| Homology vs DNA |
 Query= Contig-U11484-1 (Contig-U11484-1Q) /CSM_Contig/Contig-U11484-1Q.Seq.d
(1417 letters)
Database: ddbj_A
92,845,959 sequences; 95,242,211,685 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value N
(AC116977) Dictyostelium discoideum chromosome 2 map 5515173... 1479 0.0 1
(BJ446438) Dictyostelium discoideum cDNA clone:ddv62a21, 3' ... 1479 0.0 1
(BJ339873) Dictyostelium discoideum cDNA clone:dda10b20, 3' ... 1427 0.0 1
(BJ355545) Dictyostelium discoideum cDNA clone:dda57o07, 3' ... 1291 0.0 1
(BJ337438) Dictyostelium discoideum cDNA clone:dda57o07, 5' ... 1179 0.0 1
(AC116551) Dictyostelium discoideum chromosome 2 map complem... 52 2e-21 5
(AL407525) T3 end of clone AV0AA001G11 of library AV0AA from... 56 6e-19 4
(EA397561) Sequence 46385 from patent US 7314974. 66 6e-18 4
(BH156390) ENTRO94TR Entamoeba histolytica Sheared DNA Entam... 72 2e-14 3
(BH135523) ENTOA18TR Entamoeba histolytica Sheared DNA Entam... 72 2e-14 3
(AZ685007) ENTKA46TF Entamoeba histolytica Sheared DNA Entam... 72 2e-14 3
(CU329672) Schizosaccharomyces pombe chromosome III. 66 7e-12 3
(AL421847) T3 end of clone AY0AA015E01 of library AY0AA from... 50 1e-10 3
(Z68341) Caenorhabditis elegans Cosmid F01G4. 58 5e-10 5
(AM668257) Entamoeba terrapinae GSS, clone terra140b07.p1k. 62 6e-10 3
(FC568970) CAWF8058.fwd CAWF Lottia gigantea from mantle (H)... 48 1e-08 3
(AL406928) T7 end of clone AU0AA015B12 of library AU0AA from... 44 1e-06 2
(AM643560) Entamoeba dispar GSS, clone dispar87b02.p1k. 52 2e-05 2
(AM643251) Entamoeba dispar GSS, clone dispar112f02.p1k. 52 2e-05 2
(AM640387) Entamoeba dispar GSS, clone dispar74a11.p1k. 52 2e-05 2
(EI019358) bb12b07.f Dekkera bruxellensis Random Genomic Lib... 42 2e-05 4
(CR382133) Debaryomyces hansenii chromosome A of strain CBS7... 62 6e-05 1
(DQ366722) Uncultured Prochlorococcus marinus clone HF10-11D... 58 7e-05 2
(FG469809) 020304KAKA008110HT (KAKA) Dormant kiwifruit buds ... 46 8e-05 2
(EJ815239) 1093017512101 Global-Ocean-Sampling_GS-30-02-01-1... 54 1e-04 2
(EJ826591) 1093017563269 Global-Ocean-Sampling_GS-30-02-01-1... 54 1e-04 2
(ER610368) 1093016305733 Global-Ocean-Sampling_GS-36-01-01-2... 52 1e-04 3
(CR382126) Kluyveromyces lactis strain NRRL Y-1140 chromosom... 46 2e-04 2
(EK543223) 1095516071100 Global-Ocean-Sampling_GS-32-01-01-1... 60 2e-04 1
(FD751432) Afi04_77_B10_C014.g1 Aristolochia fimbriata flowe... 60 2e-04 1
(CP000552) Prochlorococcus marinus str. MIT 9515, complete g... 60 2e-04 1
(BX548174) Prochlorococcus marinus MED4 complete genome. 60 2e-04 1
