| Contig-U11519-1 |
| Contig ID |
Contig-U11519-1 |
| Contig update |
2002.12.18 |
| Contig sequence |
 |
| Gap |
gap included |
| Contig length |
1206 |
| Chromosome number (1..6, M) |
- |
| Chromosome length |
- |
| Start point |
- |
| End point |
- |
| Strand (PLUS/MINUS) |
- |
| Number of clones |
6 |
| Number of EST |
7 |
| Link to clone list |
U11519 |
| List of clone(s) |
|
| Translated Amino Acid sequence |
|
| Translated Amino Acid sequence (All Frames) |
|
| own update |
2004. 6.10 |
| Homology vs CSM-cDNA |
|
| dna update |
2008.11.25 |
| Homology vs DNA |
Query= Contig-U11519-1 (Contig-U11519-1Q) /CSM_Contig/Contig-U11519-1Q.Seq.d
(1216 letters)
Database: ddbj_A
92,845,959 sequences; 95,242,211,685 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value N
(BJ357211) Dictyostelium discoideum cDNA clone:dda62e23, 3' ... 1037 0.0 1
(BJ421980) Dictyostelium discoideum cDNA clone:ddv44o08, 5' ... 535 0.0 3
(AC116982) Dictyostelium discoideum chromosome 2 map 3622643... 196 0.0 16
(BJ368580) Dictyostelium discoideum cDNA clone:ddc47d09, 5' ... 165 e-174 7
(BJ364890) Dictyostelium discoideum cDNA clone:ddc33j09, 5' ... 244 e-157 6
(AC117075) Dictyostelium discoideum chromosome 2 map 5201047... 355 e-134 11
(AC117176) Dictyostelium discoideum chromosome 2 map 5018074... 210 3e-80 10
(BJ368032) Dictyostelium discoideum cDNA clone:ddc45c05, 5' ... 188 8e-78 4
(BJ338735) Dictyostelium discoideum cDNA clone:dda62e23, 5' ... 105 1e-47 5
(BJ349447) Dictyostelium discoideum cDNA clone:dda36d13, 3' ... 84 2e-32 5
(BJ350963) Dictyostelium discoideum cDNA clone:dda41g18, 3' ... 84 2e-32 5
(BJ350490) Dictyostelium discoideum cDNA clone:dda40d06, 3' ... 84 2e-32 5
(AU060664) Dictyostelium discoideum slug cDNA, clone SLK832. 86 1e-29 2
(BJ385089) Dictyostelium discoideum cDNA clone:ddc51d22, 3' ... 82 8e-28 5
(BJ383803) Dictyostelium discoideum cDNA clone:ddc47d09, 3' ... 82 2e-27 5
(BJ378702) Dictyostelium discoideum cDNA clone:ddc32f17, 3' ... 84 8e-27 4
(AC116963) Dictyostelium discoideum chromosome 2 map 4657875... 90 8e-25 15
(AC116921) Dictyostelium discoideum chromosome 2 map 4624505... 56 8e-24 6
(BJ350061) Dictyostelium discoideum cDNA clone:dda38g15, 3' ... 84 4e-20 3
(BJ397495) Dictyostelium discoideum cDNA clone:dds46d13, 5' ... 103 2e-18 2
(BJ330812) Dictyostelium discoideum cDNA clone:dda32h22, 5' ... 103 2e-18 2
(BJ422444) Dictyostelium discoideum cDNA clone:ddv45n23, 5' ... 103 2e-18 2
(BJ384729) Dictyostelium discoideum cDNA clone:ddc50c17, 3' ... 84 4e-18 3
(BJ334825) Dictyostelium discoideum cDNA clone:dda47o22, 5' ... 96 4e-16 2
(BJ361963) Dictyostelium discoideum cDNA clone:ddc19b18, 5' ... 90 7e-15 2
(BJ334607) Dictyostelium discoideum cDNA clone:dda47k04, 5' ... 54 2e-11 3
(BJ365624) Dictyostelium discoideum cDNA clone:ddc36c02, 5' ... 52 8e-11 3
(AC116305) Dictyostelium discoideum chromosome 2 map 1005175... 48 5e-10 14
(BJ367734) Dictyostelium discoideum cDNA clone:ddc43e24, 5' ... 46 4e-09 3
(AC116957) Dictyostelium discoideum chromosome 2 map 1685067... 40 2e-05 19
(BJ378963) Dictyostelium discoideum cDNA clone:ddc33j09, 3' ... 40 3e-05 4
(AE017263) Mesoplasma florum L1 complete genome. 38 3e-04 20
(AC116984) Dictyostelium discoideum chromosome 2 map 2567470... 32 6e-04 21
(CR382399) Plasmodium falciparum chromosome 6, complete sequ... 46 0.001 9
(AE014822) Plasmodium falciparum 3D7 chromosome 14 section 7... 36 0.002 15
(AL844507) Plasmodium falciparum chromosome 8. 36 0.002 16
(BJ355088) Dictyostelium discoideum cDNA clone:dda55p15, 3' ... 44 0.003 2
(CU041262) Zebrafish DNA sequence *** SEQUENCING IN PROGRESS... 46 0.010 8
(AL844509) Plasmodium falciparum chromosome 13. 40 0.013 18
(CU469464) Candidatus Phytoplasma mali strain AT complete ch... 34 0.016 21
(BJ442023) Dictyostelium discoideum cDNA clone:ddv48h17, 3' ... 40 0.016 2
(CP001078) Clostridium botulinum E3 str. Alaska E43, complet... 36 0.029 20
(AC130756) Rattus norvegicus clone CH230-11K15, *** SEQUENCI... 52 0.050 1
(AC117072) Dictyostelium discoideum chromosome 2 map 3879572... 32 0.12 13
(AC116977) Dictyostelium discoideum chromosome 2 map 5515173... 30 0.14 18
(AC188519) Spermophilus tridecemlineatus clone VMRC20-442K3,... 34 0.19 6
(FH685005) CHO_OF5078xc17r1.ab1 CHO_OF5 Nicotiana tabacum ge... 50 0.20 1
(FH469326) CHO_OF4965xd19r1.ab1 CHO_OF4 Nicotiana tabacum ge... 50 0.20 1
(BJ423258) Dictyostelium discoideum cDNA clone:ddv48h17, 5' ... 50 0.20 1
(EH015996) USDA-FP_188541 Lysiphlebus testaceipes adult whol... 48 0.20 2
(EH014474) USDA-FP_187171 Lysiphlebus testaceipes adult whol... 48 0.20 2
(AU283396) Molgula tectiformis mRNA, clone:MT03B2D11T, 3' end. 38 0.23 3
(AL031745) Plasmodium falciparum DNA from MAL1P2. 34 0.23 16
(BX248115) Zebrafish DNA sequence from clone CH211-208K15 in... 34 0.26 8
(CP000246) Clostridium perfringens ATCC 13124, complete genome. 36 0.27 20
(AL929357) Plasmodium falciparum strain 3D7, chromosome 9; s... 32 0.28 14
(AY463097) Plasmodium falciparum histone acetyltransferase (... 40 0.29 4
(CJ356634) Molgula tectiformis cDNA, cleaving embryo clone:m... 38 0.31 3
(CP000123) Mycoplasma capricolum subsp. capricolum ATCC 2734... 34 0.33 20
(AY459293) Plasmodium falciparum histone acetyltransferase (... 40 0.35 4
(AL356866) Human DNA sequence from clone RP11-211D10 on chro... 36 0.41 11
(BX928752) Zebrafish DNA sequence *** SEQUENCING CANCELLED *... 36 0.41 9
(AM285304) Spiroplasma citri GII3-3X chromosome, contig Cont... 36 0.43 10
(CJ428077) Molgula tectiformis cDNA, larva clone:mtlv031k20,... 38 0.46 3
(AY498855) Plasmodium falciparum histone acetyltransferase m... 40 0.47 4
(BX293980) Mycoplasma mycoides subsp. mycoides SC str. PG1, ... 34 0.50 20
(CJ362737) Molgula tectiformis cDNA, cleaving embryo clone:m... 38 0.51 3
(AY653733) Acanthamoeba polyphaga mimivirus, complete genome. 32 0.52 23
(BA000026) Mycoplasma penetrans HF-2 DNA, complete genome. 38 0.53 22
(AC015012) Drosophila melanogaster, *** SEQUENCING IN PROGRE... 36 0.53 3
(AC072056) Homo sapiens chromosome 7 clone RP11-273F8, WORKI... 38 0.56 7
(CJ404234) Molgula tectiformis cDNA, gonad clone:mtgd009o04,... 38 0.56 3
(CJ384904) Molgula tectiformis cDNA, gastrula/neurula clone:... 38 0.56 3
(CJ384693) Molgula tectiformis cDNA, gastrula/neurula clone:... 38 0.57 3
(CJ387004) Molgula tectiformis cDNA, gastrula/neurula clone:... 38 0.58 3
(CR457482) Zebrafish DNA sequence from clone CH211-159P3 in ... 42 0.62 5
