Contig-U11678-1 |
Contig ID |
Contig-U11678-1 |
Contig update |
2002.12.18 |
Contig sequence |
|
Gap |
gap included |
Contig length |
1504 |
Chromosome number (1..6, M) |
4 |
Chromosome length |
5430582 |
Start point |
2134798 |
End point |
2133314 |
Strand (PLUS/MINUS) |
MINUS |
Number of clones |
10 |
Number of EST |
11 |
Link to clone list |
U11678 |
List of clone(s) |
|
Translated Amino Acid sequence |
|
Translated Amino Acid sequence (All Frames) |
|
own update |
2004. 6.10 |
Homology vs CSM-cDNA |
|
dna update |
2008.11.25 |
Homology vs DNA |
Query= Contig-U11678-1 (Contig-U11678-1Q) /CSM_Contig/Contig-U11678-1Q.Seq.d (1514 letters)
Database: ddbj_A 92,845,959 sequences; 95,242,211,685 total letters
Searching..................................................done
Score E Sequences producing significant alignments: (bits) Value N
(L33848) Dictyostelium discoideum G protein alpha-8 subunit ... 2181 0.0 2 (BJ376997) Dictyostelium discoideum cDNA clone:ddc30o21, 3' ... 1281 0.0 1 (BJ372179) Dictyostelium discoideum cDNA clone:ddc11g14, 3' ... 1158 0.0 2 (BJ327894) Dictyostelium discoideum cDNA clone:dda22l01, 5' ... 1120 0.0 1 (BJ376379) Dictyostelium discoideum cDNA clone:ddc28d10, 3' ... 1104 0.0 1 (C89926) Dictyostelium discoideum slug cDNA, clone SSG631. 987 0.0 3 (AU038002) Dictyostelium discoideum slug cDNA, clone SSH145. 924 0.0 3 (C90160) Dictyostelium discoideum slug cDNA, clone SSI160. 890 0.0 3 (BJ376891) Dictyostelium discoideum cDNA clone:ddc30o10, 3' ... 952 0.0 1 (AU033664) Dictyostelium discoideum slug cDNA, clone SLB285. 870 0.0 3 (AU072488) Dictyostelium discoideum slug cDNA, clone SSE688. 476 e-129 1 (FC815961) Sr_pAMT7_04l05_T7 S. ratti mixed stage pAMP Stron... 46 2e-17 4 (FC810537) Sr_pASP6_04l05_SP6 S. ratti mixed stage pAMP Stro... 46 2e-17 4 (AX489368) Sequence 6668 from Patent WO02053728. 72 3e-12 4 (CB097550) ku42b05.y1 Strongyloides ratti PA female naive pA... 54 8e-12 3 (EC824852) SME00003485 esmbsro2 Sawyeria marylandensis cDNA,... 84 1e-11 2 (FC818832) Sr_pAMT7_013b06_T7 S. ratti mixed stage pAMP Stro... 54 2e-11 3 (CZ528433) SRAA-aac55d05.b1 Strongyloides ratti whole genome... 54 2e-11 3 (U41995) Caenorhabditis elegans cosmid E02C12, complete sequ... 62 2e-11 2 (M38250) C.elegans G protein alpha subunit (GPA-3) gene, com... 62 3e-11 2 (AY008126) Caenorhabditis elegans isolate GPA-3 heterotrimer... 62 3e-11 2 (FE265176) CAZO4316.fwd CAZO Naegleria gruberi Flagellate St... 82 7e-11 1 (FE264133) CAZO3679.fwd CAZO Naegleria gruberi Flagellate St... 82 7e-11 1 (BJ363747) Dictyostelium discoideum cDNA clone:ddc28d10, 5' ... 56 1e-10 2 (AR546342) Sequence 1473 from patent US 6747137. 72 2e-10 3 (EC825716) SME00002342 esmbsro2 Sawyeria marylandensis cDNA,... 80 3e-10 1 (M88113) Candida albicans G protein alpha subunit (CAG1) gen... 72 3e-10 3 (CD523738) kw24c03.y1 Strongyloides ratti PA female naive pA... 54 2e-09 3 (FC820473) Sr_pAMT7_017m18_T7 S. ratti mixed stage pAMP Stro... 54 4e-09 3 (CR382139) Debaryomyces hansenii chromosome G of strain CBS7... 76 4e-09 1 (AY634300) Caenorhabditis briggsae strain AF16 gpa-7 gene, c... 76 4e-09 1 (C91463) Dictyostelium discoideum slug cDNA, clone SSK311. 68 3e-08 2 (BJ373959) Dictyostelium discoideum cDNA clone:ddc5h14, 3' e... 68 3e-08 2 (M25060) D.discoideum G protein alpha-subunit 1 mRNA, comple... 68 6e-08 2 (AB073314) Ciona intestinalis CiGi1 gene for G protein alpha... 58 8e-08 2 (BD421143) Newly found genes, derived from Ciona intestinali... 58 8e-08 2 (AK116213) Ciona intestinalis cDNA, clone:citb015m10, full i... 58 8e-08 2 (AB066281) Ciona intestinalis CiGi1 for G protein alpha subu... 58 8e-08 2 (AB066282) Ciona intestinalis CiGi1 for G protein alpha subu... 58 8e-08 2 (FF749154) XABT58365.fwd Gateway compatible cien cDNA librar... 58 8e-08 2 (FF944185) CBWU76932.b1 Yutaka Satou unpublished cDNA librar... 58 8e-08 2 (BW258773) Ciona intestinalis cDNA, clone:cign019j05, 5' end... 58 8e-08 2 (BW250464) Ciona intestinalis cDNA, clone:citb087a08, 5' end... 58 8e-08 2 (BW264601) Ciona intestinalis cDNA, clone:cign038l16, 5' end... 58 8e-08 2 (BW210873) Ciona intestinalis cDNA, clone:cieg065i22, 5' end... 58 8e-08 2 (BW293859) Ciona intestinalis cDNA, clone:cigd005m18, 5' end... 58 8e-08 2 (BW236365) Ciona intestinalis cDNA, clone:citb053h23, 5' end... 58 8e-08 2 (AV956222) Ciona intestinalis cDNA, clone:cilv11p05, 5' end,... 58 8e-08 2 (BW041427) Ciona intestinalis cDNA, clone:cibd046k08, 5' end... 58 8e-08 2 (BW247462) Ciona intestinalis cDNA, clone:citb074n23, 5' end... 58 8e-08 2 (BW041430) Ciona intestinalis cDNA, clone:cibd046k14, 5' end... 58 8e-08 2 (BW282186) Ciona intestinalis cDNA, clone:cigd019d13, 5' end... 58 8e-08 2 (FF787620) XABT84524.fwd Gateway compatible cien cDNA librar... 58 8e-08 2 (FK202622) XABT212560.b1 Gateway compatible cien cDNA librar... 58 8e-08 2 (AV992585) Ciona intestinalis cDNA, clone:cicl59j04, 5' end,... 58 8e-08 2 (BW238009) Ciona intestinalis cDNA, clone:citb058i17, 5' end... 58 8e-08 2 (BP000724) Ciona intestinalis cDNA, clone:cilv30m18, 5' end,... 58 8e-08 2 (BW282735) Ciona intestinalis cDNA, clone:cigd001o06, 5' end... 58 8e-08 2 (BW193031) Ciona intestinalis cDNA, clone:ciad098i08, 5' end... 58 8e-08 2 (FE264169) CAZO3705.fwd CAZO Naegleria gruberi Flagellate St... 60 1e-07 2 (FE264168) CAZO3705.rev CAZO Naegleria gruberi Flagellate St... 60 1e-07 2 (FE265101) CAZO4267.fwd CAZO Naegleria gruberi Flagellate St... 68 1e-07 2 (FE234872) CAPG3053.fwd CAPG Naegleria gruberi amoeba stage ... 68 1e-07 2 (FE243464) CAPG7657.fwd CAPG Naegleria gruberi amoeba stage ... 68 2e-07 2 (FE243856) CAPG7870.fwd CAPG Naegleria gruberi amoeba stage ... 68 2e-07 2 (FE232496) CAPG1780.fwd CAPG Naegleria gruberi amoeba stage ... 68 2e-07 2 (FE234552) CAPG2886.fwd CAPG Naegleria gruberi amoeba stage ... 68 2e-07 2 (FE238768) CAPG5020.fwd CAPG Naegleria gruberi amoeba stage ... 68 2e-07 2 (FE235665) CAPG3484.fwd CAPG Naegleria gruberi amoeba stage ... 68 2e-07 2 (FE242481) CAPG7187.fwd CAPG Naegleria gruberi amoeba stage ... 68 2e-07 2 (FE243364) CAPG761.fwd CAPG Naegleria gruberi amoeba stage N... 68 2e-07 2 (FE242514) CAPG7202.fwd CAPG Naegleria gruberi amoeba stage ... 68 2e-07 2 (AL409540) T7 end of clone AV0AA015E06 of library AV0AA from... 62 2e-07 2 (BW122929) Ciona intestinalis cDNA, clone:rcitb095c23, 3' en... 58 3e-07 2 (EC819433) SME00005129 esmbsro2 Sawyeria marylandensis cDNA,... 68 1e-06 1 (BJ430342) Dictyostelium discoideum cDNA clone:ddv6n19, 3' e... 68 1e-06 1 (FE252872) CAPH4244.fwd CAPH Naegleria gruberi amoeba stage ... 68 1e-06 1 (FE243463) CAPG7657.rev CAPG Naegleria gruberi amoeba stage ... 68 1e-06 1 (FE243363) CAPG761.rev CAPG Naegleria gruberi amoeba stage N... 68 1e-06 1 (FE242513) CAPG7202.rev CAPG Naegleria gruberi amoeba stage ... 68 1e-06 1 (FE242480) CAPG7187.rev CAPG Naegleria gruberi amoeba stage ... 