(AM635240) Entamoeba dispar GSS, clone dispar132e03.q1k. 52 3e-04 2
(EJ014749) 1095433013608 Global-Ocean-Sampling_GS-26-01-01-1... 58 0.001 1
(BG051175) FM1_57_C04.b1_A003 Floral-Induced Meristem 1 (FM1... 58 0.001 1
(EE054124) ZF30D-8_C3 Developmental library II Taeniopygia g... 50 0.001 2
(CF721278) CCAHC26TR C.neoformans strain JEC21 Cryptococcus ... 56 0.002 2
(AC211044) Solanum lycopersicum chromosome 6 clone C06HBa010... 46 0.002 4
(AE017349) Cryptococcus neoformans var. neoformans JEC21 chr... 56 0.004 1
(DV125091) CV03041A2C03.f1 CV03-normalized library Euphorbia... 56 0.004 1
(EK000207) 1093025037791 Global-Ocean-Sampling_GS-30-02-01-1... 46 0.006 2
(AC211032) Solanum lycopersicum chromosome 6 clone C06HBa005... 46 0.012 5
(BH155542) ENTRV34TF Entamoeba histolytica Sheared DNA Entam... 42 0.012 2
(AZ531787) ENTBR22TF Entamoeba histolytica Sheared DNA Entam... 42 0.012 2
(AZ528371) ENTCO31TF Entamoeba histolytica Sheared DNA Entam... 42 0.012 2
(FF129299) CJAH-aac85g06.b1 Caenorhabditis_japonica_CJAH1_ES... 42 0.013 2
(AK176836) Arabidopsis thaliana mRNA for hypothetical protei... 40 0.016 3
(ER305131) 1092343744256 Global-Ocean-Sampling_GS-34-01-01-1... 52 0.059 1
(EJ370881) 1092963723805 Global-Ocean-Sampling_GS-28-01-01-1... 52 0.059 1
(CP000576) Prochlorococcus marinus str. MIT 9301, complete g... 52 0.059 1
(AJ719333) Gallus gallus mRNA for hypothetical protein, clon... 42 0.068 4
(B11265) F11D8-T7 IGF Arabidopsis thaliana genomic clone F11... 40 0.079 3
(AR898872) Sequence 120 from patent US 7071380. 46 0.12 2
(ER602869) 1093016255455 Global-Ocean-Sampling_GS-36-01-01-2... 50 0.23 1
(ER539258) 1093015921523 Global-Ocean-Sampling_GS-35-01-01-1... 50 0.23 1
(EK351494) 1095467964089 Global-Ocean-Sampling_GS-31-01-01-1... 50 0.23 1
(EJ984895) 1093023005038 Global-Ocean-Sampling_GS-30-02-01-1... 50 0.23 1
(EJ935799) 1093018837799 Global-Ocean-Sampling_GS-30-02-01-1... 50 0.23 1
(EJ454991) 1093017376998 Global-Ocean-Sampling_GS-28-01-01-1... 50 0.23 1
(EJ419271) 1093012218589 Global-Ocean-Sampling_GS-28-01-01-1... 50 0.23 1
(BX309869) AGENAE Rainbow trout multi-tissues - normalized +... 50 0.23 1
(AV823480) Arabidopsis thaliana cDNA clone:RAFL05-19-K12, 5'... 38 0.26 2
(CD129896) MF1-0031M-L047-D09-U.B MF1-0031 Schistosoma manso... 44 0.62 2
(CD121567) ME1-0068P-V163-H03-U.B ME1-0068 Schistosoma manso... 44 0.65 2
(CD121509) ME1-0068P-V163-B08-U.B ME1-0068 Schistosoma manso... 44 0.66 2
(ES910198) BNARO6GH_T3_016_D09_07DEC2006_073 Brassica napus ... 36 0.68 3
