculus succinyl-CoA syntheta... 71 1e-10
CP000745_199(CP000745|pid:none) Methanococcus maripaludis C7, co... 71 1e-10
CP000158_307(CP000158|pid:none) Hyphomonas neptunium ATCC 15444,... 71 1e-10
(Q9WUM5) RecName: Full=Succinyl-CoA ligase [GDP-forming] subunit... 71 1e-10
AP006841_2254(AP006841|pid:none) Bacteroides fragilis YCH46 DNA,... 71 1e-10
CP001391_1003(CP001391|pid:none) Wolbachia sp. wRi, complete gen... 71 1e-10
AE017180_1051(AE017180|pid:none) Geobacter sulfurreducens PCA, c... 71 2e-10
BX950229_955(BX950229|pid:none) Methanococcus maripaludis strain... 71 2e-10
CP000742_153(CP000742|pid:none) Methanococcus vannielii SB, comp... 71 2e-10
BT076968_1(BT076968|pid:none) Caligus rogercresseyi clone crog-e... 71 2e-10
CP001503_2845(CP001503|pid:none) Burkholderia glumae BGR1 chromo... 71 2e-10
CP000716_1823(CP000716|pid:none) Thermosipho melanesiensis BI429... 71 2e-10
CT573213_1120(CT573213|pid:none) Frankia alni str. ACN14A chromo... 70 3e-10
CP001052_3229(CP001052|pid:none) Burkholderia phytofirmans PsJN ... 70 3e-10
CP000724_469(CP000724|pid:none) Alkaliphilus metalliredigens QYM... 70 3e-10
AE017196_1086(AE017196|pid:none) Wolbachia endosymbiont of Droso... 70 3e-10
CP000884_867(CP000884|pid:none) Delftia acidovorans SPH-1, compl... 70 3e-10
(Q94522) RecName: Full=Succinyl-CoA ligase [GDP-forming] subunit... 70 3e-10
AE002098_927(AE002098|pid:none) Neisseria meningitidis MC58, com... 70 3e-10
AK291082_1(AK291082|pid:none) Homo sapiens cDNA FLJ76284 complet... 70 3e-10
CP000489_553(CP000489|pid:none) Paracoccus denitrificans PD1222 ... 70 3e-10
AE017321_515(AE017321|pid:none) Wolbachia endosymbiont strain TR... 70 3e-10
AM295250_878(AM295250|pid:none) Staphylococcus carnosus subsp. c... 70 4e-10
CP000348_749(CP000348|pid:none) Leptospira borgpetersenii serova... 70 4e-10
DQ231673_1(DQ231673|pid:none) Caenorhabditis elegans strain JU31... 70 4e-10
BA000011_274(BA000011|pid:none) Thermoplasma volcanium GSS1 DNA,... 70 4e-10
CP000542_2678(CP000542|pid:none) Verminephrobacter eiseniae EF01... 70 4e-10
AX972599_1(AX972599|pid:none) Sequence 3402 from Patent EP1104808. 69 6e-10
AE017333_1734(AE017333|pid:none) Bacillus licheniformis DSM 13, ... 69 6e-10
CP000316_4597(CP000316|pid:none) Polaromonas sp. JS666, complete... 69 6e-10
CP000867_1686(CP000867|pid:none) Methanococcus maripaludis C6, c... 69 6e-10
CP001390_745(CP001390|pid:none) Geobacter sp. FRC-32, complete g... 69 6e-10
AP007150_540(AP007150|pid:none) Aspergillus oryzae RIB40 genomic... 69 6e-10
FJ426132_1(FJ426132|pid:none) Epinephelus coioides succinate-CoA... 69 6e-10
AL646052_555(AL646052|pid:none) Ralstonia solanacearum GMI1000 c... 69 6e-10
CU928176_484(CU928176|pid:none) Zygosaccharomyces rouxii strain ... 69 7e-10
CP001281_884(CP001281|pid:none) Thauera sp. MZ1T, complete genome. 69 7e-10
AM421808_887(AM421808|pid:none) Neisseria meningitidis serogroup... 69 7e-10
CU861906_562(CU861906|pid:none) Ralstonia solanacearum strain Mo... 69 7e-10
CP001087_3200(CP001087|pid:none) Desulfobacterium autotrophicum ... 69 7e-10