68 1e-06 1 (FE238767) CAPG5020.rev CAPG Naegleria gruberi amoeba stage ... 68 1e-06 1 (FE235664) CAPG3484.rev CAPG Naegleria gruberi amoeba stage ... 68 1e-06 1 (FE234871) CAPG3053.rev CAPG Naegleria gruberi amoeba stage ... 68 1e-06 1 (FE232495) CAPG1780.rev CAPG Naegleria gruberi amoeba stage ... 68 1e-06 1 (CB394392) OSTR137A4_1 AD-wrmcDNA Caenorhabditis elegans cDN... 60 2e-06 2 (AY008130) Caenorhabditis elegans isolate GPA-7 heterotrimer... 60 3e-06 2 (BJ430353) Dictyostelium discoideum cDNA clone:ddv6p23, 3' e... 62 3e-06 2 (AF292562) Strongyloides stercoralis G protein alpha subunit... 66 4e-06 1 (CZ174951) MIAA-14E12b.g1 Meloidogyne incognita BAC end sequ... 64 2e-05 1 (CJ333633) Molgula tectiformis cDNA, embryo just before hatc... 64 2e-05 1 (Z70686) Caenorhabditis elegans Cosmid R10H10. 60 3e-05 5 (AL407875) T7 end of clone AV0AA005B12 of library AV0AA from... 62 7e-05 1 (FE257770) CAPH6795.fwd CAPH Naegleria gruberi amoeba stage ... 62 7e-05 1 (BW036109) Ciona intestinalis cDNA, clone:cibd002l24, 5' end... 58 1e-04 2 (FE242927) CAPG7400.rev CAPG Naegleria gruberi amoeba stage ... 54 1e-04 2 (BW038822) Ciona intestinalis cDNA, clone:cibd038n05, 5' end... 58 1e-04 2 (FE241145) CAPG6541.rev CAPG Naegleria gruberi amoeba stage ... 54 1e-04 2 (BW031519) Ciona intestinalis cDNA, clone:cibd018h24, 5' end... 58 1e-04 2 (AM636450) Entamoeba dispar GSS, clone dispar37g10.q1k. 48 1e-04 2
>(L33848) Dictyostelium discoideum G protein alpha-8 subunit mRNA, complete cds. Length = 1374
Score = 2181 bits (1100), Expect(2) = 0.0 Identities = 1106/1108 (99%) Strand = Plus / Plus
Query: 238 ggaaataaaatgggttgctatcaatcacgtgttcaagtagaagataaaacaaacgaacaa 297 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 124 ggaaataaaatgggttgctatcaatcacgtgttcaagtagaagataaaacaaacgaacaa 183
Query: 298 ttagataaatatcttgtacaagccggtaaagagggtttgttagattttagaatattattg 357 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 184 ttagataaatatcttgtacaagccggtaaagagggtttgttagattttagaatattattg 243
Query: 358 ttgggtgctggtgaaagtggtaaatccactgttgtaaaacaattaaaatcaatatataaa 417 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 244 ttgggtgctggtgaaagtggtaaatccactgttgtaaaacaattaaaatcaatatataaa 303
Query: 418 attcaagtcgatgatgatgaattacatagttatactgtaaatattcataaaaatacagta 477 ||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||| Sbjct: 304 attcaagtcgatgatgatgaattacatagttatgctgtaaatattcataaaaatacagta 363
Query: 478 ctttgtatgcaagttttattagaagctggtgaaactttaggtattgaattaactgacccc 537 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 364 ctttgtatgcaagttttattagaagctggtgaaactttaggtattgaattaactgacccc 423
Query: 538 gaaacaaagaaaagagcaattaatgttaaatcattccaatttgaaccagaagttaaacaa 597 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 424 gaaacaaagaaaagagcaattaatgttaaatcattccaatttgaaccagaagttaaacaa 483
Query: 598 atgccagttagtataggtttagatattgaagaattatggagggatgaagatattcaaaag 657 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 484 atgccagttagtataggtttagatattgaagaattatggagggatgaagatattcaaaag 543
Query: 658 atttgggatagaagatcagaatattggtttttagatgcaacaccatattatttcgaaaat 717 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 544 atttgggatagaagatcagaatattggtttttagatgcaacaccatattatttcgaaaat 603
Query: 718 attcaaagatttttagatgatgatttcgtaccaactgaagaagattgtattatgacacgt 777 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 604 attcaaagatttttagatgatgatttcgtaccaactgaagaagattgtattatgacacgt 663
Query: 778 gttagaactacaggtatctctgtaactgaatttgatgaaggtccagttcatttccgtgtt 837 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 664 gttagaactacaggtatctctgtaactgaatttgatgaaggtccagttcatttccgtgtt 723
Query: 838 gttgatgttggtggtcaaagaaatgaaagaaagaaatggattcattgttttgatgatgtt 897 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 724 gttgatgttggtggtcaaagaaatgaaagaaagaaatggattcattgttttgatgatgtt 783
Query: 898 aaagcattattatttgttgtaaatttagctggttatgatcaagttatgtttgaagatcct 957 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 784 aaagcattattatttgttgtaaatttagctggttatgatcaagttatgtttgaagatcct 843
Query: 958 tcacaaaatagaatgcaagaatcattaacattatttggacaaatttgtaataatccaata 1017 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 844 tcacaaaatagaatgcaagaatcattaacattatttggacaaatttgtaataatccaata 903
Query: 1018 ttttcagagaccccaacatttttggtattaaataaaaaagatttatttgaacaaatgatt 1077 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 904 ttttcagagaccccaacatttttggtattaaataaaaaagatttatttgaacaaatgatt 963
Query: 1078 caaaaaactgatcttagtaaatgtttcccagactataagggtggttcagatgtaaagaca 1137 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 964 caaaaaactgatcttagtaaatgtttcccagactataagggtggttcagatgtaaagaca 1023
Query: 1138 gcattggaattcattcaaatgaaatatcaacaaaagattcaagaatcaaataaaccttta 1197 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 1024 gcattggaattcattcaaatgaaatatcaacaaaagattcaagaatcaaataaaccttta 1083
Query: 1198 catacattccatattgctgctcgttataaaaaagatattaaatacacatgggaagaagca 1257 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 1084 catacattccatattgctgctcgttataaaaaagatattaaatacacatgggaagaagca 1143
Query: 1258 aaaggtatacttttagaagaaagtaaaaaggttttaatgaaagcaacaaaagatttaaag 1317 |||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||| Sbjct: 1144 aaaggtatacttttagaagaaaataaaaaggttttaatgaaagcaacaaaagatttaaag 1203
Query: 1318 aaatcttcaaaacaatcaagtaaatcat 1345 |||||||||||||||||||||||||||| Sbjct: 1204 aaatcttcaaaacaatcaagtaaatcat 1231
Score = 38.2 bits (19), Expect(2) = 0.0 Identities = 19/19 (100%) Strand = Plus / Plus
Query: 1349 tttaggtaatagtactcaa 1367 ||||||||||||||||||| Sbjct: 1233 tttaggtaatagtactcaa 1251
Score = 85.7 bits (43), Expect = 5e-12 Identities = 43/43 (100%) Strand = Plus / Plus
Query: 1416 ggccaaactacaattgatggtgcaaccgccaaaattaattctt 1458 ||||||||||||||||||||||||||||||||||||||||||| Sbjct: 1300 ggccaaactacaattgatggtgcaaccgccaaaattaattctt 1342
Lambda K H 1.37 0.711 1.31
Matrix: blastn matrix:1 -3 Number of Sequences: 92845959 Number of Hits to DB: 1,763,327,609 Number of extensions: 115222364 Number of successful extensions: 9763678 Number of sequences better than 10.0: 561 Length of query: 1514 Length of database: 95,242,211,685 Length adjustment: 24 Effective length of query: 1490 Effective length of database: 97,308,875,965 Effective search space: 144990225187850 Effective search space used: 144990225187850 X1: 11 (21.8 bits) S2: 22 (44.1 bits)
|
protein update |
2009. 6.30 |
Homology vs Protein |
Query= Contig-U11678-1 (Contig-U11678-1Q) /CSM_Contig/Contig-U11678-1Q.Seq.d (1514 letters)
Database: nrp_B 3,236,559 sequences; 1,051,180,864 total letters
Searching..................................................done
Score E Sequences producing significant alignments: (bits) Value