(AC215433) Solanum lycopersicum chromosome 2 clone C02HBa028... 42 0.67 7
(CR788246) Zebrafish DNA sequence *** SEQUENCING IN PROGRESS... 46 0.71 5
(AC150784) Medicago truncatula clone mth2-134j11, WORKING DR... 42 0.78 4
(CU694207) Zebrafish DNA sequence from clone ZFOS-622D1 in l... 48 0.79 1
(AC192105) Gallus gallus BAC clone CH261-50K12 from chromoso... 48 0.79 1
(AC192001) Gallus gallus BAC clone CH261-30P24 from chromoso... 48 0.79 1
(CT573078) Medicago truncatula chromosome 5 clone mte1-4f8, ... 48 0.79 1
(AC144077) Macaca mulatta clone CH250-272K15, *** SEQUENCING... 48 0.79 1
(EK412390) 1095505203682 Global-Ocean-Sampling_GS-31-01-01-1... 48 0.79 1
(EJ365321) 1092963703708 Global-Ocean-Sampling_GS-28-01-01-1... 48 0.79 1
(AJ388832) Medicago truncatula EST, clone MtNo198. 48 0.79 1
(BF601878) 266973 MARC 3BOV Bos taurus cDNA 5', mRNA sequence. 48 0.79 1
(BX897700) Bartonella quintana str. Toulouse, complete genome. 38 0.83 18
(AE014849) Plasmodium falciparum 3D7 chromosome 12, section ... 36 0.88 14
(AB360971) Culicoides actoni mitochondrial DNA, large subuni... 38 0.89 3
(AC141773) Apis mellifera clone CH224-63A8, *** SEQUENCING I... 44 1.0 5
(AC149774) Bos taurus BAC CH240-10G15 (Children's Hospital ... 38 1.0 3
(AC116551) Dictyostelium discoideum chromosome 2 map complem... 32 1.0 13
(BX248583) Blochmannia floridanus complete genome. 34 1.1 19
(AC117070) Dictyostelium discoideum chromosome 2 map 2097701... 34 1.1 11
(CN629281) taf48e07.y1 Hydra EST Darmstadt I Hydra magnipapi... 36 1.1 2
(AE014821) Plasmodium falciparum 3D7 chromosome 14 section 6... 32 1.2 13
(CU856339) S.lycopersicum DNA sequence *** SEQUENCING IN PRO... 36 1.2 5
(AC205877) Pan troglodytes BAC clone CH251-412K5 from chromo... 40 1.3 5
>(BJ357211) Dictyostelium discoideum cDNA clone:dda62e23, 3' end,
single read.
Length = 524
Score = 1037 bits (523), Expect = 0.0
Identities = 523/523 (100%)
Strand = Plus / Minus
Query: 694 ctggtatattttgcgcaatgttaggttcattatcatcattccatacaagtagtcaattag 753
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 524 ctggtatattttgcgcaatgttaggttcattatcatcattccatacaagtagtcaattag 465
Query: 754 aagtaaaagatcatatctactctttaaaatttgaatcaaaggaaccagtaataccaacat 813
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 464 aagtaaaagatcatatctactctttaaaatttgaatcaaaggaaccagtaataccaacat 405
Query: 814 tttcaacagtaacaactcatttattcaattcaaataaactatatgataatgattatattt 873
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 404 tttcaacagtaacaactcatttattcaattcaaataaactatatgataatgattatattt 345
Query: 874 ttcaaaacattatgaaacctgtattatttaatgaaacaatttcaaatctttataaacatg 933
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 344 ttcaaaacattatgaaacctgtattatttaatgaaacaatttcaaatctttataaacatg 285
Query: 934 tagaaaataatcaacttggtagtgagatgattttcattgaattggcacctcatcaaactt 993
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 284 tagaaaataatcaacttggtagtgagatgattttcattgaattggcacctcatcaaactt 225
Query: 994 tatcattttatttgaaacaattaataccaaaagattcaaattatttcagtaatagtaact 1053
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 224 tatcattttatttgaaacaattaataccaaaagattcaaattatttcagtaatagtaact 165
Query: 1054 caattacaattttatcccctcttcataaaaagaaaaatgattatttagaaattcaacaaa 1113
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 164 caattacaattttatcccctcttcataaaaagaaaaatgattatttagaaattcaacaaa 105
Query: 1114 caatttcaacttgttattgtaaaggttatgatgttaattttaaatcacagatcctcatag 1173
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 104 caatttcaacttgttattgtaaaggttatgatgttaattttaaatcacagatcctcatag 45
Query: 1174 aatctaaaacaaatatatcgaataaatctttaccactttatca 1216
|||||||||||||||||||||||||||||||||||||||||||
Sbjct: 44 aatctaaaacaaatatatcgaataaatctttaccactttatca 2
Lambda K H
1.37 0.711 1.31
Matrix: blastn matrix:1 -3
Number of Sequences: 92845959
Number of Hits to DB: 1,701,198,148
Number of extensions: 112598179
Number of successful extensions: 9380482
Number of sequences better than 10.0: 233
Length of query: 1216
Length of database: 95,242,211,685
Length adjustment: 24
Effective length of query: 1192
Effective length of database: 97,308,875,965
Effective search space: 115992180150280
Effective search space used: 115992180150280
X1: 11 (21.8 bits)
S2: 22 (44.1 bits)
|
| protein update |
2009. 6.30 |
| Homology vs Protein |
Query= Contig-U11519-1 (Contig-U11519-1Q) /CSM_Contig/Contig-U11519-1Q.Seq.d
(1216 letters)
Database: nrp_B
3,236,559 sequences; 1,051,180,864 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AC116982_22(AC116982|pid:none) Dictyostelium discoideum chromoso... 318 2e-85
AC116982_19(AC116982|pid:none) Dictyostelium discoideum chromoso... 305 2e-81
(Q54TW0) RecName: Full=Probable polyketide synthase 18; ... 289 1e-76
AC117075_22(AC117075|pid:none) Dictyostelium discoideum chromoso... 285 3e-75
AC117176_58(AC117176|pid:none) Dictyostelium discoideum chromoso... 261 5e-68
(Q54FN7) RecName: Full=Probable polyketide synthase 33; ... 249 2e-64
(Q54FC8) RecName: Full=Probable polyketide synthase 39; ... 248 2e-64
(Q54FD2) RecName: Full=Probable polyketide synthase 38; ... 248 2e-64
(Q54KU3) RecName: Full=Probable polyketide synthase 25; ... 247 5e-64
(Q54FQ3) RecName: Full=Probable polyketide synthase 29; ... 247 7e-64
(Q54KU5) RecName: Full=Probable polyketide synthase 24; ... 243 1e-62
(Q54ED6) RecName: Full=Probable polyketide synthase 41; ... 238 4e-61
AC116982_72(AC116982|pid:none) Dictyostelium discoideum chromoso... 236 9e-61
(Q54B49) RecName: Full=Probable polyketide synthase 45; ... 234 4e-60
(Q55DM7) RecName: Full=Probable polyketide synthase 2; ... 233 8e-60
AC116963_15(AC116963|pid:none) Dictyostelium discoideum chromoso... 228 3e-58
(Q54QD1) RecName: Full=Probable polyketide synthase 23; ... 221 4e-56
AC116982_20(AC116982|pid:none) Dictyostelium discoideum chromoso... 192 3e-47
AC116982_23(AC116982|pid:none) Dictyostelium discoideum chromoso... 186 2e-45
AC116982_27(AC116982|pid:none) Dictyostelium discoideum chromoso... 177 7e-43
(Q869W9) RecName: Full=Probable polyketide synthase 16; ... 175 3e-42
(Q869X2) RecName: Full=Probable polyketide synthase 17; ... 173 1e-41
CP000480_6552(CP000480|pid:none) Mycobacterium smegmatis str. MC... 140 9e-32
CP000282_3715(CP000282|pid:none) Saccharophagus degradans 2-40, ... 136 2e-30
CP000850_2328(CP000850|pid:none) Salinispora arenicola CNS-205, ... 136 2e-30
AC116957_27(AC116957|pid:none) Dictyostelium discoideum chromoso... 134 9e-30
CP001016_1096(CP001016|pid:none) Beijerinckia indica subsp. indi... 134 9e-30