CP000820_5854(CP000820|pid:none) Frankia sp. EAN1pec, complete g... 69 7e-10
BX908798_1297(BX908798|pid:none) Parachlamydia-related symbiont ... 69 1e-09
AP009385_2551(AP009385|pid:none) Burkholderia multivorans ATCC 1... 69 1e-09
CP001390_242(CP001390|pid:none) Geobacter sp. FRC-32, complete g... 69 1e-09
CP000235_971(CP000235|pid:none) Anaplasma phagocytophilum HZ, co... 69 1e-09
X15790_2(X15790|pid:none) E.coli g30 gene and sucD gene (partial... 69 1e-09
CP001114_1280(CP001114|pid:none) Deinococcus deserti VCD115, com... 69 1e-09
BX571965_789(BX571965|pid:none) Burkholderia pseudomallei strain... 68 1e-09
CP000124_966(CP000124|pid:none) Burkholderia pseudomallei 1710b ... 68 1e-09
CP000010_241(CP000010|pid:none) Burkholderia mallei ATCC 23344 c... 68 1e-09
AM747720_959(AM747720|pid:none) Burkholderia cenocepacia J2315 c... 68 1e-09
AM167904_2300(AM167904|pid:none) Bordetella avium 197N complete ... 68 1e-09
AP009384_4014(AP009384|pid:none) Azorhizobium caulinodans ORS 57... 68 1e-09
(P53598) RecName: Full=Succinyl-CoA ligase [ADP-forming] subunit... 68 1e-09
CP000570_810(CP000570|pid:none) Burkholderia pseudomallei 668 ch... 68 1e-09
CP000148_722(CP000148|pid:none) Geobacter metallireducens GS-15,... 68 1e-09
CP000698_4273(CP000698|pid:none) Geobacter uraniireducens Rf4, c... 68 1e-09
CP000544_2208(CP000544|pid:none) Halorhodospira halophila SL1, c... 68 1e-09
AK342554_1(AK342554|pid:none) Acyrthosiphon pisum ACYPI009606 mR... 68 1e-09
CP000090_531(CP000090|pid:none) Ralstonia eutropha JMP134 chromo... 68 2e-09
AY596297_413(AY596297|pid:none) Haloarcula marismortui ATCC 4304... 68 2e-09
CP001124_1450(CP001124|pid:none) Geobacter bemidjiensis Bem, com... 67 2e-09
CU914168_599(CU914168|pid:none) Ralstonia solanacearum strain IP... 67 3e-09
CP000614_2722(CP000614|pid:none) Burkholderia vietnamiensis G4 c... 67 3e-09
CP001124_3188(CP001124|pid:none) Geobacter bemidjiensis Bem, com... 67 3e-09
CP000089_3333(CP000089|pid:none) Dechloromonas aromatica RCB, co... 67 3e-09
CP000560_1508(CP000560|pid:none) Bacillus amyloliquefaciens FZB4... 67 3e-09
CR522870_286(CR522870|pid:none) Desulfotalea psychrophila LSv54 ... 67 3e-09
CP000270_3721(CP000270|pid:none) Burkholderia xenovorans LB400 c... 67 3e-09
BA000028_1544(BA000028|pid:none) Oceanobacillus iheyensis HTE831... 67 3e-09
AP009256_809(AP009256|pid:none) Bifidobacterium adolescentis ATC... 67 4e-09
CP000115_420(CP000115|pid:none) Nitrobacter winogradskyi Nb-255,... 66 5e-09
CP001615_2882(CP001615|pid:none) Exiguobacterium sp. AT1b, compl... 66 5e-09
CU633749_498(CU633749|pid:none) Cupriavidus taiwanensis str. LMG... 66 5e-09
CP000030_151(CP000030|pid:none) Anaplasma marginale str. St. Mar... 66 5e-09
CP000301_188(CP000301|pid:none) Rhodopseudomonas palustris BisB1... 66 6e-09
CP001196_2525(CP001196|pid:none) Oligotropha carboxidovorans OM5... 66 6e-09
BA000021_416(BA000021|pid:none) Wigglesworthia glossinidia endos... 66 6e-09
AK088888_1(AK088888|pid:none) Mus musculus 2 days neonate thymus... 66 6e-09