(DJ130765) Method for identification of useful proteins deri... 38 0.75 4
(AR549868) Sequence 4999 from patent US 6747137. 40 0.78 2
(BX839145) Arabidopsis thaliana Full-length cDNA 5PRIM end o... 40 0.80 2
(AC142095) Medicago truncatula clone mth2-14c17, complete se... 38 0.84 6
(DY449424) HSAA-aaa108f02.g2 UCI-11 Hydra vulgaris cDNA 5' s... 46 0.88 2
(AF165818) Guillardia theta nucleomorph chromosome 1, comple... 48 0.92 1
(EY798624) CR05-C3-701-076-G11-CT.F Mandarin fruit, developm... 48 0.92 1
(CW759333) OG_BBa0067H15.f OG_BBa Oryza glaberrima genomic c... 44 0.94 2
(AQ574519) nbxb0085J15f CUGI Rice BAC Library Oryza sativa J... 44 0.97 2
(AR898905) Sequence 186 from patent US 7071380. 38 1.0 2
(BT005794) Arabidopsis thaliana clone C105462 putative DEAD/... 38 1.0 2
(CL617743) OR_BBa0010O15.r OR_BBa Oryza nivara genomic clone... 44 1.0 2
(EI214722) OR__Ba0004I23.f OR__Ba Oryza rufipogon genomic cl... 44 1.1 2
(AY080791) Arabidopsis thaliana At2g06990 mRNA sequence. 38 1.1 2
(AY050658) Arabidopsis thaliana HUA enhancer 2 (HEN2) mRNA, ... 38 1.1 2
(CW661601) OG_BBa0014H16.f OG_BBa Oryza glaberrima genomic c... 44 1.1 2
(FE245285) CAPG8773.fwd CAPG Naegleria gruberi amoeba stage ... 38 1.2 2
(EI241643) OR__Ba0040M05.f OR__Ba Oryza rufipogon genomic cl... 44 1.2 2
(EI227959) OR__Ba0022I03.f OR__Ba Oryza rufipogon genomic cl... 44 1.3 2
(EI213446) OR__Ba0002N08.f OR__Ba Oryza rufipogon genomic cl... 44 1.3 2
(AC167610) Bos taurus clone CH240-194I24, WORKING DRAFT SEQU... 46 1.5 4
(AC113709) Rattus norvegicus clone CH230-55C1, *** SEQUENCIN... 46 1.6 7
(CF526865) tu-t-c-1582 tu-t-c Tupaia belangeri cDNA clone 03... 38 1.6 2
(AP007820) Lotus japonicus genomic DNA, chromosome 6, clone:... 38 1.8 4
(AC230431) Bos taurus clone CH240-509C3, WORKING DRAFT SEQUE... 46 1.9 4
(CL289974) ZMMBBb0631K04r ZMMBBb (HindIII) Zea mays subsp. m... 34 2.4 2
(DB777319) Apis mellifera head cDNA, RIKEN full-length enric... 32 2.5 2
(DB774463) Apis mellifera head cDNA, RIKEN full-length enric... 32 2.5 2
(DB761145) Apis mellifera head cDNA, RIKEN full-length enric... 32 2.5 2
(BG724601) EtESTed89a02.y1 Eimeria tenella S5-2 cDNA Neg Sel... 42 2.6 2
(AC125864) Rattus norvegicus clone CH230-9L24, *** SEQUENCIN... 46 2.9 4
(BZ676642) PUBEN44TD ZM_0.6_1.0_KB Zea mays genomic clone ZM... 32 2.9 3
(CW759768) OG_BBa0068B07.r OG_BBa Oryza glaberrima genomic c... 44 3.6 2
(AF058826) Arabidopsis thaliana BAC T26D22. 46 3.6 1
>(AC116977) Dictyostelium discoideum chromosome 2 map 5515173-5817331
strain AX4, complete sequence.
