| Homology vs DNA |
 Query= Contig-U11685-1 (Contig-U11685-1Q) /CSM_Contig/Contig-U11685-1Q.Seq.d
(1192 letters)
Database: ddbj_A
92,845,959 sequences; 95,242,211,685 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value N
(BJ401631) Dictyostelium discoideum cDNA clone:dds23l19, 3' ... 696 0.0 2
(AU061593) Dictyostelium discoideum slug cDNA, clone SLE760. 577 0.0 2
(BJ364088) Dictyostelium discoideum cDNA clone:ddc29l22, 5' ... 702 0.0 2
(BJ390838) Dictyostelium discoideum cDNA clone:dds23l19, 5' ... 652 0.0 2
(AU039564) Dictyostelium discoideum slug cDNA, clone SLE760. 379 e-177 2
(BJ376782) Dictyostelium discoideum cDNA clone:ddc29l22, 3' ... 458 e-135 2
(AC116986) Dictyostelium discoideum chromosome 2 map 2234041... 42 3e-05 11
(AL929351) Plasmodium falciparum strain 3D7, chromosome 5, s... 54 0.002 10
(DY885735) CeleSEQ1140 Cunninghamella elegans pBluescript (E... 38 0.003 2
(DY892835) CeleSEQ11852 Cunninghamella elegans pBluescript (... 38 0.003 2
(DY888035) CeleSEQ4974 Cunninghamella elegans pBluescript (E... 38 0.003 2
(AX344564) Sequence 15 from Patent WO0200932. 38 0.005 12
(CP000942) Ureaplasma parvum serovar 3 str. ATCC 27815, comp... 36 0.006 18
(CP000263) Buchnera aphidicola str. Cc (Cinara cedri), compl... 38 0.009 13
(AC156185) Bos taurus clone CH240-49L18, WORKING DRAFT SEQUE... 54 0.012 1
(CF619476) ERM37 G. intraradices extraradical mycelium Glomu... 54 0.012 1
(AL445563) Mycoplasma pulmonis (strain UAB CTIP) complete ge... 34 0.012 10
(AP009180) Candidatus Carsonella ruddii PV DNA, complete gen... 32 0.017 11
(AC005139) Plasmodium falciparum chromosome 12, *** SEQUENCI... 34 0.021 13
(DU867917) 89658 Tomato HindIII BAC Library Solanum lycopers... 38 0.031 3
(AM431467) Vitis vinifera contig VV78X068286.4, whole genome... 40 0.031 5
(BX248583) Blochmannia floridanus complete genome. 44 0.038 13
(FI008501) CHO_OF6902xl21r1.ab1 CHO_OF6 Nicotiana tabacum ge... 42 0.039 2
(BV327213) S241P6190FG4.T0 IndiaGrayWolf Canis lupus STS gen... 52 0.049 1
(BV262570) S235P6104FA6.T0 ItalianGreyhound Canis familiaris... 52 0.049 1
(EJ670438) 1092955055878 Global-Ocean-Sampling_GS-30-02-01-1... 52 0.049 1
(EJ653082) 1092954007622 Global-Ocean-Sampling_GS-30-02-01-1... 52 0.049 1
(CE337952) tigr-gss-dog-17000334057650 Dog Library Canis lup... 52 0.049 1
(AV383372) Halocynthia roretzi cDNA clone:005L04_5, 5' end, ... 52 0.049 1
(DB580407) Halocynthia roretzi cDNA clone:ma308d18, 5' end. 52 0.049 1
(CX576091) TTE00015809 Amplicon Express - Conjugative Form T... 42 0.050 2
(AC117072) Dictyostelium discoideum chromosome 2 map 3879572... 34 0.065 11
(AC116963) Dictyostelium discoideum chromosome 2 map 4657875... 34 0.068 11
(CT507240) A BAC library has been constructed from cultivar ... 40 0.13 2
(AC117176) Dictyostelium discoideum chromosome 2 map 5018074... 34 0.13 9
(AL034559) Plasmodium falciparum MAL3P7. 32 0.17 12
(CP000123) Mycoplasma capricolum subsp. capricolum ATCC 2734... 34 0.18 18
(DJ060316) Method and nucleic acids for the improved treatme... 38 0.19 4
(DD392058) Method and nucleic acids for the improved treatme... 38 0.19 4
(CS124663) Sequence 349 from Patent WO2005059172. 38 0.19 4
(CQ807314) Sequence 764 from Patent WO2004035803. 38 0.19 4
(AC187976) Canis lupus familiaris chromosome 30 clone XX-149... 50 0.19 1
(CE625018) tigr-gss-dog-17000328389161 Dog Library Canis lup... 50 0.19 1
(EE836455) 021030OOCX051036HT OOCX Ovis aries cDNA, mRNA seq... 50 0.19 1
(FG130106) a173 Periplaneta americana Whole Organism cDNA Li... 50 0.19 1
(EH218957) USDA-FP_181763 WHMH (pink hibiscus mealybug) Maco... 34 0.24 4
(ER372138) 1093025094081 Global-Ocean-Sampling_GS-34-01-01-1... 38 0.24 2
(EJ782726) 1093017288906 Global-Ocean-Sampling_GS-30-02-01-1... 38 0.27 2
(AX346900) Sequence 1971 from Patent WO0200928. 40 0.30 5
(AX344560) Sequence 11 from Patent WO0200932. 38 0.31 13
(EH213811) USDA-FP_176607 WHMH (pink hibiscus mealybug) Maco... 34 0.37 4
(CW947069) TcB30.2_A01_T7 Tribolium BAC library Tribolium ca... 42 0.54 3
(AC157957) Pan troglodytes BAC clone CH251-43B16 from chromo... 42 0.57 6
(M77697) Caenorhabditis elegans cosmid B0303, complete seque... 38 0.59 4
(CR382401) Plasmodium falciparum chromosome 6, complete sequ... 42 0.60 9
(AL049183) Plasmodium falciparum DNA *** SEQUENCING IN PROGR... 34 0.65 12
(CR925754) Zebrafish DNA sequence from clone CH211-148J16 in... 42 0.69 7
(AX344555) Sequence 6 from Patent WO0200932. 38 0.75 9
(BA000026) Mycoplasma penetrans HF-2 DNA, complete genome. 34 0.76 18
(AP008210) Oryza sativa (japonica cultivar-group) genomic DN... 48 0.77 1
(AL606588) Oryza sativa genomic DNA, chromosome 4, BAC clone... 48 0.77 1
(EA682994) Sequence 61873 from patent US 7365185. 48 0.77 1
(EA645456) Sequence 24335 from patent US 7365185. 48 0.77 1
(AC120069) Rattus norvegicus clone CH230-487B13, WORKING DRA... 48 0.77 1
(CR855200) Oryza sativa genomic DNA, chromosome 4, BAC clone... 48 0.77 1
(CR855195) Oryza sativa genomic DNA, chromosome 4, BAC clone... 48 0.77 1
(AC023833) Mus musculus chromosome 16 clone RP23-321G6, WORK... 48 0.77 1
(ER468137) 1092963934736 Global-Ocean-Sampling_GS-35-01-01-1... 48 0.77 1
(EK059598) 1092960064493 Global-Ocean-Sampling_GS-31-01-01-1... 48 0.77 1
(EK042659) 1092959531015 Global-Ocean-Sampling_GS-31-01-01-1... 48 0.77 1
(AQ158072) nbxb0010J15r CUGI Rice BAC Library Oryza sativa J... 48 0.77 1
(EJ658599) 1092955015149 Global-Ocean-Sampling_GS-30-02-01-1... 48 0.77 1
(CL800371) OR_CBa0011P01.r OR_CBa Oryza rufipogon genomic cl... 48 0.77 1
(CP000552) Prochlorococcus marinus str. MIT 9515, complete g... 48 0.77 1
(ER430515) 1092963775487 Global-Ocean-Sampling_GS-35-01-01-1... 42 0.82 2
(AC152132) Dasypus novemcinctus clone VMRC5-198J6, WORKING D... 36 0.83 7
(EJ020185) 1095448001456 Global-Ocean-Sampling_GS-26-01-01-1... 38 0.88 2
(AL409120) T3 end of clone AV0AA012G12 of library AV0AA from... 42 0.91 2
(AJ496545) Kluyveromyces lactis ndi1 gene for putative mitoc... 46 0.94 2
(AM452956) Vitis vinifera contig VV78X092722.13, whole genom... 42 0.99 2
(DN564410) 92173433 Sea Urchin primary mesenchyme cell cDNA ... 46 1.0 2
(CZ419377) 1015080 RP42 Bos taurus genomic clone RP42-44I23,... 34 1.0 3
(CP000721) Clostridium beijerinckii NCIMB 8052, complete gen... 46 1.0 19
(AL844509) Plasmodium falciparum chromosome 13. 38 1.1 17
(BM163989) EST566512 PyBS Plasmodium yoelii yoelii cDNA clon... 38 1.3 2
(AC116305) Dictyostelium discoideum chromosome 2 map 1005175... 32 1.3 14
(AC161012) Pan troglodytes BAC clone CH251-499A2 from chromo... 42 1.3 6
(DQ927305) Tetrahymena pigmentosa strain UM1060 mitochondrio... 32 1.3 8
(EK253368) 1095460290372 Global-Ocean-Sampling_GS-31-01-01-1... 36 1.4 3
(AX458561) Sequence 107 from Patent WO0246454. 38 1.4 6
(AL049181) Plasmodium falciparum DNA *** SEQUENCING IN PROGR... 34 1.4 12
(AJ294725) Astasia longa complete chloroplast genome. 32 1.6 8
(AM633372) Entamoeba dispar GSS, clone dispar101a07.q1k. 38 1.6 3
(AB073725) Ixodes persulcatus mitochondrial DNA, complete se... 38 1.6 4
(AC116979) Dictyostelium discoideum chromosome 2 map 6445720... 32 1.8 16
(AC125108) Mus musculus BAC clone RP24-226A8 from chromosome... 36 1.9 7
(AX344565) Sequence 16 from Patent WO0200932. 36 2.0 12
(DU071912) 63732 Tomato HindIII BAC Library Solanum lycopers... 34 2.0 2
(EK407514) 1095505087023 Global-Ocean-Sampling_GS-31-01-01-1... 32 2.1 2
(AP009247) Candidatus Vesicomyosocius okutanii HA DNA, compl... 36 2.2 13
>(BJ401631) Dictyostelium discoideum cDNA clone:dds23l19, 3' end,
single read.