AP006618_191(AP006618|pid:none) Nocardia farcinica IFM 10152 DNA... 133 1e-29
AP009493_814(AP009493|pid:none) Streptomyces griseus subsp. gris... 132 2e-29
CP001001_935(CP001001|pid:none) Methylobacterium radiotolerans J... 132 2e-29
EF028635_5(EF028635|pid:none) Lysobacter enzymogenes strain C3 H... 132 3e-29
CP000450_1933(CP000450|pid:none) Nitrosomonas eutropha C91, comp... 132 3e-29
EU569687_1(EU569687|pid:none) Pseudoalteromonas sp. NJ632 polyke... 131 6e-29
CP000511_5554(CP000511|pid:none) Mycobacterium vanbaalenii PYR-1... 131 6e-29
AY310323_18(AY310323|pid:none) Streptomyces sp. FR-008 heptaene ... 130 7e-29
BA000035_2701(BA000035|pid:none) Corynebacterium efficiens YS-31... 130 1e-28
CP000934_3129(CP000934|pid:none) Cellvibrio japonicus Ueda107, c... 129 2e-28
AY652953_1(AY652953|pid:none) Lyngbya majuscula strain 19L curac... 129 2e-28
CP000958_748(CP000958|pid:none) Burkholderia cenocepacia MC0-3 c... 129 3e-28
CP000378_295(CP000378|pid:none) Burkholderia cenocepacia AU 1054... 129 3e-28
CP000458_781(CP000458|pid:none) Burkholderia cenocepacia HI2424 ... 129 3e-28
DQ174320_1(DQ174320|pid:none) Streptomyces rimosus rimocidin syn... 129 3e-28
AL583917_101(AL583917|pid:none) Mycobacterium leprae strain TN c... 128 4e-28
AM779763_3(AM779763|pid:none) Penicillium expansum chaetoglobosi... 128 4e-28
CP000479_209(CP000479|pid:none) Mycobacterium avium 104, complet... 128 4e-28
AE016958_220(AE016958|pid:none) Mycobacterium avium subsp. parat... 128 4e-28
CP000151_689(CP000151|pid:none) Burkholderia sp. 383 chromosome ... 128 4e-28
(P12276) RecName: Full=Fatty acid synthase; EC=2.3.1.85... 128 4e-28
AM747720_3228(AM747720|pid:none) Burkholderia cenocepacia J2315 ... 128 4e-28
AE001437_3300(AE001437|pid:none) Clostridium acetobutylicum ATCC... 128 5e-28
AE000516_4052(AE000516|pid:none) Mycobacterium tuberculosis CDC1... 127 6e-28
CP000820_3029(CP000820|pid:none) Frankia sp. EAN1pec, complete g... 127 6e-28
CP001349_1882(CP001349|pid:none) Methylobacterium nodulans ORS 2... 127 6e-28
CP001503_647(CP001503|pid:none) Burkholderia glumae BGR1 chromos... 127 6e-28
AX066431_1(AX066431|pid:none) Sequence 13 from Patent WO0100805.... 127 6e-28
AM408590_3868(AM408590|pid:none) Mycobacterium bovis BCG Pasteur... 127 6e-28
BX248347_118(BX248347|pid:none) Mycobacterium bovis subsp. bovis... 127 6e-28
AC2012(AC2012) hypothetical protein all1649 [imported] - Nostoc ... 127 6e-28
CU458896_177(CU458896|pid:none) Mycobacterium abscessus chromoso... 127 6e-28
AF357202_4(AF357202|pid:none) Streptomyces nodosus amphotericin ... 127 8e-28
CP000908_1917(CP000908|pid:none) Methylobacterium extorquens PA1... 126 1e-27
AM778955_67(AM778955|pid:none) Microcystis aeruginosa PCC 7806 g... 126 2e-27
(Q71SP7) RecName: Full=Fatty acid synthase; EC=2.3.1.85... 126 2e-27
CP000511_3076(CP000511|pid:none) Mycobacterium vanbaalenii PYR-1... 125 2e-27
CP000480_6182(CP000480|pid:none) Mycobacterium smegmatis str. MC... 125 2e-27
AJ278573_3(AJ278573|pid:none) Streptomyces natalensis pimaricin ... 125 3e-27
CP000117_4713(CP000117|pid:none) Anabaena variabilis ATCC 29413,... 125 3e-27
CP000117_4082(CP000117|pid:none) Anabaena variabilis ATCC 29413,... 125 3e-27
AP009552_2780(AP009552|pid:none) Microcystis aeruginosa NIES-843... 125 4e-27
EF568935_1(EF568935|pid:none) Streptomyces lavendulae strain A1 ... 124 7e-27
U31329_1(U31329|pid:none) Aspergillus terreus putative polyketid... 124 7e-27
CP000656_1155(CP000656|pid:none) Mycobacterium gilvum PYR-GCK, c... 124 7e-27
EF552687_14(EF552687|pid:none) Streptomyces albus strain JA3453 ... 124 7e-27
AB070940_12(AB070940|pid:none) Streptomyces avermitilis oligomyc... 124 9e-27
AM902716_2323(AM902716|pid:none) Bordetella petrii strain DSM 12... 124 9e-27
AJ132222_1(AJ132222|pid:none) Streptomyces natalensis pimS1 gene... 124 9e-27
AP008957_221(AP008957|pid:none) Rhodococcus erythropolis PR4 DNA... 123 1e-26
AF217189_8(AF217189|pid:none) Sorangium cellulosum putative tran... 123 1e-26
AP009385_628(AP009385|pid:none) Burkholderia multivorans ATCC 17... 123 1e-26
CP001029_1805(CP001029|pid:none) Methylobacterium populi BJ001, ... 123 1e-26
AJ871581_38(AJ871581|pid:none) Streptomyces achromogenes subsp. ... 123 2e-26
AF188287_2(AF188287|pid:none) Stigmatella aurantiaca myxothiazol... 123 2e-26
AB070957_6(AB070957|pid:none) Streptomyces avermitilis peptide-8... 122 2e-26
AM778535_5(AM778535|pid:none) Streptomyces orinoci neoaureothin ... 122 2e-26
AE016853_4575(AE016853|pid:none) Pseudomonas syringae pv. tomato... 122 3e-26
CP000526_532(CP000526|pid:none) Burkholderia mallei SAVP1 chromo... 122 3e-26
CP001408_3359(CP001408|pid:none) Burkholderia pseudomallei MSHR3... 122 3e-26
CP000572_3224(CP000572|pid:none) Burkholderia pseudomallei 1106a... 122 3e-26
(P12785) RecName: Full=Fatty acid synthase; EC=2.3.1.85... 122 3e-26
M76767_1(M76767|pid:none) Rattus norvegicus fatty acid synthase ... 122 3e-26
AF319998_6(AF319998|pid:none) Stigmatella aurantiaca myxalamid b... 122 3e-26
(P19096) RecName: Full=Fatty acid synthase; EC=2.3.1.85... 121 4e-26
CP001503_2185(CP001503|pid:none) Burkholderia glumae BGR1 chromo... 121 4e-26
CP000384_4992(CP000384|pid:none) Mycobacterium sp. MCS, complete... 121 4e-26
AK147214_1(AK147214|pid:none) Mus musculus 15 days embryo brain ... 121 4e-26
CP000580_5341(CP000580|pid:none) Mycobacterium sp. JLS, complete... 121 4e-26
DQ272521_10(DQ272521|pid:none) Streptomyces sp. Eco86 B gene loc... 121 4e-26
AM946600_3(AM946600|pid:none) Chondromyces crocatus ajudazol bio... 121 4e-26
AY373435_7(AY373435|pid:none) Streptomyces nanchangensis strain ... 121 4e-26
AK171499_1(AK171499|pid:none) Mus musculus B6-derived CD11 +ve d... 121 4e-26
M84761_1(M84761|pid:none) Rat fatty acid synthase gene, complete... 121 4e-26
EF042286_1(EF042286|pid:none) Capra hircus fatty acid synthase (... 121 4e-26
AM850130_13(AM850130|pid:none) Stigmatella aurantiaca aurafuron ... 121 6e-26
CP001280_2660(CP001280|pid:none) Methylocella silvestris BL2, co... 121 6e-26
BA000030_420(BA000030|pid:none) Streptomyces avermitilis MA-4680... 121 6e-26
AB384663_1(AB384663|pid:none) Synthetic construct DNA, clone: pF... 121 6e-26
DQ272522_1(DQ272522|pid:none) Streptomyces sp. Eco86 B gene locu... 121 6e-26
AY451392_1(AY451392|pid:none) Homo sapiens fatty acid synthase m... 121 6e-26
G01880(G01880) fatty-acid synthase (EC 2.3.1.85) (version 2) - h... 121 6e-26
CT573213_336(CT573213|pid:none) Frankia alni str. ACN14A chromos... 121 6e-26