Length = 302156
Score = 1479 bits (746), Expect = 0.0
Identities = 746/746 (100%)
Strand = Plus / Minus
Query: 615 tatgatcatttacaatcgattgaaaaattaataccagagagtaaatgccataaatgtcca 674
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 14733 tatgatcatttacaatcgattgaaaaattaataccagagagtaaatgccataaatgtcca 14674
Query: 675 agattacatgaccattatgaacaaactgaaaaacgttatcaattacaatacgcaattcgt 734
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 14673 agattacatgaccattatgaacaaactgaaaaacgttatcaattacaatacgcaattcgt 14614
Query: 735 gatgctaaatacacagcatccgatgaaaatttgaaattaatgccacaatttaatatcaga 794
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 14613 gatgctaaatacacagcatccgatgaaaatttgaaattaatgccacaatttaatatcaga 14554
Query: 795 ttagatattttacacgagttgggttatattgatgatgagaatactgtcactttgaaagga 854
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 14553 ttagatattttacacgagttgggttatattgatgatgagaatactgtcactttgaaagga 14494
Query: 855 cgtgtttcaagagagattaacacttgcgaggatttagttatcactgaattaatctttgaa 914
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 14493 cgtgtttcaagagagattaacacttgcgaggatttagttatcactgaattaatctttgaa 14434
Query: 915 aatgctttcatcaatttagaaccttcagaagttgtatcggttttatcttgtttaatattc 974
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 14433 aatgctttcatcaatttagaaccttcagaagttgtatcggttttatcttgtttaatattc 14374
Query: 975 caagaaaaggatgctgttcaaccttcacttacaccacgtttagaagaagcaaaacaaaat 1034
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 14373 caagaaaaggatgctgttcaaccttcacttacaccacgtttagaagaagcaaaacaaaat 14314
Query: 1035 cttatcaaaactgctgaaaaaacttataaagtagaatctgataaaggtttagatgttgta 1094
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 14313 cttatcaaaactgctgaaaaaacttataaagtagaatctgataaaggtttagatgttgta 14254
Query: 1095 cctgatgataaattagaaacaactcttaaatttggtcttatgcaagttgtgtacgaatgg 1154
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 14253 cctgatgataaattagaaacaactcttaaatttggtcttatgcaagttgtgtacgaatgg 14194
Query: 1155 gctagaggtacacctttcaatgatatttgtacactcacaaatgttttagaaggttcaatc 1214
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 14193 gctagaggtacacctttcaatgatatttgtacactcacaaatgttttagaaggttcaatc 14134
Query: 1215 gttcgtgctatcactagaatcggtgaaacttgtcaagaagttagaaatgctgctagagta 1274
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 14133 gttcgtgctatcactagaatcggtgaaacttgtcaagaagttagaaatgctgctagagta 14074
Query: 1275 atcggtgatactaaattacttcaaaaaatggaagaagcaatgagattaattaaaagagat 1334
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 14073 atcggtgatactaaattacttcaaaaaatggaagaagcaatgagattaattaaaagagat 14014
Query: 1335 atcgttttcacttcttctttatatgt 1360
||||||||||||||||||||||||||
Sbjct: 14013 atcgttttcacttcttctttatatgt 13988
Score = 1172 bits (591), Expect = 0.0
Identities = 594/595 (99%)
Strand = Plus / Minus
Query: 1 gggcatttttggaacagaaagagataacttcaccattatcagatttaataaccaatccag 60
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 16898 gggcatttttggaacagaaagagataacttcaccattatcagatttaataaccaatccag 16839
Query: 61 ctatagagtatccatttgatttggattcatttcaaaaacaagctatcgttcatatggagc 120
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 16838 ctatagagtatccatttgatttggattcatttcaaaaacaagctatcgttcatatggagc 16779
Query: 121 aaggggagtctgtgtttattacagcacatacatcagctggtaagactgtgattgctgaat 180
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 16778 aaggggagtctgtgtttattacagcacatacatcagctggtaagactgtgattgctgaat 16719