Length = 580
Score = 696 bits (351), Expect(2) = 0.0
Identities = 353/354 (99%)
Strand = Plus / Minus
Query: 560 aaggaggtattgaaagattatgttattttggataatggtgatagaattccatatggttta 619
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 580 aaggaggtattgaaagattatgttattttggataatggtgatagaattccatatggttta 521
Query: 620 ttagtttggtcaactggtataggtcaacatccacttgttaaaaactcatcatttgaaaag 679
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 520 ttagtttggtcaactggtataggtcaacatccacttgttaaaaactcatcatttgaaaag 461
Query: 680 gatagccatgatagaatcattgttgatgatcatttacgtgttaaaaactattcaaatgta 739
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 460 gatagccatgatagaatcattgttgatgatcatttacgtgttaaaaactattcaaatgta 401
Query: 740 tttagttttggtgattgtgcaaatgttgaaaataaaaattatccaccaactgctcaagta 799
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 400 tttagttttggtgattgtgcaaatgttgaaaataaaaattatccaccaactgctcaagta 341
Query: 800 gcttcacaatctgctgtttatttagcaaaagaatttaataatcttgaaaagttaaatcca 859
|||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 340 gcttcacaatntgctgtttatttagcaaaagaatttaataatcttgaaaagttaaatcca 281
Query: 860 aatccaccaaaaccatttgcttttaaatttttaggtttattagcttatactggt 913
||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 280 aatccaccaaaaccatttgcttttaaatttttaggtttattagcttatactggt 227
Score = 361 bits (182), Expect(2) = 0.0
Identities = 184/185 (99%)
Strand = Plus / Minus
Query: 921 gtggtattttacaaactgatttcttcgatttaagtggttttattggttttattacttgga 980
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 219 gtggtattttacaaactgatttcttcgatttaagtggttttattggttttattacttgga 160
Query: 981 ggagtgcatatttaactagattaggttctttacgttcaaaaatacaagtaccttttgact 1040
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 159 ggagtgcatatttaactagattaggttctttacgttcaaaaatacaagtaccttttgact 100
Query: 1041 ggatgcgtactttaatatttggaagagatattagtagtttttaaaattttcattgggact 1100
|||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||
Sbjct: 99 ggatgcgtactttaatatttggaanagatattagtagtttttaaaattttcattgggact 40
Query: 1101 aaaac 1105
|||||
Sbjct: 39 aaaac 35
Lambda K H
1.37 0.711 1.31
Matrix: blastn matrix:1 -3
Number of Sequences: 92845959
Number of Hits to DB: 1,402,095,852
Number of extensions: 97101041
Number of successful extensions: 8767147
Number of sequences better than 10.0: 264
Length of query: 1192
Length of database: 95,242,211,685
Length adjustment: 24
Effective length of query: 1168
Effective length of database: 97,308,875,965
Effective search space: 113656767127120
Effective search space used: 113656767127120
X1: 11 (21.8 bits)
S2: 22 (44.1 bits)
|
| Homology vs Protein |
Query= Contig-U11685-1 (Contig-U11685-1Q) /CSM_Contig/Contig-U11685-1Q.Seq.d
(1192 letters)
Database: nrp_B
3,236,559 sequences; 1,051,180,864 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
(Q55CD9) RecName: Full=Probable NADH dehydrogenase; EC=... 330 6e-89
(P40215) RecName: Full=External NADH-ubiquinone oxidoreductase 1... 133 1e-29
AE016817_662(AE016817|pid:none) Ashbya gossypii (= Eremothecium ... 124 5e-27
AJ496546_1(AJ496546|pid:none) Kluyveromyces lactis nde1 gene for... 122 2e-26
(Q07500) RecName: Full=External NADH-ubiquinone oxidoreductase 2... 122 2e-26
AJ496545_1(AJ496545|pid:none) Kluyveromyces lactis ndi1 gene for... 120 7e-26
AY039856_1(AY039856|pid:none) Arabidopsis thaliana AT4g05020/T32... 120 9e-26
AF162444_7(AF162444|pid:none) Arabidopsis thaliana BAC T32N4. &... 119 3e-25
(P32340) RecName: Full=Rotenone-insensitive NADH-ubiquinone oxid... 119 3e-25
FM992690_322(FM992690|pid:none) Candida dubliniensis CD36 chromo... 119 3e-25
AC006234_30(AC006234|pid:none) Arabidopsis thaliana chromosome 2... 118 4e-25
AC116982_30(AC116982|pid:none) Dictyostelium discoideum chromoso... 118 4e-25
AJ006852_1(AJ006852|pid:none) Yarrowia lipolytica NDH2 gene, com... 118 4e-25
AJ390487_1(AJ390487|pid:none) Candida albicans mitochondrial mRN... 117 1e-24
AL022603_11(AL022603|pid:none) Arabidopsis thaliana DNA chromoso... 115 3e-24
CU928175_620(CU928175|pid:none) Zygosaccharomyces rouxii strain ... 114 5e-24
AP007154_319(AP007154|pid:none) Aspergillus oryzae RIB40 genomic... 114 7e-24
CU633900_397(CU633900|pid:none) Podospora anserina genomic DNA c... 114 9e-24
X61590_1(X61590|pid:none) S.cerevisiae NDI1 gene for internal NA... 113 1e-23
CR380948_99(CR380948|pid:none) Candida glabrata strain CBS138 ch... 113 2e-23
AM048815_1(AM048815|pid:none) Botryotinia fuckeliana nde-1 gene ... 112 3e-23
EU956711_1(EU956711|pid:none) Zea mays clone 1571336 hypothetica... 111 4e-23
AM494972_565(AM494972|pid:none) Leishmania braziliensis chromoso... 111 4e-23
AC149577_26(AC149577|pid:none) Medicago truncatula chromosome 2 ... 110 8e-23
CP000582_118(CP000582|pid:none) Ostreococcus lucimarinus CCE9901... 110 1e-22
AK072710_1(AK072710|pid:none) Oryza sativa Japonica Group cDNA c... 110 1e-22
FM992693_276(FM992693|pid:none) Candida dubliniensis CD36 chromo... 108 3e-22
AM270167_7(AM270167|pid:none) Aspergillus niger contig An08c0120... 108 4e-22
AM473606_1(AM473606|pid:none) Vitis vinifera contig VV78X187592.... 108 4e-22
AC004680_11(AC004680|pid:none) Arabidopsis thaliana chromosome 2... 108 4e-22
CR954202_482(CR954202|pid:none) Ostreococcus tauri strain OTTH05... 107 6e-22
AK121213_1(AK121213|pid:none) Oryza sativa Japonica Group cDNA c... 107 6e-22
AM473606_2(AM473606|pid:none) Vitis vinifera contig VV78X187592.... 107 8e-22
AY084663_1(AY084663|pid:none) Arabidopsis thaliana clone 114420 ... 107 8e-22
CR940352_517(CR940352|pid:none) Theileria annulata strain Ankara... 106 1e-21
AM910989_123(AM910989|pid:none) Plasmodium knowlesi strain H chr... 105 3e-21
AK118982_1(AK118982|pid:none) Arabidopsis thaliana At1g07180 mRN... 105 3e-21
AJ245861_1(AJ245861|pid:none) Solanum tuberosum mRNA for putativ... 105 3e-21
DQ228957_1(DQ228957|pid:none) Toxoplasma gondii mitochondrial al... 105 4e-21
BX649605_71(BX649605|pid:none) Aspergillus fumigatus BAC pilot p... 104 5e-21
CU928180_539(CU928180|pid:none) Kluyveromyces thermotolerans str... 104 5e-21
AP007154_588(AP007154|pid:none) Aspergillus oryzae RIB40 genomic... 103 9e-21
CP001327_53(CP001327|pid:none) Micromonas sp. RCC299 chromosome ... 102 2e-20
CU928179_29(CU928179|pid:none) Zygosaccharomyces rouxii strain C... 102 2e-20