EU443633_23(EU443633|pid:none) Micromonospora chalcea tetrocarci... 120 7e-26
CP001037_2819(CP001037|pid:none) Nostoc punctiforme PCC 73102, c... 120 7e-26
AM238664_466(AM238664|pid:none) Streptomyces ambofaciens ATCC 23... 120 7e-26
CP000086_1328(CP000086|pid:none) Burkholderia thailandensis E264... 120 7e-26
AY310323_20(AY310323|pid:none) Streptomyces sp. FR-008 heptaene ... 120 1e-25
DQ630728_2(DQ630728|pid:none) Streptomyces albus strain CCM4719 ... 120 1e-25
AB097904_5(AB097904|pid:none) Streptomyces carzinostaticus DNA, ... 120 1e-25
CP001291_2672(CP001291|pid:none) Cyanothece sp. PCC 7424, comple... 120 1e-25
A57788(A57788;B57788) enoyl-[acyl-carrier-protein] reductase (NA... 120 1e-25
AY466441_31(AY466441|pid:none) Saccharopolyspora spinosa NRLL 18... 120 1e-25
AF217189_6(AF217189|pid:none) Sorangium cellulosum putative tran... 120 1e-25
AF188287_6(AF188287|pid:none) Stigmatella aurantiaca myxothiazol... 120 1e-25
AP009552_3857(AP009552|pid:none) Microcystis aeruginosa NIES-843... 120 1e-25
EU443633_22(EU443633|pid:none) Micromonospora chalcea tetrocarci... 120 1e-25
AB032549_1(AB032549|pid:none) Microcystis aeruginosa mcyD, mcyE,... 120 1e-25
AF183408_8(AF183408|pid:none) Microcystis aeruginosa PCC 7806 DN... 120 1e-25
AJ557546_14(AJ557546|pid:none) Melittangium lichenicola melithia... 120 1e-25
AL646053_642(AL646053|pid:none) Ralstonia solanacearum GMI1000 m... 120 1e-25
AJ639921_1(AJ639921|pid:none) Uncultured bacterium partial pks4 ... 119 2e-25
AY373435_6(AY373435|pid:none) Streptomyces nanchangensis strain ... 119 2e-25
AY834753_10(AY834753|pid:none) Cystobacter fuscus cystothiazole ... 119 2e-25
CP001614_1744(CP001614|pid:none) Teredinibacter turnerae T7901, ... 119 2e-25
AY495609_1(AY495609|pid:none) Botryotinia fuckeliana polyketide ... 119 2e-25
AM420293_4488(AM420293|pid:none) Saccharopolyspora erythraea NRR... 119 2e-25
AF210843_9(AF210843|pid:none) Sorangium cellulosum strain So ce9... 119 2e-25
AB363939_11(AB363939|pid:none) Streptomyces cyaneogriseus subsp.... 119 2e-25
U24241_7(U24241|pid:none) Sorangium cellulosum acyl-CoA dehydrog... 119 2e-25
EF397502_12(EF397502|pid:none) Salinispora tropica strain CNB-47... 119 2e-25
U78289_3(U78289|pid:none) Streptomyces fradiae tylactone synthas... 119 2e-25
AB089954_8(AB089954|pid:none) Micromonospora griseorubida gene c... 119 2e-25
CP000384_2818(CP000384|pid:none) Mycobacterium sp. MCS, complete... 119 3e-25
AB086653_5(AB086653|pid:none) Streptomyces halstedii vicenistati... 119 3e-25
AJ278573_4(AJ278573|pid:none) Streptomyces natalensis pimaricin ... 119 3e-25
AX195972_1(AX195972|pid:none) Sequence 44 from Patent WO0151639. 119 3e-25
AM850130_10(AM850130|pid:none) Stigmatella aurantiaca aurafuron ... 119 3e-25
AY899214_4(AY899214|pid:none) Streptomyces aizunensis strain NRR... 119 3e-25
AB241068_3(AB241068|pid:none) Streptomyces halstedii halstoctaco... 118 4e-25
AF263912_15(AF263912|pid:none) Streptomyces noursei ATCC 11455 n... 118 4e-25
AM408590_444(AM408590|pid:none) Mycobacterium bovis BCG Pasteur ... 118 4e-25
AB070940_9(AB070940|pid:none) Streptomyces avermitilis oligomyci... 118 4e-25
BX640432_33(BX640432|pid:none) Bordetella parapertussis strain 1... 118 4e-25
CP001037_2818(CP001037|pid:none) Nostoc punctiforme PCC 73102, c... 118 4e-25
CP001037_1898(CP001037|pid:none) Nostoc punctiforme PCC 73102, c... 118 4e-25
U24241_8(U24241|pid:none) Sorangium cellulosum acyl-CoA dehydrog... 118 4e-25
AE000516_420(AE000516|pid:none) Mycobacterium tuberculosis CDC15... 118 4e-25
AM420293_5364(AM420293|pid:none) Saccharopolyspora erythraea NRR... 118 5e-25
AJ698723_1(AJ698723|pid:none) Stigmatella aurantiaca myxochromid... 118 5e-25
CP000854_101(CP000854|pid:none) Mycobacterium marinum M, complet... 118 5e-25
CP000656_3375(CP000656|pid:none) Mycobacterium gilvum PYR-GCK, c... 118 5e-25
AB089954_11(AB089954|pid:none) Micromonospora griseorubida gene ... 118 5e-25
FM209186_2582(FM209186|pid:none) Pseudomonas aeruginosa LESB58 c... 118 5e-25
CP000854_102(CP000854|pid:none) Mycobacterium marinum M, complet... 118 5e-25
AY899214_9(AY899214|pid:none) Streptomyces aizunensis strain NRR... 118 5e-25
EU595749_7(EU595749|pid:none) Pseudomonas aeruginosa strain PACS... 118 5e-25
EF032014_6(EF032014|pid:none) Candidatus Endobugula sertula BryS... 118 5e-25
AM988861_6(AM988861|pid:none) Chondromyces crocatus chondrochlor... 117 6e-25
AY426537_1(AY426537|pid:none) Symbiont bacterium of Paederus fus... 117 6e-25
AB158460_2(AB158460|pid:none) Streptomyces halstedii hlsA, hlsB,... 117 6e-25
DQ116941_6(DQ116941|pid:none) Streptomyces antibioticus acetyltr... 117 6e-25
CP001037_1896(CP001037|pid:none) Nostoc punctiforme PCC 73102, c... 117 6e-25
CP000076_2948(CP000076|pid:none) Pseudomonas fluorescens Pf-5, c... 117 6e-25
AB431730_1(AB431730|pid:none) Streptomyces sp. ID05-A0176 gene f... 117 8e-25
CP000113_4187(CP000113|pid:none) Myxococcus xanthus DK 1622, com... 117 8e-25
CP000850_3025(CP000850|pid:none) Salinispora arenicola CNS-205, ... 117 8e-25
CP001291_1832(CP001291|pid:none) Cyanothece sp. PCC 7424, comple... 117 1e-24
AF497482_64(AF497482|pid:none) Micromonospora echinospora calich... 117 1e-24
AJ421825_10(AJ421825|pid:none) Stigmatella aurantiaca ORF8, ORF7... 117 1e-24
AL583925_89(AL583925|pid:none) Mycobacterium leprae strain TN co... 117 1e-24
AF357202_5(AF357202|pid:none) Streptomyces nodosus amphotericin ... 117 1e-24
AJ874112_9(AJ874112|pid:none) Polyangium cellulosum disA gene, d... 117 1e-24
CP001287_2900(CP001287|pid:none) Cyanothece sp. PCC 8801, comple... 116 1e-24
DQ889941_1(DQ889941|pid:none) Candidatus Endobugula sertula isol... 116 1e-24
CP000384_2820(CP000384|pid:none) Mycobacterium sp. MCS, complete... 116 1e-24
AJ580915_19(AJ580915|pid:none) Streptomyces parvulus Tu4055 clus... 116 1e-24
BX294144_103(BX294144|pid:none) Rhodopirellula baltica SH 1 comp... 116 1e-24
EF032014_5(EF032014|pid:none) Candidatus Endobugula sertula BryS... 116 1e-24
AP009493_6073(AP009493|pid:none) Streptomyces griseus subsp. gri... 116 1e-24
AP009493_6373(AP009493|pid:none) Streptomyces griseus subsp. gri... 116 2e-24
CP001601_2360(CP001601|pid:none) Corynebacterium aurimucosum ATC... 116 2e-24
AY907537_3(AY907537|pid:none) Uncultured bacterial symbiont of D... 116 2e-24
CP000943_161(CP000943|pid:none) Methylobacterium sp. 4-46, compl... 116 2e-24
AM992894_13(AM992894|pid:none) Streptomyces violaceoruber kendom... 116 2e-24
DQ351275_17(DQ351275|pid:none) Streptomyces sp. NRRL 30748 merid... 116 2e-24