AE014297_2763(AE014297|pid:none) Drosophila melanogaster chromos... 65 8e-09
AM260479_545(AM260479|pid:none) Ralstonia eutropha H16 chromosom... 65 8e-09
AM293908_1(AM293908|pid:none) Drosophila melanogaster CG6255 gen... 65 8e-09
CP001562_1720(CP001562|pid:none) Bartonella grahamii as4aup, com... 65 1e-08
CP000494_376(CP000494|pid:none) Bradyrhizobium sp. BTAi1, comple... 65 1e-08
AM902716_2071(AM902716|pid:none) Bordetella petrii strain DSM 12... 65 1e-08
CP000777_1957(CP000777|pid:none) Leptospira biflexa serovar Pato... 65 1e-08
BX897700_1293(BX897700|pid:none) Bartonella quintana str. Toulou... 65 1e-08
AM746676_9158(AM746676|pid:none) Sorangium cellulosum 'So ce 56'... 65 1e-08
BA000043_1209(BA000043|pid:none) Geobacillus kaustophilus HTA426... 64 2e-08
AE016819_367(AE016819|pid:none) Ashbya gossypii (= Eremothecium ... 64 2e-08
BT078314_1(BT078314|pid:none) Lepeophtheirus salmonis Pacific fo... 64 2e-08
CP000559_484(CP000559|pid:none) Methanocorpusculum labreanum Z, ... 64 2e-08
AE000666_949(AE000666|pid:none) Methanothermobacter thermautotro... 64 2e-08
(Q6GHI9) RecName: Full=Succinyl-CoA ligase [ADP-forming] subunit... 64 2e-08
AE000666_1687(AE000666|pid:none) Methanothermobacter thermautotr... 64 2e-08
CP000482_1686(CP000482|pid:none) Pelobacter propionicus DSM 2379... 64 2e-08
CP000922_1729(CP000922|pid:none) Anoxybacillus flavithermus WK1,... 64 3e-08
CP000678_446(CP000678|pid:none) Methanobrevibacter smithii ATCC ... 64 3e-08
AF008589_1(AF008589|pid:none) Sus scrofa succinyl-CoA synthetase... 63 4e-08
CP001001_904(CP001001|pid:none) Methylobacterium radiotolerans J... 63 4e-08
(Q5HPU4) RecName: Full=Succinyl-CoA ligase [ADP-forming] subunit... 63 5e-08
CP001638_1018(CP001638|pid:none) Geobacillus sp. WCH70, complete... 63 5e-08
(Q8CPH4) RecName: Full=Succinyl-CoA ligase [ADP-forming] subunit... 63 5e-08
CP000471_1727(CP000471|pid:none) Magnetococcus sp. MC-1, complet... 62 7e-08
AP009484_834(AP009484|pid:none) Macrococcus caseolyticus JCSC540... 62 1e-07
CP000628_3270(CP000628|pid:none) Agrobacterium radiobacter K84 c... 62 1e-07
BX640415_29(BX640415|pid:none) Bordetella pertussis strain Toham... 62 1e-07
BA000012_3311(BA000012|pid:none) Mesorhizobium loti MAFF303099 D... 62 1e-07
BX640445_200(BX640445|pid:none) Bordetella bronchiseptica strain... 61 2e-07
CP001298_1820(CP001298|pid:none) Methylobacterium chloromethanic... 61 2e-07
CP000943_2037(CP000943|pid:none) Methylobacterium sp. 4-46, comp... 61 2e-07
CP000557_1920(CP000557|pid:none) Geobacillus thermodenitrificans... 61 2e-07
AD2900(AD2900) succinyl-CoA synthetase alpha chain [imported] - ... 61 2e-07
CP000250_278(CP000250|pid:none) Rhodopseudomonas palustris HaA2,... 61 2e-07
>(Q54YA0) RecName: Full=Probable ATP-citrate synthase;
EC=2.3.3.8; AltName: Full=ATP-citrate (pro-S-)-lyase;
AltName: Full=Citrate cleavage enzyme;
Length = 622
Score = 1125 bits (2911), Expect = 0.0
Identities = 576/621 (92%), Positives = 577/621 (92%)
Frame = +2
Query: 245 LPARLFTKQSQALIYNYKEAAVQRMLNFDNVSQRDTPSVGGLIHPGSDGGMYKAFFGFKE 424