CR382121_349(CR382121|pid:none) Kluyveromyces lactis strain NRRL... 102 3e-20
(O43090) RecName: Full=Probable NADH-ubiquinone oxidoreductase C... 100 8e-20
EF147885_1(EF147885|pid:none) Populus trichocarpa clone WS0125_L... 100 8e-20
CP001326_145(CP001326|pid:none) Micromonas sp. RCC299 chromosome... 100 8e-20
AP003766_12(AP003766|pid:none) Oryza sativa Japonica Group genom... 100 1e-19
CS287406_1(CS287406|pid:none) Sequence 3 from Patent WO2006040471. 100 1e-19
BT055028_1(BT055028|pid:none) Zea mays full-length cDNA clone ZM... 100 1e-19
BT064381_1(BT064381|pid:none) Zea mays full-length cDNA clone ZM... 100 1e-19
AP007171_308(AP007171|pid:none) Aspergillus oryzae RIB40 genomic... 99 3e-19
AM269984_12(AM269984|pid:none) Aspergillus niger contig An01c037... 96 3e-18
AY125472_1(AY125472|pid:none) Trypanosoma brucei putative NADH d... 95 6e-18
(O14121) RecName: Full=Probable NADH-ubiquinone oxidoreductase C... 94 7e-18
AY166629_1(AY166629|pid:none) Pisum sativum putative NADH-dehydr... 91 8e-17
DQ211932_1(DQ211932|pid:none) Toxoplasma gondii mitochondrial al... 89 3e-16
AE017347_77(AE017347|pid:none) Cryptococcus neoformans var. neof... 87 9e-16
CP000866_8(CP000866|pid:none) Nitrosopumilus maritimus SCM1, com... 79 4e-13
BT087962_1(BT087962|pid:none) Zea mays full-length cDNA clone ZM... 77 9e-13
CU633897_307(CU633897|pid:none) Podospora anserina genomic DNA c... 76 2e-12
FJ899542_1(FJ899542|pid:none) Actinidia deliciosa putative mitoc... 76 2e-12
AM420293_838(AM420293|pid:none) Saccharopolyspora erythraea NRRL... 73 2e-11
CP000764_3366(CP000764|pid:none) Bacillus cereus subsp. cytotoxi... 72 4e-11
BA000004_3407(BA000004|pid:none) Bacillus halodurans C-125 DNA, ... 70 1e-10
CP000386_1084(CP000386|pid:none) Rubrobacter xylanophilus DSM 99... 70 2e-10
CP000903_4628(CP000903|pid:none) Bacillus weihenstephanensis KBA... 69 3e-10
CR628336_727(CR628336|pid:none) Legionella pneumophila str. Pari... 69 3e-10
AM398681_1878(AM398681|pid:none) Flavobacterium psychrophilum JI... 69 3e-10
CR628337_711(CR628337|pid:none) Legionella pneumophila str. Lens... 69 3e-10
CP001275_1853(CP001275|pid:none) Thermomicrobium roseum DSM 5159... 69 4e-10
CP000117_4965(CP000117|pid:none) Anabaena variabilis ATCC 29413,... 67 1e-09
AP009178_971(AP009178|pid:none) Nitratiruptor sp. SB155-2 genomi... 66 2e-09
AE017180_491(AE017180|pid:none) Geobacter sulfurreducens PCA, co... 66 3e-09
CP000759_724(CP000759|pid:none) Ochrobactrum anthropi ATCC 49188... 66 3e-09
CP001638_2622(CP001638|pid:none) Geobacillus sp. WCH70, complete... 65 4e-09
AP008955_4756(AP008955|pid:none) Brevibacillus brevis NBRC 10059... 65 5e-09
CP001186_4935(CP001186|pid:none) Bacillus cereus G9842, complete... 65 6e-09
BA000040_1051(BA000040|pid:none) Bradyrhizobium japonicum USDA 1... 65 6e-09
AE016879_4773(AE016879|pid:none) Bacillus anthracis str. Ames, c... 65 6e-09
CP001037_1940(CP001037|pid:none) Nostoc punctiforme PCC 73102, c... 65 6e-09
AE014292_460(AE014292|pid:none) Brucella suis 1330 chromosome II... 64 1e-08
AE008918_787(AE008918|pid:none) Brucella melitensis 16M chromoso... 64 1e-08
CP001489_409(CP001489|pid:none) Brucella melitensis ATCC 23457 c... 64 1e-08
CP000485_4239(CP000485|pid:none) Bacillus thuringiensis str. Al ... 64 1e-08
CP000227_4619(CP000227|pid:none) Bacillus cereus Q1, complete ge... 64 1e-08
AP006627_2915(AP006627|pid:none) Bacillus clausii KSM-K16 DNA, c... 64 1e-08
CP000555_160(CP000555|pid:none) Methylibium petroleiphilum PM1, ... 64 1e-08
EU030627_1(EU030627|pid:none) Bacillus pseudofirmus OF4 Ndh2-1 g... 63 2e-08
AE017283_145(AE017283|pid:none) Propionibacterium acnes KPA17120... 63 2e-08
CP000473_7468(CP000473|pid:none) Solibacter usitatus Ellin6076, ... 63 2e-08
CP001022_2275(CP001022|pid:none) Exiguobacterium sibiricum 255-1... 63 2e-08
CP000001_4611(CP000001|pid:none) Bacillus cereus E33L, complete ... 62 3e-08
CP001037_1504(CP001037|pid:none) Nostoc punctiforme PCC 73102, c... 62 3e-08
CP000662_202(CP000662|pid:none) Rhodobacter sphaeroides ATCC 170... 62 3e-08
CP001287_3343(CP001287|pid:none) Cyanothece sp. PCC 8801, comple... 62 5e-08
CP000117_4661(CP000117|pid:none) Anabaena variabilis ATCC 29413,... 62 5e-08
CP000140_54(CP000140|pid:none) Parabacteroides distasonis ATCC 8... 61 7e-08
AE017125_1243(AE017125|pid:none) Helicobacter hepaticus ATCC 514... 61 9e-08
Y09899_3(Y09899|pid:none) C.viguieri phS gene, gene encoding put... 61 9e-08
CP000778_21(CP000778|pid:none) Leptospira biflexa serovar Patoc ... 61 9e-08
EU953750_1(EU953750|pid:none) Zea mays clone 1445275 unknown mRNA. 60 1e-07
CP000103_1987(CP000103|pid:none) Nitrosospira multiformis ATCC 2... 60 1e-07
CP000922_2375(CP000922|pid:none) Anoxybacillus flavithermus WK1,... 60 1e-07
AP009044_1557(AP009044|pid:none) Corynebacterium glutamicum R DN... 60 2e-07
CP000930_939(CP000930|pid:none) Heliobacterium modesticaldum Ice... 60 2e-07
AX065591_1(AX065591|pid:none) Sequence 717 from Patent WO0100844... 60 2e-07
AF381044_1(AF381044|pid:none) Synechococcus sp. PCC 7002 type II... 60 2e-07
AM260479_1767(AM260479|pid:none) Ralstonia eutropha H16 chromoso... 60 2e-07
CP000114_1624(CP000114|pid:none) Streptococcus agalactiae A909, ... 60 2e-07
AC1743(AC1743) NADH dehydrogenase homolog lin2488 [imported] - L... 60 2e-07
CP000578_442(CP000578|pid:none) Rhodobacter sphaeroides ATCC 170... 60 2e-07
CP000144_727(CP000144|pid:none) Rhodobacter sphaeroides 2.4.1 ch... 60 2e-07
BX248357_157(BX248357|pid:none) Corynebacterium diphtheriae grav... 59 3e-07
CP000560_2798(CP000560|pid:none) Bacillus amyloliquefaciens FZB4... 59 3e-07
CP000117_808(CP000117|pid:none) Anabaena variabilis ATCC 29413, ... 59 3e-07
BX908798_1809(BX908798|pid:none) Parachlamydia-related symbiont ... 59 3e-07
AP011115_7043(AP011115|pid:none) Rhodococcus opacus B4 DNA, comp... 59 3e-07
CP001472_2353(CP001472|pid:none) Acidobacterium capsulatum ATCC ... 59 3e-07
AL766853_49(AL766853|pid:none) Streptococcus agalactiae NEM316 c... 59 3e-07
CP000776_1525(CP000776|pid:none) Campylobacter hominis ATCC BAA-... 59 3e-07
CP001151_841(CP001151|pid:none) Rhodobacter sphaeroides KD131 ch... 59 3e-07
AM263198_2337(AM263198|pid:none) Listeria welshimeri serovar 6b ... 58 6e-07