(Q02251) RecName: Full=Mycocerosic acid synthase; EC=2.... 116 2e-24
CP000712_3868(CP000712|pid:none) Pseudomonas putida F1, complete... 115 2e-24
CP000850_1215(CP000850|pid:none) Salinispora arenicola CNS-205, ... 115 2e-24
AB070949_3(AB070949|pid:none) Streptomyces avermitilis polyene m... 115 2e-24
CP000698_3045(CP000698|pid:none) Geobacter uraniireducens Rf4, c... 115 2e-24
AM408590_1703(AM408590|pid:none) Mycobacterium bovis BCG Pasteur... 115 2e-24
AE000516_1749(AE000516|pid:none) Mycobacterium tuberculosis CDC1... 115 2e-24
BA000030_421(BA000030|pid:none) Streptomyces avermitilis MA-4680... 115 2e-24
CT573326_5142(CT573326|pid:none) Pseudomonas entomophila str. L4... 115 3e-24
CT573213_338(CT573213|pid:none) Frankia alni str. ACN14A chromos... 115 3e-24
B44110(B44110) mycocerosate synthase (EC 2.3.1.111) - Mycobacter... 115 3e-24
AM992894_15(AM992894|pid:none) Streptomyces violaceoruber kendom... 115 3e-24
AB435553_2(AB435553|pid:none) Streptomyces platensis pldAI, pldA... 115 3e-24
AP007172_62(AP007172|pid:none) Aspergillus oryzae RIB40 genomic ... 115 3e-24
AB032367_6(AB032367|pid:none) Streptomyces avermitilis polyketid... 115 3e-24
CP000820_3405(CP000820|pid:none) Frankia sp. EAN1pec, complete g... 115 3e-24
AC116963_16(AC116963|pid:none) Dictyostelium discoideum chromoso... 115 4e-24
CU914166_675(CU914166|pid:none) Ralstonia solanacearum strain IP... 115 4e-24
AF235504_17(AF235504|pid:none) Streptomyces hygroscopicus var. a... 115 4e-24
CP000113_3829(CP000113|pid:none) Myxococcus xanthus DK 1622, com... 115 4e-24
CP000580_2832(CP000580|pid:none) Mycobacterium sp. JLS, complete... 115 4e-24
CP000442_347(CP000442|pid:none) Burkholderia ambifaria AMMD chro... 115 4e-24
AB376516_1(AB376516|pid:none) Plesiocystis sp. SIS-2 gene for po... 115 4e-24
CP000113_4409(CP000113|pid:none) Myxococcus xanthus DK 1622, com... 115 4e-24
U52151_1(U52151|pid:none) Aspergillus parasiticus polyketide syn... 115 4e-24
AY007564_20(AY007564|pid:none) Saccharopolyspora spinosa probabl... 115 4e-24
AM179409_3(AM179409|pid:none) Chondromyces crocatus chondramide ... 115 4e-24
AY522504_15(AY522504|pid:none) Lyngbya majuscula jamaicamide bio... 114 5e-24
CP000511_3079(CP000511|pid:none) Mycobacterium vanbaalenii PYR-1... 114 5e-24
AF333038_21(AF333038|pid:none) Streptomyces viridochromogenes Av... 114 5e-24
AB435553_1(AB435553|pid:none) Streptomyces platensis pldAI, pldA... 114 5e-24
AF357202_16(AF357202|pid:none) Streptomyces nodosus amphotericin... 114 5e-24
CP000480_4563(CP000480|pid:none) Mycobacterium smegmatis str. MC... 114 5e-24
CP000854_3063(CP000854|pid:none) Mycobacterium marinum M, comple... 114 7e-24
AL939127_18(AL939127|pid:none) Streptomyces coelicolor A3(2) com... 114 7e-24
T30283(T30283) polyketide synthase - Streptomyces sp. (strain MA... 114 7e-24
AB070940_8(AB070940|pid:none) Streptomyces avermitilis oligomyci... 114 7e-24
AB431456_1(AB431456|pid:none) Streptomyces sp. ID05-A0002 gene f... 114 7e-24
AY373435_3(AY373435|pid:none) Streptomyces nanchangensis strain ... 114 7e-24
AB435553_3(AB435553|pid:none) Streptomyces platensis pldAI, pldA... 114 7e-24
AJ505006_2(AJ505006|pid:none) Sorangium cellulosum spiG gene (pa... 114 7e-24
AB070940_15(AB070940|pid:none) Streptomyces avermitilis oligomyc... 114 7e-24
DQ289495_1(DQ289495|pid:none) Synthetic construct EpoE (epoE) ge... 114 7e-24
CP000875_1864(CP000875|pid:none) Herpetosiphon aurantiacus ATCC ... 114 7e-24
CP000854_3738(CP000854|pid:none) Mycobacterium marinum M, comple... 114 7e-24
CP000384_3104(CP000384|pid:none) Mycobacterium sp. MCS, complete... 114 9e-24
CP000580_3096(CP000580|pid:none) Mycobacterium sp. JLS, complete... 114 9e-24
AB017641_1(AB017641|pid:none) Micromonospora griseorubida gene f... 114 9e-24
AM420293_2531(AM420293|pid:none) Saccharopolyspora erythraea NRR... 114 9e-24
DQ885223_4(DQ885223|pid:none) Streptomyces violaceusniger merida... 114 9e-24
AB449340_17(AB449340|pid:none) Streptomyces lasaliensis plasmid ... 114 9e-24
AJ871581_7(AJ871581|pid:none) Streptomyces achromogenes subsp. r... 114 9e-24
T30225(T30225) polyketide synthase - Streptomyces hygroscopicus ... 114 9e-24
DQ351275_18(DQ351275|pid:none) Streptomyces sp. NRRL 30748 merid... 113 1e-23
CP001037_2985(CP001037|pid:none) Nostoc punctiforme PCC 73102, c... 113 1e-23
BA000045_1944(BA000045|pid:none) Gloeobacter violaceus PCC 7421 ... 113 1e-23
GQ166664_1(GQ166664|pid:none) Actinoplanes sp. N902-109 polyketi... 113 1e-23
AM420293_2550(AM420293|pid:none) Saccharopolyspora erythraea NRR... 113 1e-23
AB431227_1(AB431227|pid:none) Streptomyces abikoensis gene for p... 113 1e-23
CP000820_3541(CP000820|pid:none) Frankia sp. EAN1pec, complete g... 113 1e-23
AB241068_7(AB241068|pid:none) Streptomyces halstedii halstoctaco... 113 1e-23
AB431035_1(AB431035|pid:none) Streptomyces kitasatoensis gene fo... 113 1e-23
AB070940_10(AB070940|pid:none) Streptomyces avermitilis oligomyc... 113 1e-23
AJ441056_3(AJ441056|pid:none) Planktothrix agardhii microcystin ... 113 1e-23
CP000325_1676(CP000325|pid:none) Mycobacterium ulcerans Agy99, c... 113 1e-23
CP000875_2400(CP000875|pid:none) Herpetosiphon aurantiacus ATCC ... 113 2e-23
AL939125_142(AL939125|pid:none) Streptomyces coelicolor A3(2) co... 113 2e-23
AJ223012_2(AJ223012|pid:none) Amycolatopsis mediterranei genes e... 113 2e-23
AF040570_22(AF040570|pid:none) Amycolatopsis mediterranei rifamy... 113 2e-23
AP009384_36(AP009384|pid:none) Azorhizobium caulinodans ORS 571 ... 113 2e-23
AM850130_11(AM850130|pid:none) Stigmatella aurantiaca aurafuron ... 113 2e-23
AF040570_21(AF040570|pid:none) Amycolatopsis mediterranei rifamy... 113 2e-23
AF007101_2(AF007101|pid:none) Streptomyces hygroscopicus putativ... 113 2e-23
AB431649_1(AB431649|pid:none) Streptomyces sp. ID05-A0096 gene f... 113 2e-23
AP011115_4155(AP011115|pid:none) Rhodococcus opacus B4 DNA, comp... 113 2e-23
AF440781_17(AF440781|pid:none) Streptomyces cinnamonensis polyet... 113 2e-23
AY899214_2(AY899214|pid:none) Streptomyces aizunensis strain NRR... 113 2e-23
DQ885223_3(DQ885223|pid:none) Streptomyces violaceusniger merida... 113 2e-23
CP000820_3406(CP000820|pid:none) Frankia sp. EAN1pec, complete g... 113 2e-23
AB431753_1(AB431753|pid:none) Streptomyces sp. ID05-A0208 gene f... 113 2e-23
AY623658_24(AY623658|pid:none) Aeromicrobium erythreum putative ... 113 2e-23
DQ897667_10(DQ897667|pid:none) Polyangium cellulosum strain So c... 112 2e-23
T30226(T30226) polyketide synthase - Streptomyces hygroscopicus ... 112 2e-23