(P34046) RecName: Full=Guanine nucleotide-binding protein alpha-... 714 0.0 JH0249(JH0249)guanine nucleotide-binding protein alpha-8 chain -... 299 2e-79 M60162_1(M60162|pid:none) Human guanine nucleotide-binding regul... 257 9e-67 (Q05425) RecName: Full=Guanine nucleotide-binding protein alpha-... 256 1e-66 (O13315) RecName: Full=Guanine nucleotide-binding protein subuni... 255 3e-66 (Q00743) RecName: Full=Guanine nucleotide-binding protein subuni... 254 4e-66 AM270168_167(AM270168|pid:none) Aspergillus niger contig An08c01... 254 4e-66 (O13055) RecName: Full=Guanine nucleotide-binding protein G(i) s... 254 4e-66 CQ871846_1(CQ871846|pid:none) Sequence 19 from Patent WO20040790... 254 6e-66 AF011341_1(AF011341|pid:none) Magnaporthe grisea G alpha subunit... 254 6e-66 DQ202702_1(DQ202702|pid:none) Cricetulus griseus guanine nucleot... 254 6e-66 AF448796_1(AF448796|pid:none) Penicillium marneffei G-alpha subu... 254 6e-66 AK157998_1(AK157998|pid:none) Mus musculus adult inner ear cDNA,... 253 1e-65 BC170086_1(BC170086|pid:none) Xenopus laevis G protein alpha sub... 253 1e-65 (O74259) RecName: Full=Guanine nucleotide-binding protein subuni... 253 1e-65 AY036905_1(AY036905|pid:none) Trichoderma atroviride protein GTP... 253 1e-65 AM888285_1(AM888285|pid:none) Sordaria macrospora gsa1 gene for ... 253 1e-65 AP007161_483(AP007161|pid:none) Aspergillus oryzae RIB40 genomic... 253 1e-65 BC170080_1(BC170080|pid:none) Xenopus laevis G protein alpha sub... 253 1e-65 (P08752) RecName: Full=Guanine nucleotide-binding protein G(i), ... 253 2e-65 (P59215) RecName: Full=Guanine nucleotide-binding protein G(o) s... 252 2e-65 (P08239) RecName: Full=Guanine nucleotide-binding protein G(o) s... 252 3e-65 AB047082_1(AB047082|pid:none) Halocynthia roretzi HrGi-1 mRNA fo... 252 3e-65 (P09471) RecName: Full=Guanine nucleotide-binding protein G(o) s... 252 3e-65 (P38400) RecName: Full=Guanine nucleotide-binding protein G(i), ... 252 3e-65 (O42784) RecName: Full=Guanine nucleotide-binding protein subuni... 252 3e-65 DQ202701_1(DQ202701|pid:none) Cricetulus griseus guanine nucleot... 251 4e-65 AF370014_1(AF370014|pid:none) Leptosphaeria maculans G-protein a... 251 4e-65 BC063931_1(BC063931|pid:none) Xenopus tropicalis hypothetical pr... 251 4e-65 RGRTO2(D40436;S12990)GTP-binding regulatory protein Go alpha cha... 251 4e-65 BC059637_1(BC059637|pid:none) Danio rerio guanine nucleotide bin... 251 4e-65 FJ958357_1(FJ958357|pid:none) Ovis aries GNAZ (GNAZ) mRNA, compl... 251 5e-65 X12924_1(X12924|pid:none) Bovine mRNA for GTP-binding protein G39. 251 6e-65 M13963_1(M13963|pid:none) Mouse inhibitory G protein of adenylat... 251 6e-65 DQ917648_1(DQ917648|pid:none) Sus scrofa GBI1 mRNA, complete cds. 251 6e-65 AB239917_1(AB239917|pid:none) Alternaria alternata AGA1 gene for... 251 6e-65 AJ294815_1(AJ294815|pid:none) Tapesia yallundae tyg1 gene for G ... 251 6e-65 (O74227) RecName: Full=Guanine nucleotide-binding protein subuni... 250 8e-65 DQ917649_1(DQ917649|pid:none) Sus scrofa GBI2 mRNA, complete cds. 250 8e-65 DQ863321_1(DQ863321|pid:none) Penicillium marneffei GPA2-like pr... 250 8e-65 (P04899) RecName: Full=Guanine nucleotide-binding protein G(i), ... 250 1e-64 (P10825) RecName: Full=Guanine nucleotide-binding protein G(o) s... 250 1e-64 (P87032) RecName: Full=Guanine nucleotide-binding protein alpha-... 249 1e-64 AB022098_1(AB022098|pid:none) Halocynthia roretzi mRNA for G pro... 249 2e-64 RGXLOA(S02785)GTP-binding regulatory protein Go alpha chain - Af... 248 3e-64 DQ100316_1(DQ100316|pid:none) Uta stansburiana gustducin mRNA, c... 248 3e-64 J03004_1(J03004|pid:none) Human guanine nucleotide-binding regul... 248 3e-64 AE013599_1135(AE013599|pid:none) Drosophila melanogaster chromos... 248 5e-64 M19182_1(M19182|pid:none) Homo sapiens guanine nucleotide-bindin... 248 5e-64 DQ458049_1(DQ458049|pid:none) Mycosphaerella graminicola G-prote... 247 9e-64 AK056008_1(AK056008|pid:none) Homo sapiens cDNA FLJ31446 fis, cl... 246 1e-63 BC084923_1(BC084923|pid:none) Xenopus laevis guanine nucleotide ... 246 1e-63 AY892781_1(AY892781|pid:none) Synthetic construct Homo sapiens c... 246 1e-63 BC014627_1(BC014627|pid:none) Homo sapiens guanine nucleotide bi... 246 1e-63 BT044658_1(BT044658|pid:none) Salmo salar clone ssal-rgf-002-092... 246 2e-63 (P16378) RecName: Full=Guanine nucleotide-binding protein G(o) s... 246 2e-63 EU571208_1(EU571208|pid:none) Petromyzon marinus short photorece... 246 2e-63 BC049537_1(BC049537|pid:none) Danio rerio guanine nucleotide bin... 246 2e-63 AY254175_1(AY254175|pid:none) Mucor circinelloides G protein alp... 245 4e-63 DQ182016_1(DQ182016|pid:none) Anopheles gambiae G(alpha)i mRNA, ... 245 4e-63 (P50146) RecName: Full=Guanine nucleotide-binding protein G(i), ... 244 6e-63 (P27044) RecName: Full=Guanine nucleotide-binding protein G(i), ... 244 6e-63 DQ656111_1(DQ656111|pid:none) Aplysia californica guanine nucleo... 244 6e-63 S71213_1(S71213|pid:none) G protein Gi2 alpha [mice, CBA/J, coch... 243 1e-62 (P38404) RecName: Full=Guanine nucleotide-binding protein G(o) s... 243 1e-62 (Q9N2V6) RecName: Full=Guanine nucleotide-binding protein alpha-... 243 1e-62 AY677118_1(AY677118|pid:none) Homo sapiens Galphai2 protein mRNA... 243 1e-62 (P38401) RecName: Full=Guanine nucleotide-binding protein G(i), ... 243 2e-62 (P51876) RecName: Full=Guanine nucleotide-binding protein G(i) s... 242 2e-62 (P63096) RecName: Full=Guanine nucleotide-binding protein G(i), ... 242 2e-62 (P10824) RecName: Full=Guanine nucleotide-binding protein G(i), ... 242 2e-62 (P20353) RecName: Full=Guanine nucleotide-binding protein G(i) s... 242 2e-62 AB051903_1(AB051903|pid:none) Schizophyllum commune ScGP-B gene ... 242 2e-62 (Q60XS3) RecName: Full=Guanine nucleotide-binding protein alpha-... 242 2e-62 (P30682) RecName: Full=Guanine nucleotide-binding protein G(i) s... 242 3e-62 AY391429_1(AY391429|pid:none) Danio rerio guanine nucleotide bin... 241 4e-62 EU257502_1(EU257502|pid:none) Cavia porcellus alpha-transducin (... 241 4e-62 CR859352_1(CR859352|pid:none) Pongo abelii mRNA; cDNA DKFZp469C1... 241 5e-62 BT019775_1(BT019775|pid:none) Homo sapiens guanine nucleotide bi... 241 5e-62 AB066281_1(AB066281|pid:none) Ciona intestinalis CiGi1 for G pro... 241 7e-62 (P08754) RecName: Full=Guanine nucleotide-binding protein G(k) s... 241 7e-62 AF050653_1(AF050653|pid:none) Ambystoma tigrinum rod transducin ... 241 7e-62 AF540394_1(AF540394|pid:none) Schistosoma mansoni trimeric G-pro... 240 9e-62 (P04695) RecName: Full=Guanine nucleotide-binding protein G(t) s... 240 9e-62 AJ132944_1(AJ132944|pid:none) Sclerotinia sclerotiorum sgp1 gene... 240 9e-62 AY634286_1(AY634286|pid:none) Caenorhabditis briggsae strain AF1... 240 9e-62 PDBN(1CIP)A MOL_ID: 1;MOL_ID: 1; MOLECULE: GUANINE NUCLEOTIDE-BI... 240 9e-62 (Q5RAD4) RecName: Full=Guanine nucleotide-binding protein G(i), ... 240 9e-62 (P38403) RecName: Full=Guanine nucleotide-binding protein G(k) s... 240 9e-62 BT045919_1(BT045919|pid:none) Salmo salar clone ssal-rgf-536-281... 