CP000393_1773(CP000393|pid:none) Trichodesmium erythraeum IMS101... 58 6e-07
CP000750_994(CP000750|pid:none) Kineococcus radiotolerans SRS302... 58 8e-07
CP001291_5006(CP001291|pid:none) Cyanothece sp. PCC 7424, comple... 58 8e-07
CU458896_2407(CU458896|pid:none) Mycobacterium abscessus chromos... 58 8e-07
CP001230_1714(CP001230|pid:none) Persephonella marina EX-H1, com... 58 8e-07
CP000431_7184(CP000431|pid:none) Rhodococcus jostii RHA1, comple... 57 1e-06
CP000828_1155(CP000828|pid:none) Acaryochloris marina MBIC11017,... 57 1e-06
BA000035_1591(BA000035|pid:none) Corynebacterium efficiens YS-31... 57 1e-06
CP001089_207(CP001089|pid:none) Geobacter lovleyi SZ, complete g... 57 1e-06
AF381043_1(AF381043|pid:none) Synechococcus sp. PCC 7002 type II... 57 1e-06
CP000117_940(CP000117|pid:none) Anabaena variabilis ATCC 29413, ... 57 1e-06
CP000494_686(CP000494|pid:none) Bradyrhizobium sp. BTAi1, comple... 57 1e-06
A70015(A70015) probable NADH2 dehydrogenase (EC 1.6.99.3) yumB -... 57 1e-06
AE016824_25(AE016824|pid:none) Leptospira interrogans serovar Co... 57 2e-06
AE010301_36(AE010301|pid:none) Leptospira interrogans serovar La... 57 2e-06
CP000569_1249(CP000569|pid:none) Actinobacillus pleuropneumoniae... 57 2e-06
AP006618_2436(AP006618|pid:none) Nocardia farcinica IFM 10152 DN... 57 2e-06
CP000474_910(CP000474|pid:none) Arthrobacter aurescens TC1, comp... 57 2e-06
CP000850_830(CP000850|pid:none) Salinispora arenicola CNS-205, c... 57 2e-06
CP000159_2158(CP000159|pid:none) Salinibacter ruber DSM 13855, c... 56 2e-06
BA000022_1209(BA000022|pid:none) Synechocystis sp. PCC 6803 DNA,... 56 2e-06
CP000926_2892(CP000926|pid:none) Pseudomonas putida GB-1, comple... 56 2e-06
CP000088_948(CP000088|pid:none) Thermobifida fusca YX, complete ... 56 3e-06
CP000113_1413(CP000113|pid:none) Myxococcus xanthus DK 1622, com... 56 3e-06
AE017143_736(AE017143|pid:none) Haemophilus ducreyi strain 35000... 56 3e-06
CP001291_4760(CP001291|pid:none) Cyanothece sp. PCC 7424, comple... 56 3e-06
CU234118_6435(CU234118|pid:none) Bradyrhizobium sp. ORS278,compl... 55 4e-06
CP001032_2571(CP001032|pid:none) Opitutus terrae PB90-1, complet... 55 4e-06
CP001635_3615(CP001635|pid:none) Variovorax paradoxus S110 chrom... 55 4e-06
AC2457(AC2457) hypothetical protein alr5211 [imported] - Nostoc ... 55 4e-06
CP000492_1037(CP000492|pid:none) Chlorobium phaeobacteroides DSM... 55 4e-06
CP001091_1321(CP001091|pid:none) Actinobacillus pleuropneumoniae... 55 5e-06
CP000806_4099(CP000806|pid:none) Cyanothece sp. ATCC 51142 circu... 55 5e-06
AM746676_3027(AM746676|pid:none) Sorangium cellulosum 'So ce 56'... 55 5e-06
CP000088_430(CP000088|pid:none) Thermobifida fusca YX, complete ... 55 5e-06
CP001280_2553(CP001280|pid:none) Methylocella silvestris BL2, co... 55 6e-06
CP000875_2433(CP000875|pid:none) Herpetosiphon aurantiacus ATCC ... 55 6e-06
CP000325_2497(CP000325|pid:none) Mycobacterium ulcerans Agy99, c... 55 6e-06
CP000806_623(CP000806|pid:none) Cyanothece sp. ATCC 51142 circul... 55 6e-06
CP000117_2757(CP000117|pid:none) Anabaena variabilis ATCC 29413,... 55 6e-06
AL939118_277(AL939118|pid:none) Streptomyces coelicolor A3(2) co... 55 6e-06
CP001132_99(CP001132|pid:none) Acidithiobacillus ferrooxidans AT... 55 6e-06
CP000349_30(CP000349|pid:none) Leptospira borgpetersenii serovar... 54 8e-06
AE015928_1537(AE015928|pid:none) Bacteroides thetaiotaomicron VP... 54 8e-06
CP000580_2795(CP000580|pid:none) Mycobacterium sp. JLS, complete... 54 8e-06
CP000100_101(CP000100|pid:none) Synechococcus elongatus PCC 7942... 54 8e-06
CP000628_2157(CP000628|pid:none) Agrobacterium radiobacter K84 c... 54 8e-06
AP009552_2186(AP009552|pid:none) Microcystis aeruginosa NIES-843... 54 8e-06
CU459141_930(CU459141|pid:none) Acinetobacter baumannii str. AYE... 54 8e-06
CP000909_137(CP000909|pid:none) Chloroflexus aurantiacus J-10-fl... 54 8e-06
AL939128_17(AL939128|pid:none) Streptomyces coelicolor A3(2) com... 54 1e-05
AE014184_780(AE014184|pid:none) Tropheryma whipplei str. Twist, ... 54 1e-05
CP001620_834(CP001620|pid:none) Corynebacterium kroppenstedtii D... 54 1e-05
CP000269_2605(CP000269|pid:none) Janthinobacterium sp. Marseille... 54 1e-05
CP000817_550(CP000817|pid:none) Lysinibacillus sphaericus C3-41,... 54 1e-05
CR626927_1532(CR626927|pid:none) Bacteroides fragilis NCTC 9343,... 54 1e-05
(Q2YWP9) RecName: Full=NADH dehydrogenase-like protein SAB0807; ... 54 1e-05
AP006841_1599(AP006841|pid:none) Bacteroides fragilis YCH46 DNA,... 54 1e-05
AM408590_1893(AM408590|pid:none) Mycobacterium bovis BCG Pasteur... 54 1e-05
CP000764_3467(CP000764|pid:none) Bacillus cereus subsp. cytotoxi... 54 1e-05
CP001252_3163(CP001252|pid:none) Shewanella baltica OS223, compl... 54 1e-05
AP009152_1776(AP009152|pid:none) Kocuria rhizophila DC2201 DNA, ... 53 2e-05
CP001130_125(CP001130|pid:none) Hydrogenobaculum sp. Y04AAS1, co... 53 2e-05
CP000828_6054(CP000828|pid:none) Acaryochloris marina MBIC11017,... 53 2e-05
CP001114_739(CP001114|pid:none) Deinococcus deserti VCD115, comp... 53 2e-05
CP000444_3004(CP000444|pid:none) Shewanella sp. MR-7, complete g... 53 2e-05
CP001032_2862(CP001032|pid:none) Opitutus terrae PB90-1, complet... 53 2e-05
CP000431_1346(CP000431|pid:none) Rhodococcus jostii RHA1, comple... 53 2e-05
CT971583_2175(CT971583|pid:none) Synechococcus WH7803 complete g... 53 2e-05
CP001341_831(CP001341|pid:none) Arthrobacter chlorophenolicus A6... 53 2e-05
CP000435_2466(CP000435|pid:none) Synechococcus sp. CC9311, compl... 52 3e-05
AP011115_1074(AP011115|pid:none) Rhodococcus opacus B4 DNA, comp... 52 3e-05
CR378679_312(CR378679|pid:none) Photobacterium profundum SS9 chr... 52 3e-05
AM181176_764(AM181176|pid:none) Pseudomonas fluorescens SBW25 co... 52 3e-05
CP000975_1602(CP000975|pid:none) Methylacidiphilum infernorum V4... 52 3e-05
CP000608_764(CP000608|pid:none) Francisella tularensis subsp. tu... 52 3e-05
CP000439_889(CP000439|pid:none) Francisella tularensis subsp. no... 52 3e-05
AM233362_1050(AM233362|pid:none) Francisella tularensis subsp. h... 52 3e-05
AE016958_1561(AE016958|pid:none) Mycobacterium avium subsp. para... 52 4e-05
CP001101_609(CP001101|pid:none) Chlorobium phaeobacteroides BS1,... 52 4e-05
CP001291_2210(CP001291|pid:none) Cyanothece sp. PCC 7424, comple... 52 4e-05