CP000580_2831(CP000580|pid:none) Mycobacterium sp. JLS, complete... 112 2e-23
AF007101_4(AF007101|pid:none) Streptomyces hygroscopicus putativ... 112 2e-23
AM408590_1246(AM408590|pid:none) Mycobacterium bovis BCG Pasteur... 112 2e-23
AF263912_14(AF263912|pid:none) Streptomyces noursei ATCC 11455 n... 112 2e-23
EU301739_27(EU301739|pid:none) Actinomadura kijaniata fructokina... 112 2e-23
AB431830_1(AB431830|pid:none) Streptomyces sp. ID05-A0252 gene f... 112 2e-23
BX842575_261(BX842575|pid:none) Mycobacterium tuberculosis H37Rv... 112 2e-23
FM173265_22(FM173265|pid:none) Streptomyces lasaliensis lasaloci... 112 2e-23
AY495658_1(AY495658|pid:none) Cochliobolus heterostrophus polyke... 112 2e-23
AY652953_13(AY652953|pid:none) Lyngbya majuscula strain 19L cura... 112 2e-23
AE000516_1256(AE000516|pid:none) Mycobacterium tuberculosis CDC1... 112 2e-23
AL935186_8(AL935186|pid:none) Zebrafish DNA sequence from clone ... 112 2e-23
AB241068_6(AB241068|pid:none) Streptomyces halstedii halstoctaco... 112 2e-23
AM778535_8(AM778535|pid:none) Streptomyces orinoci neoaureothin ... 112 2e-23
CP000325_1664(CP000325|pid:none) Mycobacterium ulcerans Agy99, c... 112 2e-23
AM930232_1(AM930232|pid:none) Botrytis cinerea pks6 gene for pol... 112 2e-23
AP008955_3987(AP008955|pid:none) Brevibacillus brevis NBRC 10059... 112 3e-23
AM746676_4143(AM746676|pid:none) Sorangium cellulosum 'So ce 56'... 112 3e-23
AP009493_6181(AP009493|pid:none) Streptomyces griseus subsp. gri... 112 3e-23
EU220288_3(EU220288|pid:none) Streptomyces eurythermus strain AT... 112 3e-23
AB449340_15(AB449340|pid:none) Streptomyces lasaliensis plasmid ... 112 3e-23
CP000806_3757(CP000806|pid:none) Cyanothece sp. ATCC 51142 circu... 112 3e-23
DQ351275_19(DQ351275|pid:none) Streptomyces sp. NRRL 30748 merid... 112 3e-23
AY196994_1(AY196994|pid:none) Streptomyces griseoruber heda clus... 112 3e-23
CP000384_2819(CP000384|pid:none) Mycobacterium sp. MCS, complete... 112 3e-23
AJ704622_1(AJ704622|pid:none) Magnaporthe grisea ace1 gene for p... 112 3e-23
FM173265_18(FM173265|pid:none) Streptomyces lasaliensis lasaloci... 112 3e-23
AF016585_4(AF016585|pid:none) Streptomyces caelestis cytochrome ... 112 3e-23
FJ872525_9(FJ872525|pid:none) Streptomyces sp. MP39-85 putative ... 112 3e-23
AY423269_2(AY423269|pid:none) Streptomyces diastaticus 108 cytoc... 112 3e-23
CP000854_2322(CP000854|pid:none) Mycobacterium marinum M, comple... 112 3e-23
FM173265_16(FM173265|pid:none) Streptomyces lasaliensis lasaloci... 112 3e-23
AL583917_135(AL583917|pid:none) Mycobacterium leprae strain TN c... 112 3e-23
E69679(E69679)polyketide synthetase pksP [similarity] - Bacillus... 112 3e-23
Z99113_3(Z99113|pid:none) Bacillus subtilis complete genome (sec... 112 3e-23
EF990140_11(EF990140|pid:none) Streptomyces spiroverticillatus c... 112 3e-23
A70984(A70984) probable polyketide synthase - Mycobacterium tube... 112 3e-23
AB431457_1(AB431457|pid:none) Streptomyces sp. ID05-A0002 gene f... 111 5e-23
CP000573_1381(CP000573|pid:none) Burkholderia pseudomallei 1106a... 111 5e-23
AF016585_6(AF016585|pid:none) Streptomyces caelestis cytochrome ... 111 5e-23
CP000545_436(CP000545|pid:none) Burkholderia mallei NCTC 10229 c... 111 5e-23
CP000571_1468(CP000571|pid:none) Burkholderia pseudomallei 668 c... 111 5e-23
CP000125_2608(CP000125|pid:none) Burkholderia pseudomallei 1710b... 111 5e-23
CP000547_1111(CP000547|pid:none) Burkholderia mallei NCTC 10247 ... 111 5e-23
FJ477836_8(FJ477836|pid:none) Oscillatoria sp. PCC 6506 anatoxin... 111 5e-23
AB193609_7(AB193609|pid:none) Streptomyces sp. NRRL 11266 tetron... 111 5e-23
CT573213_3367(CT573213|pid:none) Frankia alni str. ACN14A chromo... 111 5e-23
CP000525_163(CP000525|pid:none) Burkholderia mallei SAVP1 chromo... 111 5e-23
T30228(T30228) polyketide synthase - Streptomyces hygroscopicus ... 111 5e-23
CP000580_3449(CP000580|pid:none) Mycobacterium sp. JLS, complete... 111 5e-23
CP000667_2737(CP000667|pid:none) Salinispora tropica CNB-440, co... 111 5e-23
AM850130_9(AM850130|pid:none) Stigmatella aurantiaca aurafuron b... 111 5e-23
AF040570_23(AF040570|pid:none) Amycolatopsis mediterranei rifamy... 111 5e-23
AB430969_1(AB430969|pid:none) Streptomyces netropsis gene for po... 111 5e-23
CT573213_2489(CT573213|pid:none) Frankia alni str. ACN14A chromo... 111 6e-23
AL009126_1775(AL009126|pid:none) Bacillus subtilis subsp. subtil... 111 6e-23
AB431447_1(AB431447|pid:none) Streptomyces stramineus gene for p... 111 6e-23
CP001037_1897(CP001037|pid:none) Nostoc punctiforme PCC 73102, c... 111 6e-23
AB431882_1(AB431882|pid:none) Streptomyces sp. ID05-A0327 gene f... 111 6e-23
DQ450945_2(DQ450945|pid:none) Streptomyces sp. 98-62 polyketide ... 111 6e-23
GQ166673_1(GQ166673|pid:none) Actinoplanes sp. N902-109 clone 10... 111 6e-23
CP000850_3024(CP000850|pid:none) Salinispora arenicola CNS-205, ... 111 6e-23
AB070949_7(AB070949|pid:none) Streptomyces avermitilis polyene m... 111 6e-23
A69679(A69679) polyketide synthase pksK - Bacillus subtilis &U1... 111 6e-23
AL583921_77(AL583921|pid:none) Mycobacterium leprae strain TN co... 111 6e-23
AB431376_1(AB431376|pid:none) Streptomyces kobenensis gene for p... 111 6e-23
CP001037_2824(CP001037|pid:none) Nostoc punctiforme PCC 73102, c... 111 6e-23
CP000384_3457(CP000384|pid:none) Mycobacterium sp. MCS, complete... 111 6e-23
CP000113_3827(CP000113|pid:none) Myxococcus xanthus DK 1622, com... 110 8e-23
AF082100_3(AF082100|pid:none) Streptomyces sp. MA6548 FK506 pept... 110 8e-23
AB432053_1(AB432053|pid:none) Streptomyces sp. ID05-A0426 gene f... 110 8e-23
EU220288_2(EU220288|pid:none) Streptomyces eurythermus strain AT... 110 8e-23
BX005238_11(BX005238|pid:none) Zebrafish DNA sequence from clone... 110 8e-23
AJ634061_4(AJ634061|pid:none) Bacillus amyloliquefaciens pks2 ge... 110 8e-23
CP000560_1351(CP000560|pid:none) Bacillus amyloliquefaciens FZB4... 110 8e-23
AF319998_9(AF319998|pid:none) Stigmatella aurantiaca myxalamid b... 110 8e-23
AY899214_10(AY899214|pid:none) Streptomyces aizunensis strain NR... 110 8e-23
AM420293_4053(AM420293|pid:none) Saccharopolyspora erythraea NRR... 110 8e-23
CP000820_3810(CP000820|pid:none) Frankia sp. EAN1pec, complete g... 110 8e-23
AM238664_270(AM238664|pid:none) Streptomyces ambofaciens ATCC 23... 110 8e-23
AJ704623_1(AJ704623|pid:none) Magnaporthe grisea syn2 gene for p... 110 8e-23
CP000431_4186(CP000431|pid:none) Rhodococcus jostii RHA1, comple... 110 1e-22