240 9e-62 AY327542_1(AY327542|pid:none) Phaeosphaeria nodorum G-alpha subu... 240 9e-62 AY899210_1(AY899210|pid:none) Rattus norvegicus GTP-binding prot... 240 1e-61 (P30676) RecName: Full=Guanine nucleotide-binding protein G(i) s... 240 1e-61 AB180748_1(AB180748|pid:none) Cyprinus carpio Galpha-t1-1 mRNA f... 240 1e-61 AB167957_1(AB167957|pid:none) Bombyx mori mRNA for G protein alp... 240 1e-61 (P20612) RecName: Full=Guanine nucleotide-binding protein G(t) s... 240 1e-61 BC155288_1(BC155288|pid:none) Danio rerio guanine nucleotide bin... 240 1e-61 (A8MTJ3) RecName: Full=Guanine nucleotide-binding protein G(t) s... 240 1e-61 AY603976_1(AY603976|pid:none) Sitobion avenae guanine nucleotide... 239 1e-61 (P30683) RecName: Full=Guanine nucleotide-binding protein G(o) s... 239 2e-61 (P38407) RecName: Full=Guanine nucleotide-binding protein G(t) s... 239 2e-61 BC053164_1(BC053164|pid:none) Danio rerio guanine nucleotide bin... 239 2e-61 AY891138_1(AY891138|pid:none) Synthetic construct Homo sapiens c... 239 2e-61 AB274828_1(AB274828|pid:none) Capra hircus Gi2 mRNA for guanine ... 239 2e-61 BC026326_1(BC026326|pid:none) Homo sapiens guanine nucleotide bi... 239 2e-61 AF407334_1(AF407334|pid:none) Lentinula edodes guanine nucleotid... 239 3e-61 L24550_1(L24550|pid:none) Gallus gallus G protein alpha subunit ... 239 3e-61 (Q9DC51) RecName: Full=Guanine nucleotide-binding protein G(k) s... 239 3e-61 (P08753) RecName: Full=Guanine nucleotide-binding protein G(k) s... 239 3e-61 DQ202703_1(DQ202703|pid:none) Cricetulus griseus guanine nucleot... 239 3e-61 AF200338_1(AF200338|pid:none) Gallus gallus rod-type transducin ... 239 3e-61 (O15976) RecName: Full=Guanine nucleotide-binding protein G(o) s... 239 3e-61 (Q28300) RecName: Full=Guanine nucleotide-binding protein G(t) s... 238 3e-61 FN357329_24(FN357329|pid:none) Schistosoma mansoni genome sequen... 238 6e-61 DQ917647_1(DQ917647|pid:none) Sus scrofa GBAK mRNA, complete cds. 238 6e-61 DQ656112_1(DQ656112|pid:none) Aplysia californica guanine nucleo... 238 6e-61 (P11488) RecName: Full=Guanine nucleotide-binding protein G(t) s... 237 7e-61 AK167438_1(AK167438|pid:none) Mus musculus 15 days pregnant adul... 237 1e-60 (P50149) RecName: Full=Guanine nucleotide-binding protein G(t) s... 236 1e-60 (P54853) RecName: Full=Guanine nucleotide-binding protein subuni... 236 2e-60 BC044123_1(BC044123|pid:none) Xenopus laevis alpha-subunit of G-... 236 2e-60 L24551_1(L24551|pid:none) Gallus gallus G protein (Galpa i3-o) m... 236 2e-60 AF329891_1(AF329891|pid:none) Pisolithus sp. 441 G protein alpha... 236 2e-60 AB025781_1(AB025781|pid:none) Octopus vulgaris OvGao mRNA for G ... 235 3e-60 AY170625_1(AY170625|pid:none) Penicillium marneffei G protein al... 235 3e-60 BC075229_1(BC075229|pid:none) Xenopus laevis MGC84417 protein, m... 235 4e-60 EU369353_1(EU369353|pid:none) Oncorhynchus mykiss G protein alph... 234 5e-60 AF050654_1(AF050654|pid:none) Ambystoma tigrinum cone transducin... 234 5e-60 AF452097_1(AF452097|pid:none) Trichoderma atroviride G protein a... 234 5e-60 AK009388_1(AK009388|pid:none) Mus musculus adult male tongue cDN... 234 5e-60 (P29348) RecName: Full=Guanine nucleotide-binding protein G(t) s... 234 6e-60 S47614_1(S47614|pid:none) G-protein alpha i subunit [Homarus ame... 233 1e-59 (Q21917) RecName: Full=Guanine nucleotide-binding protein alpha-... 233 1e-59 X15088_1(X15088|pid:none) Human GNAT1 mRNA for transducin alpha-... 233 1e-59 EU057176_1(EU057176|pid:none) Helicoverpa assulta G(alpha)q mRNA... 233 1e-59 NRL(1TNDA) Transducin (alpha subunit) complexed with the Nonhydr... 233 2e-59 BC016995_1(BC016995|pid:none) Homo sapiens guanine nucleotide bi... 232 2e-59 AY534107_1(AY534107|pid:none) Lytechinus variegatus guanine nucl... 232 2e-59 BC168083_1(BC168083|pid:none) Xenopus tropicalis cDNA clone MGC:... 232 2e-59 (P34042) RecName: Full=Guanine nucleotide-binding protein alpha-... 232 2e-59 AK302330_1(AK302330|pid:none) Homo sapiens cDNA FLJ61190 complet... 232 2e-59 AK096299_1(AK096299|pid:none) Homo sapiens cDNA FLJ38980 fis, cl... 232 2e-59 FN318225_1(FN318225|pid:none) Schistosoma japonicum isolate Anhu... 232 3e-59 (P16894) RecName: Full=Guanine nucleotide-binding protein alpha-... 232 3e-59 FJ230781_1(FJ230781|pid:none) Drechslerella dactyloides G protei... 231 4e-59 DQ993172_1(DQ993172|pid:none) Hypocrea jecorina G-alpha protein ... 231 4e-59 AY814015_1(AY814015|pid:none) Schistosoma japonicum SJCHGC05797 ... 231 5e-59 AY534108_1(AY534108|pid:none) Strongylocentrotus purpuratus guan... 231 5e-59 NRL(1TNDB) Transducin (alpha subunit) complexed with the Nonhydr... 231 5e-59 AB066282_1(AB066282|pid:none) Ciona intestinalis CiGi1 for G pro... 231 7e-59 AM888287_1(AM888287|pid:none) Sordaria macrospora partial gsa3 g... 231 7e-59 EU571207_1(EU571207|pid:none) Petromyzon marinus long photorecep... 231 7e-59 BC162964_1(BC162964|pid:none) Danio rerio guanine nucleotide bin... 231 7e-59 DQ397515_1(DQ397515|pid:none) Aplysia californica guanine nucleo... 230 9e-59 NRL(1GIA) Gi alpha 1 (active form with bound gtp-gamma-s) - Rattus 230 9e-59 AY957405_1(AY957405|pid:none) Helicoverpa armigera GTP-binding p... 230 1e-58 DQ100319_1(DQ100319|pid:none) Uta stansburiana cone transducin m... 229 2e-58 NRL(1TAG) Transducin-alpha complexed with gdp and magnesium 229 3e-58 FN357320_6(FN357320|pid:none) Schistosoma mansoni genome sequenc... 229 3e-58 FJ362377_4(FJ362377|pid:none) Caenorhabditis sp. PS1010 contig J... 229 3e-58 BC080940_1(BC080940|pid:none) Xenopus tropicalis guanine nucleot... 228 6e-58 AY357297_1(AY357297|pid:none) Cryptococcus neoformans var. grubi... 228 6e-58 AB105070_1(AB105070|pid:none) Bombyx mori mRNA for Gq-like G pro... 227 1e-57 AF200339_1(AF200339|pid:none) Gallus gallus cone-type transducin... 226 1e-57 (O73819) RecName: Full=Guanine nucleotide-binding protein subuni... 226 1e-57 AB180747_1(AB180747|pid:none) Cyprinus carpio Galpha-t2 mRNA for... 226 1e-57 AY626792_1(AY626792|pid:none) Litopenaeus vannamei heterotrimeri... 226 2e-57 AF292562_1(AF292562|pid:none) Strongyloides stercoralis G protei... 226 2e-57 (O14438) RecName: Full=Guanine nucleotide-binding protein alpha-... 226 2e-57 AY328525_1(AY328525|pid:none) Gekko gecko photoreceptor transduc... 226 2e-57 BC108552_1(BC108552|pid:none) Xenopus laevis hypothetical protei... 225 3e-57 BC085433_1(BC085433|pid:none) Danio rerio zgc:101761, mRNA (cDNA... 225 4e-57 AK040065_1(AK040065|pid:none) Mus musculus 0 day neonate thymus ... 225 4e-57 AB425233_1(AB425233|pid:none) Bombyx mori Gq mRNA for G protein ... 224 5e-57 AM920428_1167(AM920428|pid:none) Penicillium chrysogenum Wiscons... 224 5e-57 (P30677) RecName: Full=Guanine nucleotide-binding protein subuni... 224 6e-57 L79908_1(L79908|pid:none) Takifugu rubripes G protein alpha subu... 224 6e-57 AE017341_175(AE017341|pid:none) Cryptococcus neoformans var. neo... 224 6e-57 (P38408) RecName: Full=Guanine nucleotide-binding protein subuni... 224 8e-57 (O95837) RecName: Full=Guanine nucleotide-binding protein subuni... 