Query: 181 atgcaattgcgatggctgcaaagaatatgacgagagcaatctatacgtcgccaattaaag 240
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 16718 atgcaattgcgatggctgcaaagaatatgacgagagcaatctatacgtcgccaattaaag 16659
Query: 241 cattatcaaatcaaaagtttagagattttaaaaatacatccaacgatgttggtttgatca 300
||||||||||||||||||||||||||||||||||||||| ||||||||||||||||||||
Sbjct: 16658 cattatcaaatcaaaagtttagagattttaaaaatacattcaacgatgttggtttgatca 16599
Query: 301 ctggtgacgtatcaatttcaccctcgagtagttgtttagtattgactacagagattttaa 360
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 16598 ctggtgacgtatcaatttcaccctcgagtagttgtttagtattgactacagagattttaa 16539
Query: 361 gatcaatgttatataaaggtgctgatttaattagagatattgaatgggtgattttcgatg 420
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 16538 gatcaatgttatataaaggtgctgatttaattagagatattgaatgggtgattttcgatg 16479
Query: 421 aggttcattatttaaatgatttagaaaggggtgtggtttgggaggaggttatcattatgt 480
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 16478 aggttcattatttaaatgatttagaaaggggtgtggtttgggaggaggttatcattatgt 16419
Query: 481 taccaccatatgtgaaaatggtgttcttatcagcaacagtttcaaatccattagaatttg 540
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 16418 taccaccatatgtgaaaatggtgttcttatcagcaacagtttcaaatccattagaatttg 16359
Query: 541 cacaatggattggtagaactaaacaattaccaatctatgtaattggtacaactaa 595
|||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 16358 cacaatggattggtagaactaaacaattaccaatctatgtaattggtacaactaa 16304
Lambda K H
1.37 0.711 1.31
Matrix: blastn matrix:1 -3
Number of Sequences: 92845959
Number of Hits to DB: 1,551,122,804
Number of extensions: 87785569
Number of successful extensions: 6955923
Number of sequences better than 10.0: 156
Length of query: 1417
Length of database: 95,242,211,685
Length adjustment: 24
Effective length of query: 1393
Effective length of database: 97,308,875,965
Effective search space: 135551264219245
Effective search space used: 135551264219245
X1: 11 (21.8 bits)
S2: 22 (44.1 bits)
|
| Homology vs Protein |
Query= Contig-U11484-1 (Contig-U11484-1Q) /CSM_Contig/Contig-U11484-1Q.Seq.d
(1417 letters)
Database: nrp_B
3,236,559 sequences; 1,051,180,864 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
CR382127_374(CR382127|pid:none) Yarrowia lipolytica strain CLIB1... 283 1e-74
AP007171_540(AP007171|pid:none) Aspergillus oryzae RIB40 genomic... 281 4e-74
AK029763_1(AK029763|pid:none) Mus musculus adult male testis cDN... 279 2e-73
BX883045_4(BX883045|pid:none) Rattus norvegicus chromosome 20, m... 279 2e-73
AK169864_1(AK169864|pid:none) Mus musculus NOD-derived CD11c +ve... 279 2e-73
L13469_2(L13469|pid:none) Saccharomyces cerevisiae antiviral pro... 278 3e-73
CU928174_531(CU928174|pid:none) Zygosaccharomyces rouxii strain ... 278 5e-73
(O59801) RecName: Full=Uncharacterized helicase C550.03c; ... 278 5e-73
EU282370_1(EU282370|pid:none) Sus scrofa putative superkiller vi... 277 6e-73
FM992695_755(FM992695|pid:none) Candida dubliniensis CD36 chromo... 276 1e-72
AK297230_1(AK297230|pid:none) Homo sapiens cDNA FLJ57529 complet... 276 1e-72
AF059675_1(AF059675|pid:none) Homo sapiens putative RNA helicase... 276 1e-72
AF019413_6(AF019413|pid:none) Homo sapiens HLA class III region ... 276 1e-72
AL645922_14(AL645922|pid:none) Human DNA sequence from clone XXb... 276 1e-72
EU176680_1(EU176680|pid:none) Synthetic construct Homo sapiens c... 276 1e-72