CP001337_486(CP001337|pid:none) Chloroflexus aggregans DSM 9485,... 52 4e-05
AE015451_2841(AE015451|pid:none) Pseudomonas putida KT2440 compl... 52 4e-05
CP000510_1882(CP000510|pid:none) Psychromonas ingrahamii 37, com... 52 5e-05
CP000554_2369(CP000554|pid:none) Prochlorococcus marinus str. MI... 52 5e-05
CP000656_3328(CP000656|pid:none) Mycobacterium gilvum PYR-GCK, c... 52 5e-05
AP009386_77(AP009386|pid:none) Burkholderia multivorans ATCC 176... 52 5e-05
CP001638_2629(CP001638|pid:none) Geobacillus sp. WCH70, complete... 52 5e-05
AK221879_1(AK221879|pid:none) Arabidopsis thaliana mRNA for puta... 52 5e-05
CP000240_1703(CP000240|pid:none) Synechococcus sp. JA-2-3B'a(2-1... 52 5e-05
CP000264_866(CP000264|pid:none) Jannaschia sp. CCS1, complete ge... 52 5e-05
AP007281_495(AP007281|pid:none) Lactobacillus reuteri JCM 1112 D... 52 5e-05
CP000269_1033(CP000269|pid:none) Janthinobacterium sp. Marseille... 52 5e-05
AP009552_4291(AP009552|pid:none) Microcystis aeruginosa NIES-843... 52 5e-05
CP000746_1945(CP000746|pid:none) Actinobacillus succinogenes 130... 51 7e-05
(Q49W80) RecName: Full=NADH dehydrogenase-like protein SSP1834; ... 51 7e-05
CR555306_3962(CR555306|pid:none) Azoarcus sp. EbN1 complete geno... 51 7e-05
CP000813_2836(CP000813|pid:none) Bacillus pumilus SAFR-032, comp... 51 7e-05
CP000091_1365(CP000091|pid:none) Ralstonia eutropha JMP134 chrom... 51 7e-05
CP000949_2368(CP000949|pid:none) Pseudomonas putida W619, comple... 51 7e-05
CP001026_137(CP001026|pid:none) Burkholderia ambifaria MC40-6 ch... 51 7e-05
CT573326_1875(CT573326|pid:none) Pseudomonas entomophila str. L4... 51 7e-05
CP000563_1056(CP000563|pid:none) Shewanella baltica OS155, compl... 51 7e-05
BA000004_3415(BA000004|pid:none) Bacillus halodurans C-125 DNA, ... 51 7e-05
CP001022_2283(CP001022|pid:none) Exiguobacterium sibiricum 255-1... 51 7e-05
CP000854_677(CP000854|pid:none) Mycobacterium marinum M, complet... 51 7e-05
CP001364_3543(CP001364|pid:none) Chloroflexus sp. Y-400-fl, comp... 51 9e-05
CP001197_900(CP001197|pid:none) Desulfovibrio vulgaris str. 'Miy... 51 9e-05
CP000480_3338(CP000480|pid:none) Mycobacterium smegmatis str. MC... 51 9e-05
CP000251_2145(CP000251|pid:none) Anaeromyxobacter dehalogenans 2... 51 9e-05
CP000441_1866(CP000441|pid:none) Burkholderia ambifaria AMMD chr... 51 9e-05
AE008691_2299(AE008691|pid:none) Thermoanaerobacter tengcongensi... 51 9e-05
BA000030_4116(BA000030|pid:none) Streptomyces avermitilis MA-468... 51 9e-05
CP000394_1652(CP000394|pid:none) Granulibacter bethesdensis CGDN... 51 9e-05
AE017333_3240(AE017333|pid:none) Bacillus licheniformis DSM 13, ... 51 9e-05
CU234118_2161(CU234118|pid:none) Bradyrhizobium sp. ORS278,compl... 51 9e-05
CP000815_618(CP000815|pid:none) Paulinella chromatophora chromat... 50 1e-04
AP009384_804(AP009384|pid:none) Azorhizobium caulinodans ORS 571... 50 1e-04
CP000769_1609(CP000769|pid:none) Anaeromyxobacter sp. Fw109-5, c... 50 1e-04
CP000959_1125(CP000959|pid:none) Burkholderia cenocepacia MC0-3 ... 50 1e-04
CP000764_3376(CP000764|pid:none) Bacillus cereus subsp. cytotoxi... 50 1e-04
AM408590_430(AM408590|pid:none) Mycobacterium bovis BCG Pasteur ... 50 1e-04
BA000028_3117(BA000028|pid:none) Oceanobacillus iheyensis HTE831... 50 1e-04
CP000301_2143(CP000301|pid:none) Rhodopseudomonas palustris BisB... 50 1e-04
AE000516_403(AE000516|pid:none) Mycobacterium tuberculosis CDC15... 50 1e-04
AE015929_632(AE015929|pid:none) Staphylococcus epidermidis ATCC ... 50 1e-04
CP000529_1268(CP000529|pid:none) Polaromonas naphthalenivorans C... 50 1e-04
BA000043_2959(BA000043|pid:none) Geobacillus kaustophilus HTA426... 50 1e-04
AM902716_3944(AM902716|pid:none) Bordetella petrii strain DSM 12... 50 1e-04
CP001344_1224(CP001344|pid:none) Cyanothece sp. PCC 7425, comple... 50 1e-04
BA000011_1229(BA000011|pid:none) Thermoplasma volcanium GSS1 DNA... 50 2e-04
CP000850_2194(CP000850|pid:none) Salinispora arenicola CNS-205, ... 50 2e-04
AP009351_29(AP009351|pid:none) Staphylococcus aureus subsp. aure... 50 2e-04
CP000934_819(CP000934|pid:none) Cellvibrio japonicus Ueda107, co... 50 2e-04
CP000431_4502(CP000431|pid:none) Rhodococcus jostii RHA1, comple... 50 2e-04
CP000656_3438(CP000656|pid:none) Mycobacterium gilvum PYR-GCK, c... 50 2e-04
CP000152_2977(CP000152|pid:none) Burkholderia sp. 383 chromosome... 50 2e-04
CP000058_778(CP000058|pid:none) Pseudomonas syringae pv. phaseol... 50 2e-04
AY316747_240(AY316747|pid:none) Rhizobium sp. NGR234 megaplasmid... 50 2e-04
CP001108_585(CP001108|pid:none) Prosthecochloris aestuarii DSM 2... 50 2e-04
AM849034_2406(AM849034|pid:none) Clavibacter michiganensis subsp... 50 2e-04
CP000560_2814(CP000560|pid:none) Bacillus amyloliquefaciens FZB4... 50 2e-04
CP000514_139(CP000514|pid:none) Marinobacter aquaeolei VT8, comp... 50 2e-04
CP000090_871(CP000090|pid:none) Ralstonia eutropha JMP134 chromo... 50 2e-04
AM747721_170(AM747721|pid:none) Burkholderia cenocepacia J2315 c... 50 2e-04
CP000539_2032(CP000539|pid:none) Acidovorax sp. JS42, complete g... 50 2e-04
CP000903_4776(CP000903|pid:none) Bacillus weihenstephanensis KBA... 50 2e-04
CP000964_3387(CP000964|pid:none) Klebsiella pneumoniae 342, comp... 49 3e-04
BX294142_262(BX294142|pid:none) Rhodopirellula baltica SH 1 comp... 49 3e-04
AM711867_2284(AM711867|pid:none) Clavibacter michiganensis subsp... 49 3e-04
CP000580_2877(CP000580|pid:none) Mycobacterium sp. JLS, complete... 49 3e-04
CP000926_667(CP000926|pid:none) Pseudomonas putida GB-1, complet... 49 3e-04
CP001349_4289(CP001349|pid:none) Methylobacterium nodulans ORS 2... 49 3e-04
AE015451_617(AE015451|pid:none) Pseudomonas putida KT2440 comple... 49 3e-04
CU914168_2031(CU914168|pid:none) Ralstonia solanacearum strain I... 49 3e-04
CU695239_139(CU695239|pid:none) Ralstonia solanacearum strain Mo... 49 3e-04
CP000828_2608(CP000828|pid:none) Acaryochloris marina MBIC11017,... 49 3e-04
CP000153_1209(CP000153|pid:none) Sulfurimonas denitrificans DSM ... 49 3e-04
CP001389_1942(CP001389|pid:none) Rhizobium sp. NGR234, complete ... 49 4e-04
CP001074_2859(CP001074|pid:none) Rhizobium etli CIAT 652, comple... 49 4e-04
AP006725_1886(AP006725|pid:none) Klebsiella pneumoniae NTUH-K204... 49 4e-04