224 8e-57 AY634285_1(AY634285|pid:none) Caenorhabditis briggsae strain AF1... 223 1e-56 AB083056_1(AB083056|pid:none) Helicobasidium mompa hga1-2 gene f... 223 1e-56 AY146560_1(AY146560|pid:none) Caenorhabditis elegans strain CB49... 223 2e-56 AY146562_1(AY146562|pid:none) Caenorhabditis elegans strain CB48... 223 2e-56 AY146558_1(AY146558|pid:none) Caenorhabditis elegans strain DH42... 223 2e-56 AY146566_1(AY146566|pid:none) Caenorhabditis elegans strain AB3 ... 223 2e-56 FN357299_30(FN357299|pid:none) Schistosoma mansoni genome sequen... 223 2e-56 AK147393_1(AK147393|pid:none) Mus musculus cDNA, RIKEN full-leng... 222 2e-56 BC081126_1(BC081126|pid:none) Xenopus laevis guanine nucleotide ... 222 2e-56 (Q86FX7) RecName: Full=Guanine nucleotide-binding protein alpha-... 222 2e-56 AJ851735_1(AJ851735|pid:none) Gallus gallus mRNA for hypothetica... 222 2e-56 AF234260_1(AF234260|pid:none) Rattus norvegicus heterotrimeric g... 222 3e-56 (Q9BIG5) RecName: Full=Guanine nucleotide-binding protein alpha-... 222 3e-56 (P38410) RecName: Full=Guanine nucleotide-binding protein G(q) s... 221 4e-56 AB271925_1(AB271925|pid:none) Sus scrofa GNAQ mRNA for guanine n... 221 4e-56 (P50148) RecName: Full=Guanine nucleotide-binding protein G(q) s... 221 4e-56 L76256_1(L76256|pid:none) Homo sapiens G alpha q mRNA, 5' end of... 221 4e-56 DQ327708_1(DQ327708|pid:none) Schistosoma japonicum GTP-binding ... 221 4e-56 (Q61B55) RecName: Full=Guanine nucleotide-binding protein alpha-... 221 5e-56 AY146576_1(AY146576|pid:none) Caenorhabditis remanei strain PB26... 221 7e-56 AY146574_1(AY146574|pid:none) Caenorhabditis remanei strain PB24... 221 7e-56 AY146571_1(AY146571|pid:none) Caenorhabditis remanei strain PB23... 221 7e-56 AF011496_1(AF011496|pid:none) Homo sapiens GTP-binding protein a... 221 7e-56 BX005248_1(BX005248|pid:none) Zebrafish DNA sequence from clone ... 220 9e-56 (P22454) RecName: Full=Guanine nucleotide-binding protein alpha-... 220 9e-56 (Q54R41) RecName: Full=Guanine nucleotide-binding protein alpha-... 220 1e-55 CR761976_1(CR761976|pid:none) Xenopus tropicalis finished cDNA, ... 219 2e-55 AY146577_1(AY146577|pid:none) Caenorhabditis remanei strain EM46... 218 4e-55 (P43444) RecName: Full=Guanine nucleotide-binding protein subuni... 218 4e-55 T32578(T32578)hypothetical protein T07A9.7 - Caenorhabditis eleg... 218 4e-55 (P38409) RecName: Full=Guanine nucleotide-binding protein subuni... 218 4e-55 AF157496_1(AF157496|pid:none) Suillus bovinus heterotrimeric G p... 218 5e-55 AF521583_1(AF521583|pid:none) Loligo pealei visual iGq-alpha pro... 218 5e-55 AB066503_1(AB066503|pid:none) Schizophyllum commune ScGP-A gene ... 217 8e-55 (Q4VT35) RecName: Full=Guanine nucleotide-binding protein alpha-... 217 8e-55 FJ455725_1(FJ455725|pid:none) Caenorhabditis remanei strain PB24... 217 8e-55 AB209435_1(AB209435|pid:none) Homo sapiens mRNA for Guanine nucl... 217 1e-54 BC061608_1(BC061608|pid:none) Xenopus tropicalis guanine nucleot... 216 1e-54 AJ250443_1(AJ250443|pid:none) Calliphora vicina mRNA for guanine... 216 2e-54 EU170368_1(EU170368|pid:none) Dipolydora quadrilobata guanine nu... 216 2e-54 U37413_1(U37413|pid:none) Mus musculus guanine nucleotide-bindin... 216 2e-54 BC030027_1(BC030027|pid:none) Homo sapiens guanine nucleotide bi... 215 3e-54 (P28052) RecName: Full=Guanine nucleotide-binding protein alpha-... 215 4e-54 AY301989_1(AY301989|pid:none) Penicillium marneffei G-alpha subu... 215 4e-54 (O15975) RecName: Full=Guanine nucleotide-binding protein G(q) s... 215 4e-54 M69013_1(M69013|pid:none) Human guanine nucleotide-binding regul... 214 5e-54 (Q9JID2) RecName: Full=Guanine nucleotide-binding protein subuni... 214 7e-54 BC122955_1(BC122955|pid:none) Xenopus tropicalis hypothetical pr... 214 9e-54 (P34043) RecName: Full=Guanine nucleotide-binding protein alpha-... 213 1e-53 AF201328_1(AF201328|pid:none) Panulirus argus Gq/11 protein alph... 213 2e-53 (O70443) RecName: Full=Guanine nucleotide-binding protein G(z) s... 213 2e-53 BC011169_1(BC011169|pid:none) Mus musculus guanine nucleotide bi... 213 2e-53 CQ830630_1(CQ830630|pid:none) Sequence 1 from Patent WO2004055048. 212 3e-53 (P19627) RecName: Full=Guanine nucleotide-binding protein G(z) s... 211 4e-53 BC026342_1(BC026342|pid:none) Homo sapiens guanine nucleotide bi... 211 7e-53 JN0115(JN0115)GTP-binding regulatory protein dgq alpha chain - f... 210 1e-52 BC077141_1(BC077141|pid:none) Danio rerio zgc:100942, mRNA (cDNA... 210 1e-52 AY542969_1(AY542969|pid:none) Bigelowiella natans guanine nucleo... 210 1e-52 BC037333_1(BC037333|pid:none) Homo sapiens guanine nucleotide bi... 210 1e-52 (P19086) RecName: Full=Guanine nucleotide-binding protein G(z) s... 209 2e-52 (Q60MJ0) RecName: Full=Guanine nucleotide-binding protein alpha-... 209 2e-52 BT060740_1(BT060740|pid:none) Zea mays full-length cDNA clone ZM... 209 2e-52 (P28051) RecName: Full=Guanine nucleotide-binding protein alpha-... 209 3e-52 AK304473_1(AK304473|pid:none) Homo sapiens cDNA FLJ61561 complet... 208 4e-52 EU069505_1(EU069505|pid:none) Sorghum bicolor G protein alpha su... 208 5e-52 AP007151_631(AP007151|pid:none) Aspergillus oryzae RIB40 genomic... 208 5e-52 D90150_1(D90150|pid:none) Homo sapiens Gx-alpha gene for pertuss... 207 8e-52 (P30678) RecName: Full=Guanine nucleotide-binding protein subuni... 207 8e-52 AF157495_1(AF157495|pid:none) Schizophyllum commune heterotrimer... 207 8e-52 BT001768_1(BT001768|pid:none) Drosophila melanogaster RH09776 fu... 207 1e-51 (Q60W52) RecName: Full=Guanine nucleotide-binding protein alpha-... 207 1e-51 AB045579_1(AB045579|pid:none) Rosellinia necatrix WGA3 gene for ... 207 1e-51 BT059303_1(BT059303|pid:none) Salmo salar clone ssal-rgf-540-070... 207 1e-51 AK126708_1(AK126708|pid:none) Homo sapiens cDNA FLJ44754 fis, cl... 206 1e-51 AY550248_1(AY550248|pid:none) Paracoccidioides brasiliensis smal... 206 2e-51 (Q9TU29) RecName: Full=Guanine nucleotide-binding protein subuni... 206 2e-51 EU489474_1(EU489474|pid:none) Scoparia dulcis heterotrimeric GTP... 206 2e-51 AM920433_161(AM920433|pid:none) Penicillium chrysogenum Wisconsi... 206 2e-51 (P30679) RecName: Full=Guanine nucleotide-binding protein subuni... 206 2e-51 AK291329_1(AK291329|pid:none) Homo sapiens cDNA FLJ76843 complet... 205 3e-51 AB006548_1(AB006548|pid:none) Ephydatia fluviatilis mRNA for G p... 205 3e-51 AF306530_1(AF306530|pid:none) Schizophyllum commune heterotrimer... 205 4e-51 BX649295_2(BX649295|pid:none) Zebrafish DNA sequence from clone ... 205 4e-51 AY168002_1(AY168002|pid:none) Hypocrea virens G protein alpha su... 204 5e-51 CU459096_4(CU459096|pid:none) Zebrafish DNA sequence from clone ... 204 5e-51 AK035320_1(AK035320|pid:none) Mus musculus adult male urinary bl... 204 7e-51 AB025782_1(AB025782|pid:none) Octopus vulgaris OvGaq mRNA for G ... 204 9e-51 AB051904_1(AB051904|pid:none) Schizophyllum commune ScGP-C gene ... 203 2e-50 AL953843_1(AL953843|pid:none) Zebrafish DNA sequence from clone ... 