S56752(S56752;A56003) helicase SKI2W - human &Z48796_1(Z48796|p... 276 1e-72
BC171377_1(BC171377|pid:none) Danio rerio superkiller viralicidi... 275 3e-72
BX537337_5(BX537337|pid:none) Zebrafish DNA sequence from clone ... 275 3e-72
CP000501_178(CP000501|pid:none) Pichia stipitis CBS 6054 chromos... 275 4e-72
AM920437_2004(AM920437|pid:none) Penicillium chrysogenum Wiscons... 275 4e-72
AE016818_413(AE016818|pid:none) Ashbya gossypii (= Eremothecium ... 271 6e-71
AL133292_1(AL133292|pid:none) Arabidopsis thaliana DNA chromosom... 268 4e-70
FN392320_757(FN392320|pid:none) Pichia pastoris GS115 chromosome... 267 6e-70
CP000581_322(CP000581|pid:none) Ostreococcus lucimarinus CCE9901... 265 4e-69
CP001325_407(CP001325|pid:none) Micromonas sp. RCC299 chromosome... 257 8e-67
AE014297_3524(AE014297|pid:none) Drosophila melanogaster chromos... 256 1e-66
AJ276896_1(AJ276896|pid:none) Drosophila melanogaster mRNA for p... 256 1e-66
AC007258_8(AC007258|pid:none) Arabidopsis thaliana chromosome I ... 236 2e-60
CR954206_325(CR954206|pid:none) Ostreococcus tauri strain OTTH05... 234 4e-60
CR382130_502(CR382130|pid:none) Yarrowia lipolytica strain CLIB1... 231 6e-59
FN357350_34(FN357350|pid:none) Schistosoma mansoni genome sequen... 230 8e-59
CP001323_861(CP001323|pid:none) Micromonas sp. RCC299 chromosome... 229 1e-58
AC116551_15(AC116551|pid:none) Dictyostelium discoideum chromoso... 229 1e-58
CR954209_292(CR954209|pid:none) Ostreococcus tauri strain OTTH05... 229 2e-58
CP000589_270(CP000589|pid:none) Ostreococcus lucimarinus CCE9901... 228 3e-58
(P47047) RecName: Full=ATP-dependent RNA helicase DOB1; ... 228 4e-58
AC142095_23(AC142095|pid:none) Medicago truncatula clone mth2-14... 228 5e-58
(O13799) RecName: Full=Uncharacterized helicase C17H9.02; ... 228 5e-58
B84481(B84481)hypothetical protein At2g06990 [imported] - Arabid... 228 5e-58
CU638743_430(CU638743|pid:none) Podospora anserina genomic DNA c... 228 5e-58
AY050658_1(AY050658|pid:none) Arabidopsis thaliana HUA enhancer ... 227 7e-58
AK291649_1(AK291649|pid:none) Homo sapiens cDNA FLJ76877 complet... 227 9e-58
AC120539_28(AC120539|pid:none) Oryza sativa (japonica cultivar-g... 227 9e-58
AC140023_23(AC140023|pid:none) Medicago truncatula clone mth2-32... 227 9e-58
AJ719333_1(AJ719333|pid:none) Gallus gallus mRNA for hypothetica... 226 1e-57
AE017344_500(AE017344|pid:none) Cryptococcus neoformans var. neo... 226 1e-57
(Q23223) RecName: Full=Uncharacterized helicase W08D2.7; ... 225 3e-57
AY890513_1(AY890513|pid:none) Synthetic construct Homo sapiens c... 225 3e-57
AK304788_1(AK304788|pid:none) Homo sapiens cDNA FLJ55446 complet... 225 3e-57
BX640789_1(BX640789|pid:none) Homo sapiens mRNA; cDNA DKFZp686K2... 225 3e-57
BC065258_1(BC065258|pid:none) Homo sapiens superkiller viralicid... 225 3e-57
AY892971_1(AY892971|pid:none) Synthetic construct Homo sapiens c... 225 3e-57
AM910993_478(AM910993|pid:none) Plasmodium knowlesi strain H chr... 225 3e-57
AK078091_1(AK078091|pid:none) Mus musculus adult male medulla ob... 224 5e-57
BC146077_1(BC146077|pid:none) Bos taurus superkiller viralicidic... 224 5e-57
AM270070_26(AM270070|pid:none) Aspergillus niger contig An04c009... 224 6e-57
CR382126_56(CR382126|pid:none) Kluyveromyces lactis strain NRRL ... 224 6e-57
AE016818_166(AE016818|pid:none) Ashbya gossypii (= Eremothecium ... 223 1e-56