AM778535_10(AM778535|pid:none) Streptomyces orinoci neoaureothin... 110 1e-22
DQ272520_5(DQ272520|pid:none) Streptomyces aculeolatus A gene lo... 110 1e-22
AJ557546_10(AJ557546|pid:none) Melittangium lichenicola melithia... 110 1e-22
CP000667_2725(CP000667|pid:none) Salinispora tropica CNB-440, co... 110 1e-22
AF079138_3(AF079138|pid:none) Streptomyces venezuelae methymycin... 110 1e-22
AP009493_6077(AP009493|pid:none) Streptomyces griseus subsp. gri... 110 1e-22
Z81523_9(Z81523|pid:none) Caenorhabditis elegans Cosmid F32H2, c... 110 1e-22
AM238664_468(AM238664|pid:none) Streptomyces ambofaciens ATCC 23... 110 1e-22
AB431958_1(AB431958|pid:none) Nocardia sp. ID05-A0382 gene for p... 110 1e-22
AB430945_1(AB430945|pid:none) Streptomyces hygroscopicus subsp. ... 110 1e-22
CU633872_241(CU633872|pid:none) Podospora anserina genomic DNA c... 110 1e-22
CT573213_3981(CT573213|pid:none) Frankia alni str. ACN14A chromo... 110 1e-22
AB431850_1(AB431850|pid:none) Streptomyces sp. ID05-A0263 gene f... 110 1e-22
T21676(T21676)hypothetical protein F32H2.5 - Caenorhabditis eleg... 110 1e-22
CP001348_847(CP001348|pid:none) Clostridium cellulolyticum H10, ... 110 1e-22
CP001344_2632(CP001344|pid:none) Cyanothece sp. PCC 7425, comple... 110 1e-22
AB070949_5(AB070949|pid:none) Streptomyces avermitilis polyene m... 110 1e-22
AJ634060_12(AJ634060|pid:none) Bacillus amyloliquefaciens bae ge... 110 1e-22
AM920431_1393(AM920431|pid:none) Penicillium chrysogenum Wiscons... 110 1e-22
AE014134_574(AE014134|pid:none) Drosophila melanogaster chromoso... 110 1e-22
CP000738_196(CP000738|pid:none) Sinorhizobium medicae WSM419, co... 110 1e-22
AY210783_11(AY210783|pid:none) Nodularia spumigena strain NSOR10... 110 1e-22
AB431427_1(AB431427|pid:none) Streptomyces humidus subsp. antitu... 110 1e-22
CP000667_2735(CP000667|pid:none) Salinispora tropica CNB-440, co... 110 1e-22
FJ872523_17(FJ872523|pid:none) Streptomyces sp. DSM 21069 putati... 110 1e-22
AE014134_573(AE014134|pid:none) Drosophila melanogaster chromoso... 110 1e-22
AP009493_6182(AP009493|pid:none) Streptomyces griseus subsp. gri... 110 1e-22
DQ019316_7(DQ019316|pid:none) Gibberella zeae aldehyde dehydroge... 110 1e-22
DQ897668_8(DQ897668|pid:none) Polyangium cellulosum strain So ce... 110 1e-22
DQ272520_4(DQ272520|pid:none) Streptomyces aculeolatus A gene lo... 110 1e-22
CP001287_2899(CP001287|pid:none) Cyanothece sp. PCC 8801, comple... 110 1e-22
AF144049_1(AF144049|pid:none) Streptomyces griseus macrolide typ... 110 1e-22
AF521085_26(AF521085|pid:none) Streptomyces nanchangensis NS3226... 110 1e-22
DQ897667_14(DQ897667|pid:none) Polyangium cellulosum strain So c... 110 1e-22
AB086653_7(AB086653|pid:none) Streptomyces halstedii vicenistati... 110 1e-22
AE000516_3123(AE000516|pid:none) Mycobacterium tuberculosis CDC1... 110 1e-22
BX842581_136(BX842581|pid:none) Mycobacterium tuberculosis H37Rv... 110 1e-22
CP000085_2079(CP000085|pid:none) Burkholderia thailandensis E264... 110 1e-22
AB2012(AB2012) hypothetical protein all1648 [imported] - Nostoc ... 110 1e-22
U00024_22(U00024|pid:none) Mycobacterium tuberculosis cosmid tbc2. 110 1e-22
CP000850_1217(CP000850|pid:none) Salinispora arenicola CNS-205, ... 110 1e-22
AY509120_23(AY509120|pid:none) Streptomyces bikiniensis strain N... 110 1e-22
AJ580915_16(AJ580915|pid:none) Streptomyces parvulus Tu4055 clus... 109 2e-22
AB032367_5(AB032367|pid:none) Streptomyces avermitilis polyketid... 109 2e-22
AF453501_32(AF453501|pid:none) Actinosynnema pretiosum subsp. au... 109 2e-22
AY899214_3(AY899214|pid:none) Streptomyces aizunensis strain NRR... 109 2e-22
AY899214_8(AY899214|pid:none) Streptomyces aizunensis strain NRR... 109 2e-22
AF144048_1(AF144048|pid:none) Streptomyces flavopersicus macroli... 109 2e-22
AF319998_5(AF319998|pid:none) Stigmatella aurantiaca myxalamid b... 109 2e-22
AJ505006_1(AJ505006|pid:none) Sorangium cellulosum spiG gene (pa... 109 2e-22
AB431672_1(AB431672|pid:none) Streptomyces sp. ID05-A0130 gene f... 109 2e-22
AB279593_12(AB279593|pid:none) Microcystis aeruginosa new nonrib... 109 2e-22
AB431962_1(AB431962|pid:none) Streptomyces sp. ID05-A0384 gene f... 109 2e-22
AM420293_5192(AM420293|pid:none) Saccharopolyspora erythraea NRR... 109 2e-22
AJ132221_1(AJ132221|pid:none) Streptomyces natalensis pimS0 gene... 109 2e-22
CP000325_1678(CP000325|pid:none) Mycobacterium ulcerans Agy99, c... 109 2e-22
S23070(S23070;S22011;S23205)erythronolide synthase (EC 2.3.1.94)... 109 2e-22
DQ249342_4(DQ249342|pid:none) Streptomyces hygroscopicus subsp. ... 109 2e-22
A87204(A87204) polyketide synthase [imported] - Mycobacterium le... 109 2e-22
DQ272520_6(DQ272520|pid:none) Streptomyces aculeolatus A gene lo... 109 2e-22
CP000854_1754(CP000854|pid:none) Mycobacterium marinum M, comple... 109 2e-22
AB431957_1(AB431957|pid:none) Streptomyces sp. ID05-A0380 gene f... 109 2e-22
AB432019_1(AB432019|pid:none) Streptomyces sp. ID05-A0410 gene f... 109 2e-22
AF016585_2(AF016585|pid:none) Streptomyces caelestis cytochrome ... 109 2e-22
AB431709_1(AB431709|pid:none) Streptomyces sp. ID05-A0157 gene f... 109 2e-22
AY466441_29(AY466441|pid:none) Saccharopolyspora spinosa NRLL 18... 109 2e-22
AB435553_4(AB435553|pid:none) Streptomyces platensis pldAI, pldA... 109 2e-22
AB431706_1(AB431706|pid:none) Streptomyces sp. ID05-A0157 gene f... 109 2e-22
DQ354110_6(DQ354110|pid:none) Streptomyces violaceusniger strain... 109 2e-22
DQ885223_2(DQ885223|pid:none) Streptomyces violaceusniger merida... 109 2e-22
AM420293_4055(AM420293|pid:none) Saccharopolyspora erythraea NRR... 109 2e-22
CP000854_2451(CP000854|pid:none) Mycobacterium marinum M, comple... 109 2e-22
AB431876_1(AB431876|pid:none) Streptomyces sp. ID05-A0316 gene f... 109 2e-22
AB431052_1(AB431052|pid:none) Streptomyces hygroscopicus subsp. ... 109 2e-22
AM920431_37(AM920431|pid:none) Penicillium chrysogenum Wisconsin... 109 2e-22
FJ872523_5(FJ872523|pid:none) Streptomyces sp. DSM 21069 putativ... 108 3e-22
AB431794_1(AB431794|pid:none) Streptomyces sp. ID05-A0222 gene f... 108 3e-22
AB431201_1(AB431201|pid:none) Streptomyces felleus gene for poly... 108 3e-22
AY466441_30(AY466441|pid:none) Saccharopolyspora spinosa NRLL 18... 108 3e-22
AM420293_4220(AM420293|pid:none) Saccharopolyspora erythraea NRR... 108 3e-22
AB431273_1(AB431273|pid:none) Streptomyces aureofaciens gene for... 108 3e-22
CP000479_2340(CP000479|pid:none) Mycobacterium avium 104, comple... 108 3e-22
AB432273_1(AB432273|pid:none) Streptomyces sp. ID05-A0919 gene f... 108 3e-22