203 2e-50 AP008211_854(AP008211|pid:none) Oryza sativa (japonica cultivar-... 202 2e-50 AB274883_1(AB274883|pid:none) Mauremys reevesii mRNA for guanine... 202 3e-50 AY487343_1(AY487343|pid:none) Sporothrix schenckii G-protein alp... 202 3e-50 L47105_1(L47105|pid:none) Kluyveromyces lactis G protein alpha s... 201 4e-50 (P10823) RecName: Full=Guanine nucleotide-binding protein alpha-... 201 6e-50 T09152(T09152) GTP-binding regulatory protein alpha chain - spin... 201 8e-50 AY091588_1(AY091588|pid:none) Cryphonectria parasitica G-protein... 201 8e-50 BC161136_1(BC161136|pid:none) Xenopus tropicalis hypothetical pr... 201 8e-50 AM270019_27(AM270019|pid:none) Aspergillus niger contig An02c024... 200 1e-49 (Q9XZV4) RecName: Full=Guanine nucleotide-binding protein G(q) s... 199 2e-49 AB234091_1(AB234091|pid:none) Phaseolus lunatus PlGPA2 mRNA for ... 199 2e-49 DQ458050_1(DQ458050|pid:none) Mycosphaerella graminicola G-prote... 199 3e-49 FJ455134_1(FJ455134|pid:none) Gibberella moniliformis G protein ... 199 3e-49 L28001_1(L28001|pid:none) Rice G protein alpha-subunit (RGA1) mR... 199 3e-49 AY369812_1(AY369812|pid:none) Pan troglodytes guanine nucleotide... 198 4e-49 DQ413186_1(DQ413186|pid:none) Sepia officinalis visual iGq-alpha... 198 4e-49 AY369813_1(AY369813|pid:none) Macaca mulatta guanine nucleotide-... 198 4e-49 (Q19572) RecName: Full=Guanine nucleotide-binding protein alpha-... 198 4e-49 EU142020_1(EU142020|pid:none) Phaseolus vulgaris hetrotrimeric G... 198 5e-49 AX657506_1(AX657506|pid:none) Sequence 89 from Patent WO03000893. 198 5e-49 EU142021_1(EU142021|pid:none) Phaseolus vulgaris hetrotrimeric G... 198 5e-49 DQ156150_9(DQ156150|pid:none) Salmo salar BAC S0188I22, partial ... 198 5e-49 AJ294816_1(AJ294816|pid:none) Tapesia yallundae tyg2 gene for G ... 198 5e-49 (P49082) RecName: Full=Guanine nucleotide-binding protein alpha-... 197 6e-49 AF011342_1(AF011342|pid:none) Magnaporthe grisea G alpha subunit... 197 6e-49 AY386360_1(AY386360|pid:none) Danio rerio G-protein alpha 13a mR... 196 1e-48 AE013599_1607(AE013599|pid:none) Drosophila melanogaster chromos... 196 1e-48 FM992692_479(FM992692|pid:none) Candida dubliniensis CD36 chromo... 196 1e-48 (Q93743) RecName: Full=Guanine nucleotide-binding protein alpha-... 196 1e-48 (P34044) RecName: Full=Guanine nucleotide-binding protein alpha-... 196 2e-48 AF249742_1(AF249742|pid:none) Nicotiana tabacum heterotrimeric G... 196 2e-48 S56670(S56670;S56669)GTP-binding regulatory protein alpha chain ... 196 2e-48 AY534102_1(AY534102|pid:none) Lytechinus variegatus guanine nucl... 196 2e-48 AB006541_1(AB006541|pid:none) Hydra magnipapillata mRNA for G pr... 196 2e-48 BC095814_1(BC095814|pid:none) Danio rerio guanine nucleotide bin... 196 2e-48 AY063128_1(AY063128|pid:none) Solanum tuberosum G protein alpha ... 196 2e-48 (P26981) RecName: Full=Guanine nucleotide-binding protein alpha-... 196 2e-48 U30792_1(U30792|pid:none) Pneumocystis carinii guanine nucleotid... 195 3e-48 (P93564) RecName: Full=Guanine nucleotide-binding protein alpha-... 195 3e-48 CU640366_1097(CU640366|pid:none) Podospora anserina genomic DNA ... 195 4e-48 FJ230780_1(FJ230780|pid:none) Arthrobotrys oligospora G protein ... 194 5e-48 (P27600) RecName: Full=Guanine nucleotide-binding protein subuni... 194 7e-48 (Q40224) RecName: Full=Guanine nucleotide-binding protein alpha-... 194 7e-48 AB066594_1(AB066594|pid:none) Nicotiana tomentosiformis NtGA2t g... 194 7e-48 (Q05424) RecName: Full=Guanine nucleotide-binding protein alpha-... 194 7e-48 (Q63210) RecName: Full=Guanine nucleotide-binding protein subuni... 194 9e-48 (Q4VT31) RecName: Full=Guanine nucleotide-binding protein alpha-... 194 9e-48 (Q14344) RecName: Full=Guanine nucleotide-binding protein subuni... 193 1e-47 AF267485_1(AF267485|pid:none) Hordeum vulgare G protein alpha su... 193 1e-47 (O04279) RecName: Full=Guanine nucleotide-binding protein alpha-... 193 1e-47 AF533439_1(AF533439|pid:none) Pisum sativum G protein alpha II s... 193 1e-47 AF533438_1(AF533438|pid:none) Pisum sativum G protein alpha II s... 193 1e-47 AB066592_1(AB066592|pid:none) Nicotiana tabacum NtGA1 gene for h... 193 2e-47 DQ066424_1(DQ066424|pid:none) Caenorhabditis remanei strain EM46... 192 2e-47 (P27584) RecName: Full=Guanine nucleotide-binding protein alpha-... 192 2e-47 AF004846_1(AF004846|pid:none) Neurospora crassa G protein alpha ... 192 3e-47 CR382127_296(CR382127|pid:none) Yarrowia lipolytica strain CLIB1... 192 3e-47 BC088948_1(BC088948|pid:none) Xenopus laevis hypothetical LOC496... 192 3e-47 M14207_1(M14207|pid:none) Cow GTP-binding protein alpha-h subuni... 192 4e-47 AY292281_1(AY292281|pid:none) Synthetic construct rod transducin... 192 4e-47 (P18064) RecName: Full=Guanine nucleotide-binding protein alpha-... 192 4e-47 EF095216_1(EF095216|pid:none) Daucus carota GTP-binding protein ... 191 5e-47 (Q03113) RecName: Full=Guanine nucleotide-binding protein subuni... 191 5e-47 L33847_1(L33847|pid:none) Dictyostelium discoideum G protein alp... 191 6e-47 AK055574_1(AK055574|pid:none) Homo sapiens cDNA FLJ31012 fis, cl... 191 8e-47 AY534101_1(AY534101|pid:none) Strongylocentrotus purpuratus guan... 191 8e-47 BC134004_1(BC134004|pid:none) Danio rerio guanine nucleotide bin... 190 1e-46 AB006549_1(AB006549|pid:none) Ephydatia fluviatilis mRNA for G p... 190 1e-46 AB006550_1(AB006550|pid:none) Ephydatia fluviatilis mRNA for G p... 190 1e-46 BC087537_1(BC087537|pid:none) Homo sapiens guanine nucleotide bi... 190 1e-46 AF493901_1(AF493901|pid:none) Homo sapiens guanine nucleotide bi... 190 1e-46 CR382136_587(CR382136|pid:none) Debaryomyces hansenii strain CBS... 189 2e-46 A41106(A41106) GTP-binding protein alpha chain gpa1 - fission ye... 189 2e-46 (P27601) RecName: Full=Guanine nucleotide-binding protein subuni... 189 2e-46 AK149766_1(AK149766|pid:none) Mus musculus bone marrow macrophag... 189 2e-46 (Q61DE0) RecName: Full=Guanine nucleotide-binding protein alpha-... 189 2e-46 (P34045) RecName: Full=Guanine nucleotide-binding protein alpha-... 189 2e-46 GQ223793_1(GQ223793|pid:none) Nicotiana benthamiana heterotrimer... 189 2e-46 DQ202707_1(DQ202707|pid:none) Cricetulus griseus guanine nucleot... 188 4e-46 DQ156149_9(DQ156149|pid:none) Salmo salar clone BAC S0085O16, pa... 188 4e-46 CR382139_99(CR382139|pid:none) Debaryomyces hansenii strain CBS7... 187 7e-46 DQ156149_10(DQ156149|pid:none) Salmo salar clone BAC S0085O16, p... 187 9e-46 BC057665_1(BC057665|pid:none) Mus musculus guanine nucleotide bi... 187 1e-45 AE013599_1606(AE013599|pid:none) Drosophila melanogaster chromos... 186 2e-45 AB066591_1(AB066591|pid:none) Nicotiana tabacum NtGA2 gene for h... 186 2e-45 AY371698_1(AY371698|pid:none) Cryptococcus neoformans var. grubi... 186 2e-45 EF188807_1(EF188807|pid:none) Bombyx mori strain P50 G protein a... 184 6e-45 AF003739_2(AF003739|pid:none) Caenorhabditis elegans cosmid M01D... 184 1e-44 CP000496_1010(CP000496|pid:none) Pichia stipitis CBS 6054 chromo... 