CP000110_287(CP000110|pid:none) Synechococcus sp. CC9605, comple... 49 4e-04
CR543861_3264(CR543861|pid:none) Acinetobacter sp. ADP1 complete... 49 4e-04
D70024(D70024) NADH dehydrogenase homolog yutJ - Bacillus subtil... 49 4e-04
CP000388_4232(CP000388|pid:none) Pseudoalteromonas atlantica T6c... 49 4e-04
AE017340_1679(AE017340|pid:none) Idiomarina loihiensis L2TR, com... 49 5e-04
CP001616_1521(CP001616|pid:none) Tolumonas auensis DSM 9187, com... 49 5e-04
CP000454_1145(CP000454|pid:none) Arthrobacter sp. FB24, complete... 49 5e-04
AP008957_5586(AP008957|pid:none) Rhodococcus erythropolis PR4 DN... 49 5e-04
A82145(A82145) NADH dehydrogenase VC1890 [imported] - Vibrio cho... 49 5e-04
CP000681_1234(CP000681|pid:none) Shewanella putrefaciens CN-32, ... 49 5e-04
CP000431_7201(CP000431|pid:none) Rhodococcus jostii RHA1, comple... 49 5e-04
CP000304_3555(CP000304|pid:none) Pseudomonas stutzeri A1501, com... 49 5e-04
CP000302_2692(CP000302|pid:none) Shewanella denitrificans OS217,... 49 5e-04
CP001111_3598(CP001111|pid:none) Stenotrophomonas maltophilia R5... 49 5e-04
BA000040_3727(BA000040|pid:none) Bradyrhizobium japonicum USDA 1... 49 5e-04
CP000001_4748(CP000001|pid:none) Bacillus cereus E33L, complete ... 49 5e-04
AE016879_4917(AE016879|pid:none) Bacillus anthracis str. Ames, c... 49 5e-04
AL939131_68(AL939131|pid:none) Streptomyces coelicolor A3(2) com... 48 6e-04
CP000612_428(CP000612|pid:none) Desulfotomaculum reducens MI-1, ... 48 6e-04
CP000957_75(CP000957|pid:none) Synechococcus sp. PCC 7002 plasmi... 48 6e-04
AP011115_4466(AP011115|pid:none) Rhodococcus opacus B4 DNA, comp... 48 6e-04
CP000633_635(CP000633|pid:none) Agrobacterium vitis S4 chromosom... 48 6e-04
AM889285_312(AM889285|pid:none) Gluconacetobacter diazotrophicus... 48 6e-04
CP000680_2173(CP000680|pid:none) Pseudomonas mendocina ymp, comp... 48 6e-04
CP000272_258(CP000272|pid:none) Burkholderia xenovorans LB400 ch... 48 6e-04
CP000250_4243(CP000250|pid:none) Rhodopseudomonas palustris HaA2... 48 6e-04
CP000075_789(CP000075|pid:none) Pseudomonas syringae pv. syringa... 48 6e-04
CP000680_758(CP000680|pid:none) Pseudomonas mendocina ymp, compl... 48 6e-04
CP000503_3055(CP000503|pid:none) Shewanella sp. W3-18-1, complet... 48 6e-04
BA000028_1365(BA000028|pid:none) Oceanobacillus iheyensis HTE831... 48 6e-04
CP001196_2722(CP001196|pid:none) Oligotropha carboxidovorans OM5... 48 6e-04
BA000031_971(BA000031|pid:none) Vibrio parahaemolyticus RIMD 221... 48 8e-04
CT573213_4201(CT573213|pid:none) Frankia alni str. ACN14A chromo... 48 8e-04
AE017126_96(AE017126|pid:none) Prochlorococcus marinus subsp. ma... 48 8e-04
CP001108_2097(CP001108|pid:none) Prosthecochloris aestuarii DSM ... 48 8e-04
AE006470_368(AE006470|pid:none) Chlorobium tepidum TLS, complete... 48 8e-04
AM236080_3214(AM236080|pid:none) Rhizobium leguminosarum bv. vic... 48 8e-04
CP000820_2442(CP000820|pid:none) Frankia sp. EAN1pec, complete g... 48 8e-04
AB365454_4(AB365454|pid:none) Streptomyces griseus subsp. griseu... 48 8e-04
CP000316_3397(CP000316|pid:none) Polaromonas sp. JS666, complete... 48 8e-04
CP001618_1024(CP001618|pid:none) Beutenbergia cavernae DSM 12333... 48 8e-04
AE017333_2030(AE017333|pid:none) Bacillus licheniformis DSM 13, ... 48 8e-04
CP000777_1015(CP000777|pid:none) Leptospira biflexa serovar Pato... 48 8e-04
CP001191_2473(CP001191|pid:none) Rhizobium leguminosarum bv. tri... 47 0.001
CP001131_1711(CP001131|pid:none) Anaeromyxobacter sp. K, complet... 47 0.001
CP001097_1879(CP001097|pid:none) Chlorobium limicola DSM 245, co... 47 0.001
CP000113_371(CP000113|pid:none) Myxococcus xanthus DK 1622, comp... 47 0.001
CP000820_4249(CP000820|pid:none) Frankia sp. EAN1pec, complete g... 47 0.001
CP000555_2965(CP000555|pid:none) Methylibium petroleiphilum PM1,... 47 0.001
CP000552_336(CP000552|pid:none) Prochlorococcus marinus str. MIT... 47 0.001
BA000022_1205(BA000022|pid:none) Synechocystis sp. PCC 6803 DNA,... 47 0.001
CP001341_1213(CP001341|pid:none) Arthrobacter chlorophenolicus A... 47 0.002
CP001029_2722(CP001029|pid:none) Methylobacterium populi BJ001, ... 47 0.002
EF656452_1(EF656452|pid:none) Arenicola marina sulfide:quinone o... 47 0.002
(P44856) RecName: Full=NADH dehydrogenase; EC=1.6.99.3;... 47 0.002
CP000094_2449(CP000094|pid:none) Pseudomonas fluorescens Pf0-1, ... 47 0.002
CP001186_5077(CP001186|pid:none) Bacillus cereus G9842, complete... 47 0.002
AJ938182_804(AJ938182|pid:none) Staphylococcus aureus RF122 comp... 47 0.002
CU633749_2186(CU633749|pid:none) Cupriavidus taiwanensis str. LM... 47 0.002
AE016877_4820(AE016877|pid:none) Bacillus cereus ATCC 14579, com... 47 0.002
CP000111_88(CP000111|pid:none) Prochlorococcus marinus str. MIT ... 47 0.002
AP008229_4048(AP008229|pid:none) Xanthomonas oryzae pv. oryzae M... 46 0.002
CP000789_1434(CP000789|pid:none) Vibrio harveyi ATCC BAA-1116 ch... 46 0.002
CP001108_11(CP001108|pid:none) Prosthecochloris aestuarii DSM 27... 46 0.002
CP001400_2255(CP001400|pid:none) Sulfolobus islandicus M.14.25, ... 46 0.002
AE013598_4199(AE013598|pid:none) Xanthomonas oryzae pv. oryzae K... 46 0.002
AM039952_3947(AM039952|pid:none) Xanthomonas campestris pv. vesi... 46 0.002
CP000112_642(CP000112|pid:none) Desulfovibrio desulfuricans G20,... 46 0.002
CP000473_5165(CP000473|pid:none) Solibacter usitatus Ellin6076, ... 46 0.002
BA000030_6103(BA000030|pid:none) Streptomyces avermitilis MA-468... 46 0.002
CP000431_5283(CP000431|pid:none) Rhodococcus jostii RHA1, comple... 46 0.002
AP009493_3572(AP009493|pid:none) Streptomyces griseus subsp. gri... 46 0.002
CP000607_1670(CP000607|pid:none) Chlorobium phaeovibrioides DSM ... 46 0.003
AM238663_805(AM238663|pid:none) Streptomyces ambofaciens ATCC 23... 46 0.003
CP000560_1152(CP000560|pid:none) Bacillus amyloliquefaciens FZB4... 46 0.003
CP001001_694(CP001001|pid:none) Methylobacterium radiotolerans J... 46 0.003
AL646052_2227(AL646052|pid:none) Ralstonia solanacearum GMI1000 ... 46 0.003
CP000153_2074(CP000153|pid:none) Sulfurimonas denitrificans DSM ... 45 0.004
CP000820_4798(CP000820|pid:none) Frankia sp. EAN1pec, complete g... 45 0.004
CP001139_1167(CP001139|pid:none) Vibrio fischeri MJ11 chromosome... 45 0.004
BA000037_2368(BA000037|pid:none) Vibrio vulnificus YJ016 DNA, ch... 45 0.004