LPARLFTKQSQALIYNYKEAAVQRML+FDNVSQRDTPSVGGLIHPGSDGGMYKAFFGFKE
Sbjct: 15 LPARLFTKQSQALIYNYKEAAVQRMLDFDNVSQRDTPSVGGLIHPGSDGGMYKAFFGFKE 74
Query: 425 LVIPVYNSVSEACQQCPNADVFLNFASHRSAYQSSLLALREPSIQTVVIIAEGVPENEAR 604
LVIPVYNSVSEACQQCPNADVFLNFASHRSAYQSSLLALREPSIQTVVIIAEGVPENEAR
Sbjct: 75 LVIPVYNSVSEACQQCPNADVFLNFASHRSAYQSSLLALREPSIQTVVIIAEGVPENEAR 134
Query: 605 SLISIAKKLGKVIIGPATVGGIQAGCFKIGNTAGTIDNIMACKLYRXXXXXXXXXXXXXX 784
SLISIAKKLGKVIIGPATVGGIQAGCFKIGNTAGTI IMACKLYR
Sbjct: 135 SLISIAKKLGKVIIGPATVGGIQAGCFKIGNTAGTIVYIMACKLYRSGSVGFVSKSGGLS 194
Query: 785 NEMYNVLSRCTDGIYEGIAIGGDAFPGSTLTDHALRYEKLPEVQMIVILGELGGWDEYGI 964
NEMYNVLSRCTDGIYEGIAIGGDAFPGSTLTDHALRYEKLPEVQMIVILGELGGWDEYGI
Sbjct: 195 NEMYNVLSRCTDGIYEGIAIGGDAFPGSTLTDHALRYEKLPEVQMIVILGELGGWDEYGI 254
Query: 965 VEALKKGEITKPICAWVSGTVAKIFPTEVQFGHAGAKSGGETESADAKNKALREAGAVVP 1144
VEALKKGEITKPICAWVSGTVAKIFPTEVQFGHAGAKSGGETESADAKNKALREAGAVVP
Sbjct: 255 VEALKKGEITKPICAWVSGTVAKIFPTEVQFGHAGAKSGGETESADAKNKALREAGAVVP 314
Query: 1145 TSFEDFSNVIAATYAKLQSKGXXXXXXXXXXXXXXXDFKTAVKAGKVRKPTSIISTICDD 1324
TSFEDFSNVIAATYAKLQSKG DFKTAVKAGKVRKPTSIISTICDD
Sbjct: 315 TSFEDFSNVIAATYAKLQSKGLVKPVEEPTPPELPLDFKTAVKAGKVRKPTSIISTICDD 374
Query: 1325 RGDELSXXXXVMIVVMNFPYAGVPISEVCKEQYNMGDVIGLLWFKRKLPPYASKFFEMCL 1504
RGDELS YAGVPISEVCKEQYNMGDVIGLLWFKRKLPPYASKFFEMCL
Sbjct: 375 RGDELS-------------YAGVPISEVCKEQYNMGDVIGLLWFKRKLPPYASKFFEMCL 421
Query: 1505 KLVADHGPCVSGAHNTIVAARAGKDLVSSLVSGLLTIGPRFGGAIDDSARVFQDAVDNNL 1684
KLVADHGPCVSGAHNTIVAARAGKDLVSSLVSGLLTIGPRFGGAIDDSARVFQDAVDNNL
Sbjct: 422 KLVADHGPCVSGAHNTIVAARAGKDLVSSLVSGLLTIGPRFGGAIDDSARVFQDAVDNNL 481
Query: 1685 QPSQFVEGMKSKGKRIPGIGHLIKSADEIDKRVVLLKDYAFTHFSSTKYLEYALEVEKYT 1864
QPSQFVEGMKSKGKRIPGIGHLIKSADEIDKRVVLLKDYAFTHFSSTKYLEYALEVEKYT
Sbjct: 482 QPSQFVEGMKSKGKRIPGIGHLIKSADEIDKRVVLLKDYAFTHFSSTKYLEYALEVEKYT 541
Query: 1865 LQKANNLILNVDGCIGVLFLDLLHSSGLFTQHEIKEIIDVGYLNGFFIVGRSVGLIGHAL 2044
LQKANNLILNVDGCIGVLFLDLLHSSGLFTQHEIKEIIDVGYLNGFFIVGRSVGLIGHAL
Sbjct: 542 LQKANNLILNVDGCIGVLFLDLLHSSGLFTQHEIKEIIDVGYLNGFFIVGRSVGLIGHAL 601
Query: 2045 DQRRNKQGLYRHQADDVHYAL 2107
DQRRNKQGLYRHQADDVHYAL
Sbjct: 602 DQRRNKQGLYRHQADDVHYAL 622
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3236559
Number of Hits to DB: 3,335,446,078
Number of extensions: 67798103
Number of successful extensions: 187629
Number of sequences better than 10.0: 703
Number of HSP's gapped: 185501
Number of HSP's successfully gapped: 720
Length of query: 751
Length of database: 1,051,180,864
Length adjustment: 136
Effective length of query: 615
Effective length of database: 611,008,840
Effective search space: 375770436600
Effective search space used: 375770436600
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 32 (16.9 bits)
|
| PSORT |
|
| VS (DIR, S) |
5 |
| VH (FL, L) |
11 |
| VF (FL, S) |
2 |
| AH (FL, L) |
0 |
| AF (FL, S) |
1 |
| SL (DIR, L) |
0 |
| SS (DIR, S) |
0 |
| SH (FL, L) |
0 |
| SF (FL, S) |
0 |
| CH (FL, L) |
3 |
| CF (FL, S) |
0 |
| FCL (DIR, L) |
0 |
| FC (DIR, S) |
0 |
| FC-IC (SUB) |
0 |