183 1e-44 CU928169_56(CU928169|pid:none) Kluyveromyces thermotolerans stra... 183 2e-44 AY634306_1(AY634306|pid:none) Caenorhabditis briggsae strain AF1... 181 5e-44 AB003486_1(AB003486|pid:none) Caenorhabditis elegans mRNA for G ... 181 6e-44 (Q7PD79) RecName: Full=Guanine nucleotide-binding protein G(s) s... 181 6e-44 (P49084) RecName: Full=Guanine nucleotide-binding protein alpha-... 180 1e-43 AY634289_1(AY634289|pid:none) Caenorhabditis briggsae strain AF1... 180 1e-43 S27015(S27015;S25590)GTP-binding regulatory protein Gs alpha cha... 180 1e-43 CP000498_625(CP000498|pid:none) Pichia stipitis CBS 6054 chromos... 179 2e-43 AE016815_371(AE016815|pid:none) Ashbya gossypii (= Eremothecium ... 179 3e-43 AL593857_10(AL593857|pid:none) Mouse DNA sequence from clone RP2... 179 3e-43 (P29797) RecName: Full=Guanine nucleotide-binding protein G(s) s... 179 3e-43 BC066923_1(BC066923|pid:none) Homo sapiens GNAS complex locus, m... 178 4e-43 DQ288161_1(DQ288161|pid:none) Mucor circinelloides GPA4 (gpa4) g... 178 4e-43 AL109840_15(AL109840|pid:none) Human DNA sequence from clone RP4... 178 4e-43 T23705(T23705)hypothetical protein M04C7.1 - Caenorhabditis eleg... 178 4e-43 (P24799) RecName: Full=Guanine nucleotide-binding protein G(s) s... 178 4e-43 (P08539) RecName: Full=Guanine nucleotide-binding protein alpha-... 177 7e-43 AE013599_3968(AE013599|pid:none) Drosophila melanogaster chromos... 177 9e-43 M17414_1(M17414|pid:none) Saccharomyces cerevisiae SCG1 gene enc... 177 9e-43 AY248719_1(AY248719|pid:none) Oryctolagus cuniculus guanine nucl... 177 9e-43 AL593857_5(AL593857|pid:none) Mouse DNA sequence from clone RP23... 177 1e-42 M13964_1(M13964|pid:none) Mouse stimulatory G protein of adenyla... 177 1e-42 AF116268_1(AF116268|pid:none) Mus musculus G-protein XLalphas mR... 177 1e-42 AF354744_1(AF354744|pid:none) Bos taurus inhibitory GTP-binding ... 176 2e-42 AY534105_1(AY534105|pid:none) Strongylocentrotus purpuratus guan... 176 2e-42 U11250_1(U11250|pid:none) Sus scrofa Gi-alpha-2 protein mRNA, pa... 176 2e-42 AE016817_554(AE016817|pid:none) Ashbya gossypii (= Eremothecium ... 176 3e-42 AL109840_3(AL109840|pid:none) Human DNA sequence from clone RP4-... 176 3e-42 AL121917_14(AL121917|pid:none) Human DNA sequence from clone RP1... 176 3e-42 AB006545_1(AB006545|pid:none) Ephydatia fluviatilis mRNA for G p... 176 3e-42 (Q292P9) RecName: Full=Guanine nucleotide-binding protein G(s) s... 175 3e-42 BC170038_1(BC170038|pid:none) Xenopus laevis GNAS complex locus,... 175 3e-42 BC085540_1(BC085540|pid:none) Danio rerio guanine nucleotide bin... 175 4e-42 CU928181_26(CU928181|pid:none) Zygosaccharomyces rouxii strain C... 174 6e-42 BC106133_1(BC106133|pid:none) Mus musculus GNAS (guanine nucleot... 174 6e-42 AK147051_1(AK147051|pid:none) Mus musculus cDNA, RIKEN full-leng... 174 6e-42 BC022875_1(BC022875|pid:none) Homo sapiens, Similar to GNAS comp... 174 8e-42 D87723(D87723)protein R06A10.2 [imported] - Caenorhabditis elegans 174 8e-42 (P25157) RecName: Full=Guanine nucleotide-binding protein subuni... 174 8e-42 CR956413_7(CR956413|pid:none) Pig DNA sequence from clone CH242-... 174 1e-41 CR380952_270(CR380952|pid:none) Candida glabrata strain CBS138 c... 174 1e-41 CR956413_6(CR956413|pid:none) Pig DNA sequence from clone CH242-... 173 2e-41 AB047087_1(AB047087|pid:none) Halocynthia roretzi HrGs mRNA for ... 172 2e-41 BC076540_1(BC076540|pid:none) Danio rerio zgc:92392, mRNA (cDNA ... 172 3e-41 AY576989_1(AY576989|pid:none) Danio rerio clone RK054A1C04 GNAS ... 172 3e-41 (O16118) RecName: Full=Guanine nucleotide-binding protein G(s) s... 172 3e-41 (Q86D96) RecName: Full=Guanine nucleotide-binding protein subuni... 172 4e-41 AB274829_1(AB274829|pid:none) Capra hircus Golf mRNA for guanine... 172 4e-41 (Q61MC6) RecName: Full=Guanine nucleotide-binding protein alpha-... 171 5e-41 (P04896) RecName: Full=Guanine nucleotide-binding protein G(s) s... 171 5e-41 (Q6R0H7) RecName: Full=Guanine nucleotide-binding protein G(s) s... 171 6e-41 (Q54VG1) RecName: Full=Guanine nucleotide-binding protein alpha-... 171 8e-41 (Q20907) RecName: Full=Guanine nucleotide-binding protein alpha-... 171 8e-41 AF010476_1(AF010476|pid:none) Avena fatua Af12-amino acid (Af12-... 171 8e-41 BC063735_1(BC063735|pid:none) Xenopus laevis hypothetical protei... 171 8e-41 BC149402_1(BC149402|pid:none) Bos taurus guanine nucleotide bind... 171 8e-41 CP001141_76(CP001141|pid:none) Phaeodactylum tricornutum CCAP 10... 170 1e-40 CQ760002_1(CQ760002|pid:none) Sequence 28 from Patent EP1382613. 170 1e-40 AL109840_2(AL109840|pid:none) Human DNA sequence from clone RP4-... 170 1e-40 AL109840_17(AL109840|pid:none) Human DNA sequence from clone RP4... 170 1e-40 BC078439_1(BC078439|pid:none) Mus musculus guanine nucleotide bi... 169 2e-40 AK158831_1(AK158831|pid:none) Mus musculus visual cortex cDNA, R... 169 2e-40 (Q63803) RecName: Full=Guanine nucleotide-binding protein G(s) s... 169 2e-40 X84047_1(X84047|pid:none) Rattus norvegicus mRNA for XLalphas pr... 169 2e-40 S52418(S52418)GTP-binding regulatory protein Gs alpha-XL chain -... 169 2e-40 AK168996_1(AK168996|pid:none) Mus musculus 17 days embryo stomac... 169 3e-40 BC050021_1(BC050021|pid:none) Homo sapiens guanine nucleotide bi... 169 3e-40 (P63093) RecName: Full=Guanine nucleotide-binding protein G(s) s... 169 3e-40 AY892114_1(AY892114|pid:none) Synthetic construct Homo sapiens c... 168 4e-40 RGMSA2(S03075) GTP-binding regulatory protein Gs alpha-S2 chain ... 168 4e-40 BC168579_1(BC168579|pid:none) Xenopus tropicalis cDNA clone MGC:... 168 5e-40 (Q4VT42) RecName: Full=Guanine nucleotide-binding protein alpha-... 168 5e-40 X07036_1(X07036|pid:none) Human mRNA stimulatory GTP-binding pro... 167 7e-40 AK159563_1(AK159563|pid:none) Mus musculus osteoclast-like cell ... 167 9e-40 CR956413_3(CR956413|pid:none) Pig DNA sequence from clone CH242-... 167 9e-40 CU928167_40(CU928167|pid:none) Kluyveromyces thermotolerans stra... 167 1e-39 (Q04665) RecName: Full=Guanine nucleotide-binding protein alpha-... 165 4e-39 AF135552_1(AF135552|pid:none) Kluyveromyces lactis heterotrimeri... 165 5e-39 FJ362364_1(FJ362364|pid:none) Caenorhabditis brenneri contig JD1... 164 6e-39 (Q9Y7B7) RecName: Full=Guanine nucleotide-binding protein alpha-... 164 8e-39 AY815795_1(AY815795|pid:none) Schistosoma japonicum SJCHGC09316 ... 164 1e-38 AB172008_1(AB172008|pid:none) Macaca fascicularis brain cDNA clo... 163 1e-38 (P30669) RecName: Full=Guanine nucleotide-binding protein G(s) s... 163 2e-38 AB006546_1(AB006546|pid:none) Ephydatia fluviatilis mRNA for G p... 162 2e-38 AB192569_1(AB192569|pid:none) Lyophyllum shimeji gpa1 gene for g... 162 2e-38 BT061033_1(BT061033|pid:none) Zea mays full-length cDNA clone ZM... 161 5e-38 A46393(A46393)GTP-binding protein alpha chain gpa2 - fission yea... 161 5e-38 DQ115329_1(DQ115329|pid:none) Caenorhabditis remanei heterotrime... 