CP001399_2392(CP001399|pid:none) Sulfolobus islandicus L.S.2.15,... 45 0.004
CP000908_2603(CP000908|pid:none) Methylobacterium extorquens PA1... 45 0.004
CU459141_1634(CU459141|pid:none) Acinetobacter baumannii str. AY... 45 0.004
CP001172_1586(CP001172|pid:none) Acinetobacter baumannii AB307-0... 45 0.004
AP009493_239(AP009493|pid:none) Streptomyces griseus subsp. gris... 45 0.004
CP000416_309(CP000416|pid:none) Lactobacillus brevis ATCC 367, c... 45 0.004
AE016795_1918(AE016795|pid:none) Vibrio vulnificus CMCP6 chromos... 45 0.004
AE008923_3772(AE008923|pid:none) Xanthomonas axonopodis pv. citr... 45 0.005
CP001063_1899(CP001063|pid:none) Shigella boydii CDC 3083-94, co... 45 0.005
AP009493_6321(AP009493|pid:none) Streptomyces griseus subsp. gri... 45 0.005
CP000970_1952(CP000970|pid:none) Escherichia coli SMS-3-5, compl... 45 0.005
CP001298_2735(CP001298|pid:none) Methylobacterium chloromethanic... 45 0.005
AE014075_1335(AE014075|pid:none) Escherichia coli CFT073, comple... 45 0.005
CP000034_1900(CP000034|pid:none) Shigella dysenteriae Sd197, com... 45 0.005
CP000038_1057(CP000038|pid:none) Shigella sonnei Ss046, complete... 45 0.005
CP001404_311(CP001404|pid:none) Sulfolobus islandicus Y.N.15.51,... 45 0.005
CP000606_1158(CP000606|pid:none) Shewanella loihica PV-4, comple... 45 0.005
CP000568_554(CP000568|pid:none) Clostridium thermocellum ATCC 27... 45 0.005
CP000931_1184(CP000931|pid:none) Shewanella halifaxensis HAW-EB4... 45 0.005
CU928164_2037(CU928164|pid:none) Escherichia coli IAI39 chromoso... 45 0.005
CP000479_4596(CP000479|pid:none) Mycobacterium avium 104, comple... 45 0.005
BA000045_3503(BA000045|pid:none) Gloeobacter violaceus PCC 7421 ... 45 0.005
AE016879_4784(AE016879|pid:none) Bacillus anthracis str. Ames, c... 45 0.005
CP000227_4630(CP000227|pid:none) Bacillus cereus Q1, complete ge... 45 0.005
CP000521_2014(CP000521|pid:none) Acinetobacter baumannii ATCC 17... 45 0.005
AM180088_1715(AM180088|pid:none) Haloquadratum walsbyi DSM 16790... 45 0.005
AM295250_542(AM295250|pid:none) Staphylococcus carnosus subsp. c... 45 0.005
CP000863_1924(CP000863|pid:none) Acinetobacter baumannii ACICU, ... 45 0.005
AP006627_2928(AP006627|pid:none) Bacillus clausii KSM-K16 DNA, c... 45 0.005
CP001186_4948(CP001186|pid:none) Bacillus cereus G9842, complete... 45 0.005
CP000085_604(CP000085|pid:none) Burkholderia thailandensis E264 ... 45 0.005
AE016877_4701(AE016877|pid:none) Bacillus cereus ATCC 14579, com... 45 0.005
AE016958_3874(AE016958|pid:none) Mycobacterium avium subsp. para... 45 0.005
AM902716_3966(AM902716|pid:none) Bordetella petrii strain DSM 12... 45 0.005
AE004091_4536(AE004091|pid:none) Pseudomonas aeruginosa PAO1, co... 45 0.005
CP000903_4639(CP000903|pid:none) Bacillus weihenstephanensis KBA... 45 0.005
AL591985_1166(AL591985|pid:none) Sinorhizobium meliloti 1021 pla... 45 0.005
AP008955_1852(AP008955|pid:none) Brevibacillus brevis NBRC 10059... 45 0.007
CP001130_1508(CP001130|pid:none) Hydrogenobaculum sp. Y04AAS1, c... 45 0.007
(Q54DK1) RecName: Full=Sulfide:quinone oxidoreductase, mitochond... 45 0.007
CP000152_996(CP000152|pid:none) Burkholderia sp. 383 chromosome ... 45 0.007
BX571966_1801(BX571966|pid:none) Burkholderia pseudomallei strai... 45 0.007
CP001098_1472(CP001098|pid:none) Halothermothrix orenii H 168, c... 45 0.007
CP000438_2349(CP000438|pid:none) Pseudomonas aeruginosa UCBPP-PA... 45 0.007
CP000644_2393(CP000644|pid:none) Aeromonas salmonicida subsp. sa... 45 0.007
CP000804_2220(CP000804|pid:none) Roseiflexus castenholzii DSM 13... 45 0.007
FJ392609_12(FJ392609|pid:none) Streptomyces pactum strain ATCC 2... 45 0.007
EF487538_1(EF487538|pid:none) Urechis unicinctus sulfide-quinine... 44 0.009
DQ021191_1(DQ021191|pid:none) Vibrio cholerae isolate 395 NADH d... 44 0.009
CP000749_2236(CP000749|pid:none) Marinomonas sp. MWYL1, complete... 44 0.009
(Q5HQM1) RecName: Full=NADH dehydrogenase-like protein SERP0527;... 44 0.009
CP000111_313(CP000111|pid:none) Prochlorococcus marinus str. MIT... 44 0.009
CP001403_1175(CP001403|pid:none) Sulfolobus islandicus Y.G.57.14... 44 0.009
AM238663_306(AM238663|pid:none) Streptomyces ambofaciens ATCC 23... 44 0.009
CP001400_1076(CP001400|pid:none) Sulfolobus islandicus M.14.25, ... 44 0.009
CP000821_4225(CP000821|pid:none) Shewanella sediminis HAW-EB3, c... 44 0.009
AP009386_1379(AP009386|pid:none) Burkholderia multivorans ATCC 1... 44 0.009
AE006641_2900(AE006641|pid:none) Sulfolobus solfataricus P2, com... 44 0.009
CP000821_1251(CP000821|pid:none) Shewanella sediminis HAW-EB3, c... 44 0.011
FM178379_1311(FM178379|pid:none) Aliivibrio salmonicida LFI1238 ... 44 0.011
CP001636_38(CP001636|pid:none) Variovorax paradoxus S110 chromos... 44 0.011
AE005174_1555(AE005174|pid:none) Escherichia coli O157:H7 EDL933... 44 0.011
CP000271_194(CP000271|pid:none) Burkholderia xenovorans LB400 ch... 44 0.011
AP011115_2696(AP011115|pid:none) Rhodococcus opacus B4 DNA, comp... 44 0.011
CP000379_628(CP000379|pid:none) Burkholderia cenocepacia AU 1054... 44 0.011
AP006716_2013(AP006716|pid:none) Staphylococcus haemolyticus JCS... 44 0.011
CP000959_2318(CP000959|pid:none) Burkholderia cenocepacia MC0-3 ... 44 0.011
E72645(E72645)hypothetical protein APE0595 - Aeropyrum pernix (s... 44 0.015
CP000353_689(CP000353|pid:none) Ralstonia metallidurans CH34 meg... 44 0.015
AP009484_566(AP009484|pid:none) Macrococcus caseolyticus JCSC540... 44 0.015
CP000851_263(CP000851|pid:none) Shewanella pealeana ATCC 700345,... 44 0.015
AF346487_2(AF346487|pid:none) Azotobacter vinelandii uncoupled N... 43 0.019
AE006470_117(AE006470|pid:none) Chlorobium tepidum TLS, complete... 43 0.019
CP000472_1238(CP000472|pid:none) Shewanella piezotolerans WP3, c... 43 0.019
CT978603_389(CT978603|pid:none) Synechococcus sp. RCC307 genomic... 43 0.019
CP000584_378(CP000584|pid:none) Ostreococcus lucimarinus CCE9901... 43 0.019
AE016830_3039(AE016830|pid:none) Enterococcus faecalis V583, com... 43 0.019
FM954972_1966(FM954972|pid:none) Vibrio splendidus LGP32 chromos... 43 0.019
CP000362_725(CP000362|pid:none) Roseobacter denitrificans OCh 11... 43 0.025
CP000967_489(CP000967|pid:none) Xanthomonas oryzae pv. oryzae PX... 43 0.025