AM238664_478(AM238664|pid:none) Streptomyces ambofaciens ATCC 23... 108 3e-22
DQ020253_1(DQ020253|pid:none) Streptomyces sp. UNSW 094300 type ... 108 3e-22
AJ421825_14(AJ421825|pid:none) Stigmatella aurantiaca ORF8, ORF7... 108 3e-22
AM270241_33(AM270241|pid:none) Aspergillus niger contig An11c024... 108 3e-22
AE016958_1796(AE016958|pid:none) Mycobacterium avium subsp. para... 108 3e-22
CP001389_205(CP001389|pid:none) Rhizobium sp. NGR234, complete g... 108 3e-22
CP000318_69(CP000318|pid:none) Polaromonas sp. JS666 plasmid 2, ... 108 3e-22
AB430966_1(AB430966|pid:none) Streptomyces cinnamoneus subsp. sp... 108 3e-22
AB431329_1(AB431329|pid:none) Streptomyces sp. NBRC 3361 gene fo... 108 3e-22
AJ421825_15(AJ421825|pid:none) Stigmatella aurantiaca ORF8, ORF7... 108 3e-22
AY118081_23(AY118081|pid:none) Streptomyces sp. KCTC 0041BP dihy... 108 3e-22
AB431682_1(AB431682|pid:none) Streptomyces sp. ID05-A0139 gene f... 108 3e-22
AP009493_6180(AP009493|pid:none) Streptomyces griseus subsp. gri... 108 3e-22
AB193609_15(AB193609|pid:none) Streptomyces sp. NRRL 11266 tetro... 108 3e-22
CP000117_4716(CP000117|pid:none) Anabaena variabilis ATCC 29413,... 108 3e-22
AB431883_1(AB431883|pid:none) Streptomyces sp. ID05-A0327 gene f... 108 3e-22
AY118081_25(AY118081|pid:none) Streptomyces sp. KCTC 0041BP dihy... 108 3e-22
AB431199_1(AB431199|pid:none) Streptomyces felleus gene for poly... 108 3e-22
CP000854_3062(CP000854|pid:none) Mycobacterium marinum M, comple... 108 3e-22
DQ116941_31(DQ116941|pid:none) Streptomyces antibioticus acetylt... 108 4e-22
AB430942_1(AB430942|pid:none) Streptomyces eurocidicus gene for ... 108 4e-22
AB431106_1(AB431106|pid:none) Streptomyces nodosus subsp. asukae... 108 4e-22
AB431959_1(AB431959|pid:none) Nocardia sp. ID05-A0382 gene for p... 108 4e-22
DQ897667_18(DQ897667|pid:none) Polyangium cellulosum strain So c... 108 4e-22
AB432208_1(AB432208|pid:none) Streptomyces sp. ID05-A0491 gene f... 108 4e-22
(A5U9F4) RecName: Full=Phthioceranic/hydroxyphthioceranic acid s... 108 4e-22
CP001348_846(CP001348|pid:none) Clostridium cellulolyticum H10, ... 108 4e-22
DQ065771_3(DQ065771|pid:none) Polyangium cellulosum hypothetical... 108 4e-22
AB431073_1(AB431073|pid:none) Streptomyces sp. NBRC 13838 gene f... 108 4e-22
AB432097_1(AB432097|pid:none) Streptomyces sp. ID05-A0444 gene f... 108 4e-22
AB431409_1(AB431409|pid:none) Streptomyces cinnamoneus subsp. sp... 108 4e-22
AY495629_1(AY495629|pid:none) Gibberella zeae polyketide synthas... 108 4e-22
CP001348_951(CP001348|pid:none) Clostridium cellulolyticum H10, ... 108 4e-22
AF440781_26(AF440781|pid:none) Streptomyces cinnamonensis polyet... 108 4e-22
GQ166683_1(GQ166683|pid:none) Actinoplanes sp. N902-109 clone 20... 108 4e-22
CP000112_1605(CP000112|pid:none) Desulfovibrio desulfuricans G20... 108 4e-22
CP000249_979(CP000249|pid:none) Frankia sp. CcI3, complete genome. 108 4e-22
AF202898_1(AF202898|pid:none) Streptomyces coelicolor A3(2) type... 108 4e-22
CP000854_98(CP000854|pid:none) Mycobacterium marinum M, complete... 108 4e-22
AB431984_1(AB431984|pid:none) Streptomyces sp. ID05-A0395 gene f... 108 5e-22
AM420293_2558(AM420293|pid:none) Saccharopolyspora erythraea NRR... 108 5e-22
AB431969_1(AB431969|pid:none) Nonomuraea sp. ID05-A0390 gene for... 108 5e-22
AB431019_1(AB431019|pid:none) Streptomyces hygroscopicus subsp. ... 108 5e-22
AB431777_1(AB431777|pid:none) Streptomyces sp. ID05-A0215 gene f... 108 5e-22
AY495613_1(AY495613|pid:none) Botryotinia fuckeliana polyketide ... 108 5e-22
BX294154_97(BX294154|pid:none) Rhodopirellula baltica SH 1 compl... 108 5e-22
AB431861_1(AB431861|pid:none) Streptomyces sp. ID05-A0268 gene f... 108 5e-22
DQ149987_4(DQ149987|pid:none) Streptomyces neyagawaensis concana... 108 5e-22
AM778952_15(AM778952|pid:none) Microcystis aeruginosa PCC 7806 g... 108 5e-22
DQ149987_8(DQ149987|pid:none) Streptomyces neyagawaensis concana... 108 5e-22
AF183408_7(AF183408|pid:none) Microcystis aeruginosa PCC 7806 DN... 108 5e-22
(Q03133) RecName: Full=Erythronolide synthase, modules 5 and 6; ... 107 7e-22
AF440781_15(AF440781|pid:none) Streptomyces cinnamonensis polyet... 107 7e-22
M63677_2(M63677|pid:none) S.erythraea second and third ORF's of ... 107 7e-22
AJ634061_5(AJ634061|pid:none) Bacillus amyloliquefaciens pks2 ge... 107 7e-22
AB431629_1(AB431629|pid:none) Streptomyces sp. ID05-A0082 gene f... 107 7e-22
AB432063_1(AB432063|pid:none) Nocardia sp. ID05-A0430 gene for p... 107 7e-22
DQ176871_14(DQ176871|pid:none) Streptomyces aureofaciens strain ... 107 7e-22
FJ872525_4(FJ872525|pid:none) Streptomyces sp. MP39-85 putative ... 107 7e-22
>AC116982_22(AC116982|pid:none) Dictyostelium discoideum chromosome
2 map 3622643-3879522 strain AX4, complete sequence.
Length = 215
Score = 318 bits (816), Expect = 2e-85
Identities = 157/204 (76%), Positives = 175/204 (85%)
Frame = +2
Query: 62 MNNFKNINLIEKGVAIVGIGFRLPSGDLSKSNDSTKELWNNLMNGFDGVVKTTERWSDNF 241
MNNFKNINLIEKGVAIVGIGFR+PSG+ S S +L+NNL NGFDGV T+ERWSDNF
Sbjct: 1 MNNFKNINLIEKGVAIVGIGFRIPSGNNENSISSPDDLFNNLKNGFDGVSSTSERWSDNF 60
Query: 242 NELGEISNGNAGLLPFNECKSFDPLFFGINPSEVSTIDPQQRLLLKCTWEALEDAGIDPI 421
++LGEIS+ NAGLLPFNECKSFDPLFFGINPSE IDPQQRLLLKCTWEALEDA IDPI
Sbjct: 61 HKLGEISSPNAGLLPFNECKSFDPLFFGINPSEAPLIDPQQRLLLKCTWEALEDASIDPI 120
Query: 422 SIRGSNTSVFIGSSNIDYKDISKNPNSTQTNVFGSALSTIANRISHCFDFSGESITIDTA 601
SIRG+NTSVFIGSSNIDY +K+ +S NV + I+NRIS+CFDF+G S++IDTA
Sbjct: 121 SIRGTNTSVFIGSSNIDYLHTNKHQDSVLKNVIAQSTCAISNRISYCFDFNGPSLSIDTA 180
Query: 602 CSSSLNAISQGYHSILNGTSDISI 673
CSSSLNAISQGYHSILNGTSDISI
Sbjct: 181 CSSSLNAISQGYHSILNGTSDISI 204
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3236559
Number of Hits to DB: 1,763,863,699
Number of extensions: 35957535
Number of successful extensions: 94260
Number of sequences better than 10.0: 2770
Number of HSP's gapped: 90752
Number of HSP's successfully gapped: 3561
Length of query: 405
Length of database: 1,051,180,864
Length adjustment: 131
Effective length of query: 274
Effective length of database: 627,191,635
Effective search space: 171850507990
Effective search space used: 171850507990
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 32 (16.9 bits)
|
| PSORT |
|
| VS (DIR, S) |
0 |
| VH (FL, L) |
1 |
| VF (FL, S) |
0 |
| AH (FL, L) |
1 |
| AF (FL, S) |
0 |
| SL (DIR, L) |
1 |
| SS (DIR, S) |
0 |
| SH (FL, L) |
0 |
| SF (FL, S) |
0 |
| CH (FL, L) |
3 |
| CF (FL, S) |
0 |
| FCL (DIR, L) |
0 |
| FC (DIR, S) |
0 |
| FC-IC (SUB) |
0 |