160 1e-37 T29826(T29826)hypothetical protein C55H1.2 - Caenorhabditis eleg... 160 1e-37 (Q9XZV5) RecName: Full=Guanine nucleotide-binding protein G(s) s... 159 3e-37 AL671854_10(AL671854|pid:none) Mouse DNA sequence from clone RP2... 158 6e-37 AF107844_2(AF107844|pid:none) Rattus norvegicus neuroendocrine-s... 157 7e-37 BC036081_1(BC036081|pid:none) Homo sapiens GNAS complex locus, m... 157 1e-36 FN357327_58(FN357327|pid:none) Schistosoma mansoni genome sequen... 157 1e-36 BX649295_4(BX649295|pid:none) Zebrafish DNA sequence from clone ... 156 2e-36 AK302400_1(AK302400|pid:none) Homo sapiens cDNA FLJ50732 complet... 156 2e-36 S34421(S34421;S40964) GTP-binding regulatory protein Gs alpha ch... 155 5e-36 AB006540_1(AB006540|pid:none) Hydra magnipapillata hyGa-2 mRNA f... 154 8e-36 FN357726_16(FN357726|pid:none) Schistosoma mansoni genome sequen... 153 1e-35 (Q05337) RecName: Full=Guanine nucleotide-binding protein G(f) s... 152 3e-35 Z47551_1(Z47551|pid:none) L.stagnalis G protein alpha-a subunit. 152 4e-35 U11249_1(U11249|pid:none) Sus scrofa Gi-alpha-1 protein mRNA, pa... 150 9e-35 (P52206) RecName: Full=Guanine nucleotide-binding protein subuni... 149 3e-34 AF056973_1(AF056973|pid:none) Mus musculus GTP binding protein G... 147 1e-33 AK295830_1(AK295830|pid:none) Homo sapiens cDNA FLJ55846 complet... 147 1e-33 AY724808_1(AY724808|pid:none) Anopheles gambiae G protein alpha ... 145 4e-33 U64319_1(U64319|pid:none) Dictyostelium discoideum GTP-binding p... 145 4e-33 AL121917_29(AL121917|pid:none) Human DNA sequence from clone RP1... 144 8e-33 AB220439_1(AB220439|pid:none) Macaca fascicularis mRNA, clone Qc... 144 1e-32 BC048834_1(BC048834|pid:none) Mus musculus GNAS (guanine nucleot... 143 1e-32 JH0813(JH0813)GTP-binding regulatory protein Gs alpha chain isof... 142 2e-32 (Q4VT38) RecName: Full=Guanine nucleotide-binding protein alpha-... 142 2e-32 AB435550_1(AB435550|pid:none) Carybdea rastonii cuboGs mRNA for ... 140 2e-31 FJ374687_1(FJ374687|pid:none) Spodoptera frugiperda heterotrimer... 139 2e-31 AJ310909_1(AJ310909|pid:none) Mucor racemosus partial gpa2 gene ... 139 2e-31 AY650382_1(AY650382|pid:none) Macaca fascicularis guanine nucleo... 139 3e-31 AJ879481_1(AJ879481|pid:none) Sordaria macrospora partial gna1 g... 137 1e-30 AK295088_1(AK295088|pid:none) Homo sapiens cDNA FLJ55310 complet... 137 1e-30 AB006539_1(AB006539|pid:none) Hydra magnipapillata mRNA for G pr... 136 2e-30 (Q20910) RecName: Full=Guanine nucleotide-binding protein alpha-... 135 5e-30 FN357454_4(FN357454|pid:none) Schistosoma mansoni genome sequenc... 134 7e-30 AB274882_1(AB274882|pid:none) Mauremys reevesii mRNA for guanine... 134 1e-29 AL121917_28(AL121917|pid:none) Human DNA sequence from clone RP1... 132 3e-29 AL109840_18(AL109840|pid:none) Human DNA sequence from clone RP4... 132 3e-29 AF252394_1(AF252394|pid:none) Coccidioides posadasii G protein a... 131 6e-29 AY376066_1(AY376066|pid:none) Bos taurus guanine nucleotide bind... 131 7e-29 AB435551_1(AB435551|pid:none) Carybdea rastonii cuboG12 mRNA for... 130 1e-28 AE014134_3720(AE014134|pid:none) Drosophila melanogaster chromos... 130 1e-28 AK128701_1(AK128701|pid:none) Homo sapiens cDNA FLJ46868 fis, cl... 130 1e-28 AB006544_1(AB006544|pid:none) Ephydatia fluviatilis mRNA for G p... 130 2e-28 AY724804_1(AY724804|pid:none) Anopheles gambiae G protein alpha ... 125 5e-27 AY724805_1(AY724805|pid:none) Anopheles gambiae G protein alpha ... 124 9e-27 DQ082114_1(DQ082114|pid:none) Felis catus GNAZ (GNAZ) gene, part... 124 9e-27 AL671854_12(AL671854|pid:none) Mouse DNA sequence from clone RP2... 121 6e-26 AY724803_1(AY724803|pid:none) Anopheles gambiae G protein alpha ... 120 1e-25 DQ082152_1(DQ082152|pid:none) Prionodon linsang GNAZ (GNAZ) gene... 120 2e-25 DQ223372_1(DQ223372|pid:none) Oryza officinalis IRGC seed access... 119 3e-25 DQ223335_1(DQ223335|pid:none) Oryza eichingeri IRGC seed accessi... 119 3e-25 AB066285_1(AB066285|pid:none) Ciona intestinalis CiGi2 for G pro... 119 4e-25 AB172909_1(AB172909|pid:none) Macaca fascicularis brain cDNA clo... 117 9e-25 AB066284_1(AB066284|pid:none) Ciona intestinalis CiGq for G prot... 117 9e-25 AJ563468_1(AJ563468|pid:none) Crassostrea gigas mRNA for guanine... 117 1e-24
>(P34046) RecName: Full=Guanine nucleotide-binding protein alpha-8 subunit; Short=G alpha-8; &L33848_1(L33848|pid:none) Length = 403
Score = 714 bits (1843), Expect(2) = 0.0 Identities = 351/353 (99%), Positives = 352/353 (99%) Frame = +1
Query: 247 MGCYQSRVQVEDKTNEQLDKYLVQAGKEGLLDFRILLLGAGESGKSTVVKQLKSIYKIQV 426 MGCYQSRVQVEDKTNEQLDKYLVQAGKEGLLDFRILLLGAGESGKSTVVKQLKSIYKIQV Sbjct: 1 MGCYQSRVQVEDKTNEQLDKYLVQAGKEGLLDFRILLLGAGESGKSTVVKQLKSIYKIQV 60
Query: 427 DDDELHSYTVNIHKNTVLCMQVLLEAGETLGIELTDPETKKRAINVKSFQFEPEVKQMPV 606 DDDELHSY VNIHKNTVLCMQVLLEAGETLGIELTDPETKKRAINVKSFQFEPEVKQMPV Sbjct: 61 DDDELHSYAVNIHKNTVLCMQVLLEAGETLGIELTDPETKKRAINVKSFQFEPEVKQMPV 120
Query: 607 SIGLDIEELWRDEDIQKIWDRRSEYWFLDATPYYFENIQRFLDDDFVPTEEDCIMTRVRT 786 SIGLDIEELWRDEDIQKIWDRRSEYWFLDATPYYFENIQRFLDDDFVPTEEDCIMTRVRT Sbjct: 121 SIGLDIEELWRDEDIQKIWDRRSEYWFLDATPYYFENIQRFLDDDFVPTEEDCIMTRVRT 180
Query: 787 TGISVTEFDEGPVHFRVVDVGGQRNERKKWIHCFDDVKALLFVVNLAGYDQVMFEDPSQN 966 TGISVTEFDEGPVHFRVVDVGGQRNERKKWIHCFDDVKALLFVVNLAGYDQVMFEDPSQN Sbjct: 181 TGISVTEFDEGPVHFRVVDVGGQRNERKKWIHCFDDVKALLFVVNLAGYDQVMFEDPSQN 240
Query: 967 RMQESLTLFGQICNNPIFSETPTFLVLNKKDLFEQMIQKTDLSKCFPDYKGGSDVKTALE 1146 RMQESLTLFGQICNNPIFSETPTFLVLNKKDLFEQMIQKTDLSKCFPDYKGGSDVKTALE Sbjct: 241 RMQESLTLFGQICNNPIFSETPTFLVLNKKDLFEQMIQKTDLSKCFPDYKGGSDVKTALE 300
Query: 1147 FIQMKYQQKIQESNKPLHTFHIAARYKKDIKYTWEEAKGILLEESKKVLMKAT 1305 FIQMKYQQKIQESNKPLHTFHIAARYKKDIKYTWEEAKGILLEE+KKVLMKAT Sbjct: 301 FIQMKYQQKIQESNKPLHTFHIAARYKKDIKYTWEEAKGILLEENKKVLMKAT 353
Score = 29.3 bits (64), Expect(2) = 0.0 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = +3
Query: 1350 LGNSTQXXXXXXXXXXXXXXXXGQTTIDGATA 1445 LGNSTQ GQTTIDGATA Sbjct: 368 LGNSTQNNSNNNNNNNNSNNNNGQTTIDGATA 399
Lambda K H 0.318 0.134 0.401
Gapped Lambda K H 0.267 0.0410 0.140
Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 3236559 Number of Hits to DB: 1,936,710,646 Number of extensions: 37618762 Number of successful extensions: 102288 Number of sequences better than 10.0: 927 Number of HSP's gapped: 101636 Number of HSP's successfully gapped: 956 Length of query: 504 Length of database: 1,051,180,864 Length adjustment: 133 Effective length of query: 371 Effective length of database: 620,718,517 Effective search space: 230286569807 Effective search space used: 230286569807 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 32 (16.9 bits)
|
PSORT |
|
VS (DIR, S) |
0 |
VH (FL, L) |
0 |
VF (FL, S) |
0 |
AH (FL, L) |
0 |
AF (FL, S) |
1 |
SL (DIR, L) |
1 |
SS (DIR, S) |
4 |
SH (FL, L) |
0 |
SF (FL, S) |
0 |
CH (FL, L) |
3 |
CF (FL, S) |
1 |
FCL (DIR, L) |
0 |
FC (DIR, S) |
0 |
FC-IC (SUB) |
0 |