AE006470_1077(AE006470|pid:none) Chlorobium tepidum TLS, complet... 43 0.025
CP000485_2760(CP000485|pid:none) Bacillus thuringiensis str. Al ... 42 0.033
CR936257_1745(CR936257|pid:none) Natronomonas pharaonis DSM 2160... 42 0.033
CP000411_1668(CP000411|pid:none) Oenococcus oeni PSU-1, complete... 42 0.033
CP000097_214(CP000097|pid:none) Synechococcus sp. CC9902, comple... 42 0.033
AE017285_1966(AE017285|pid:none) Desulfovibrio vulgaris subsp. v... 42 0.033
AY596297_395(AY596297|pid:none) Haloarcula marismortui ATCC 4304... 42 0.033
CP001600_2244(CP001600|pid:none) Edwardsiella ictaluri 93-146, c... 42 0.033
AY596297_1151(AY596297|pid:none) Haloarcula marismortui ATCC 430... 42 0.033
AL445066_198(AL445066|pid:none) Thermoplasma acidophilum complet... 42 0.043
AM406671_1698(AM406671|pid:none) Lactococcus lactis subsp. cremo... 42 0.043
CP000108_285(CP000108|pid:none) Chlorobium chlorochromatii CaD3,... 42 0.043
AE005176_828(AE005176|pid:none) Lactococcus lactis subsp. lactis... 42 0.043
CP001618_3502(CP001618|pid:none) Beutenbergia cavernae DSM 12333... 42 0.043
CP001281_3544(CP001281|pid:none) Thauera sp. MZ1T, complete geno... 42 0.043
CP000480_5259(CP000480|pid:none) Mycobacterium smegmatis str. MC... 42 0.043
AP007164_508(AP007164|pid:none) Aspergillus oryzae RIB40 genomic... 42 0.043
CP001283_2461(CP001283|pid:none) Bacillus cereus AH820, complete... 42 0.056
DQ417161_1(DQ417161|pid:none) Ictalurus punctatus clone SAAD07R ... 42 0.056
AE017221_1393(AE017221|pid:none) Thermus thermophilus HB27, comp... 42 0.056
CP000001_2247(CP000001|pid:none) Bacillus cereus E33L, complete ... 42 0.056
CP001186_3428(CP001186|pid:none) Bacillus cereus G9842, complete... 42 0.056
AM238663_561(AM238663|pid:none) Streptomyces ambofaciens ATCC 23... 42 0.056
AP009153_395(AP009153|pid:none) Gemmatimonas aurantiaca T-27 DNA... 42 0.056
CP001101_2334(CP001101|pid:none) Chlorobium phaeobacteroides BS1... 41 0.073
AM920689_3990(AM920689|pid:none) Xanthomonas campestris pv. camp... 41 0.073
CP000828_442(CP000828|pid:none) Acaryochloris marina MBIC11017, ... 41 0.073
CP000468_999(CP000468|pid:none) Escherichia coli APEC O1, comple... 41 0.073
AL939104_147(AL939104|pid:none) Streptomyces coelicolor A3(2) co... 41 0.073
CP001407_2462(CP001407|pid:none) Bacillus cereus 03BB102, comple... 41 0.073
AE008922_3719(AE008922|pid:none) Xanthomonas campestris pv. camp... 41 0.073
CP001001_3629(CP001001|pid:none) Methylobacterium radiotolerans ... 41 0.073
CP000266_1049(CP000266|pid:none) Shigella flexneri 5 str. 8401, ... 41 0.073
CP001503_2142(CP001503|pid:none) Burkholderia glumae BGR1 chromo... 41 0.073
CP001615_775(CP001615|pid:none) Exiguobacterium sp. AT1b, comple... 41 0.073
CP000826_1919(CP000826|pid:none) Serratia proteamaculans 568, co... 41 0.073
AE004437_687(AE004437|pid:none) Halobacterium sp. NRC-1, complet... 41 0.073
(Q9BRQ8) RecName: Full=Apoptosis-inducing factor 2; EC=... 41 0.073
BX537621_1(BX537621|pid:none) Homo sapiens mRNA; cDNA DKFZp686H1... 41 0.073
CP000552_93(CP000552|pid:none) Prochlorococcus marinus str. MIT ... 41 0.073
CP000485_2159(CP000485|pid:none) Bacillus thuringiensis str. Al ... 41 0.095
CP001628_467(CP001628|pid:none) Micrococcus luteus NCTC 2665, co... 41 0.095
CP000931_3467(CP000931|pid:none) Shewanella halifaxensis HAW-EB4... 41 0.095
BX548174_87(BX548174|pid:none) Prochlorococcus marinus MED4 comp... 41 0.096
CP000777_2615(CP000777|pid:none) Leptospira biflexa serovar Pato... 40 0.12
CP000822_1894(CP000822|pid:none) Citrobacter koseri ATCC BAA-895... 40 0.12
BX640425_206(BX640425|pid:none) Bordetella parapertussis strain ... 40 0.12
CP000477_1512(CP000477|pid:none) Methanosaeta thermophila PT, co... 40 0.12
AD0197(AD0197) NADH2 dehydrogenase (EC 1.6.99.3) [imported] - Ye... 40 0.12
AC152348_8(AC152348|pid:none) Medicago truncatula clone mth2-52e... 40 0.12
CP000285_2310(CP000285|pid:none) Chromohalobacter salexigens DSM... 40 0.12
BX571868_152(BX571868|pid:none) Photorhabdus luminescens subsp. ... 40 0.12
CP001097_707(CP001097|pid:none) Chlorobium limicola DSM 245, com... 40 0.16
CP001618_2124(CP001618|pid:none) Beutenbergia cavernae DSM 12333... 40 0.16
>(Q55CD9) RecName: Full=Probable NADH dehydrogenase;
EC=1.6.-.-;
Length = 451
Score = 330 bits (846), Expect = 6e-89
Identities = 166/166 (100%), Positives = 166/166 (100%)
Frame = +3
Query: 51 MGLKNLIIRGRNYISDHLTKSSLEKAIIRRQKRGKVIENEKLIILGCGWGSYSFLKNLNS 230
MGLKNLIIRGRNYISDHLTKSSLEKAIIRRQKRGKVIENEKLIILGCGWGSYSFLKNLNS
Sbjct: 1 MGLKNLIIRGRNYISDHLTKSSLEKAIIRRQKRGKVIENEKLIILGCGWGSYSFLKNLNS 60
Query: 231 IKYDITVISPRNHFLFTPLLTSSAVGTLEFRSIAEPVRTTRDINEFKYIQASVTSINPEN 410
IKYDITVISPRNHFLFTPLLTSSAVGTLEFRSIAEPVRTTRDINEFKYIQASVTSINPEN
Sbjct: 61 IKYDITVISPRNHFLFTPLLTSSAVGTLEFRSIAEPVRTTRDINEFKYIQASVTSINPEN 120
Query: 411 NSVLVKSTFHNEKPFEMKYDKLVIGVGSRNNTFGIKGVEENANFLK 548
NSVLVKSTFHNEKPFEMKYDKLVIGVGSRNNTFGIKGVEENANFLK
Sbjct: 121 NSVLVKSTFHNEKPFEMKYDKLVIGVGSRNNTFGIKGVEENANFLK 166
Score = 305 bits (781), Expect = 2e-81
Identities = 153/174 (87%), Positives = 153/174 (87%)
Frame = +2
Query: 560 KEVLKDYVILDNGDRIPYGLLVWSTGIGQHPLVKNSSFEKDSHDRIIVDDHLRVKNYSNV 739
KEVLKDYVILDNGDRIPYGLLVWSTGIGQHPLVKNSSFEKDSHDRIIVDDHLRVKNYSNV
Sbjct: 278 KEVLKDYVILDNGDRIPYGLLVWSTGIGQHPLVKNSSFEKDSHDRIIVDDHLRVKNYSNV 337
Query: 740 FSFGDCANVENKNYPPTAQVASQSAVYLAKXXXXXXXXXXXXXXXXXXXXXGLLAYTGKK 919
FSFGDCANVENKNYPPTAQVASQSAVYLAK GLLAYTGKK
Sbjct: 338 FSFGDCANVENKNYPPTAQVASQSAVYLAKEFNNLEKLNPNPPKPFAFKFLGLLAYTGKK 397
Query: 920 SGILQTDFFDLSGFIGFITWRSAYLTRLGSLRSKIQVPFDWMRTLIFGRDISSF 1081
SGILQTDFFDLSGFIGFITWRSAYLTRLGSLRSKIQVPFDWMRTLIFGRDISSF
Sbjct: 398 SGILQTDFFDLSGFIGFITWRSAYLTRLGSLRSKIQVPFDWMRTLIFGRDISSF 451
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3236559
Number of Hits to DB: 1,388,186,039
Number of extensions: 24251019
Number of successful extensions: 64045
Number of sequences better than 10.0: 634
Number of HSP's gapped: 63636
Number of HSP's successfully gapped: 1014
Length of query: 397
Length of database: 1,051,180,864
Length adjustment: 131
Effective length of query: 266
Effective length of database: 627,191,635
Effective search space: 166832974910
Effective search space used: 166832974910
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 32 (16.9 bits)
|