CR940353_330(CR940353|pid:none) Theileria annulata strain Ankara... 223 2e-56
CU928174_393(CU928174|pid:none) Zygosaccharomyces rouxii strain ... 223 2e-56
FN313906_1(FN313906|pid:none) Schistosoma japonicum isolate Anhu... 221 4e-56
AY818711_1(AY818711|pid:none) Neurospora crassa FRQ-interacting ... 221 5e-56
FN376190_1(FN376190|pid:none) Schistosoma mansoni genome sequenc... 221 5e-56
AL096859_1(AL096859|pid:none) Arabidopsis thaliana DNA chromosom... 221 7e-56
FM992694_303(FM992694|pid:none) Candida dubliniensis CD36 chromo... 220 9e-56
AP006852_314(AP006852|pid:none) Candida albicans genomic DNA, ch... 220 9e-56
(O14232) RecName: Full=Uncharacterized helicase C6F12.16c; ... 220 1e-55
CP001332_277(CP001332|pid:none) Micromonas sp. RCC299 chromosome... 219 2e-55
CP000500_562(CP000500|pid:none) Pichia stipitis CBS 6054 chromos... 217 9e-55
AL844508_99(AL844508|pid:none) Plasmodium falciparum 3D7 chromos... 212 2e-53
BT072786_1(BT072786|pid:none) Salmo salar clone ssal-rgf-540-229... 209 2e-52
AM494972_322(AM494972|pid:none) Leishmania braziliensis chromoso... 205 3e-51
CT005272_310(CT005272|pid:none) Leishmania major strain Friedlin... 205 4e-51
AM502254_370(AM502254|pid:none) Leishmania infantum chromosome 36. 204 5e-51
T17732(T17732) helicase-like protein A241R - Chlorella virus PBC... 177 8e-43
DQ890022_227(DQ890022|pid:none) Paramecium bursaria Chlorella vi... 168 5e-40
CP000095_1814(CP000095|pid:none) Prochlorococcus marinus str. NA... 167 7e-40
BC023478_1(BC023478|pid:none) Mus musculus superkiller viralicid... 167 9e-40
AF165818_12(AF165818|pid:none) Guillardia theta nucleomorph chro... 167 1e-39
CP001275_167(CP001275|pid:none) Thermomicrobium roseum DSM 5159,... 166 1e-39
CP001628_1128(CP001628|pid:none) Micrococcus luteus NCTC 2665, c... 166 2e-39
CP000820_4763(CP000820|pid:none) Frankia sp. EAN1pec, complete g... 165 3e-39
CP000110_2000(CP000110|pid:none) Synechococcus sp. CC9605, compl... 164 6e-39
CP000454_2164(CP000454|pid:none) Arthrobacter sp. FB24, complete... 164 6e-39
BX569690_282(BX569690|pid:none) Synechococcus sp. WH8102 complet... 164 7e-39
CP001213_1308(CP001213|pid:none) Bifidobacterium animalis subsp.... 164 1e-38
AP008231_229(AP008231|pid:none) Synechococcus elongatus PCC 6301... 164 1e-38
AM711867_1705(AM711867|pid:none) Clavibacter michiganensis subsp... 164 1e-38
CP000100_1322(CP000100|pid:none) Synechococcus elongatus PCC 794... 164 1e-38
CP001341_1900(CP001341|pid:none) Arthrobacter chlorophenolicus A... 163 1e-38
CP000605_467(CP000605|pid:none) Bifidobacterium longum DJO10A, c... 163 2e-38
CP000481_1202(CP000481|pid:none) Acidothermus cellulolyticus 11B... 163 2e-38
CP001095_1126(CP001095|pid:none) Bifidobacterium longum subsp. i... 163 2e-38
AE014295_394(AE014295|pid:none) Bifidobacterium longum NCC2705, ... 163 2e-38
CP000878_1588(CP000878|pid:none) Prochlorococcus marinus str. MI... 162 2e-38
CP001287_1244(CP001287|pid:none) Cyanothece sp. PCC 8801, comple... 162 3e-38
AK099845_1(AK099845|pid:none) Oryza sativa Japonica Group cDNA c... 162 3e-38
AM420293_2215(AM420293|pid:none) Saccharopolyspora erythraea NRR... 161 5e-38
CP000249_2572(CP000249|pid:none) Frankia sp. CcI3, complete geno... 161 6e-38
CP000667_2221(CP000667|pid:none) Salinispora tropica CNB-440, co... 161 6e-38
CP001601_1263(CP001601|pid:none) Corynebacterium aurimucosum ATC... 161 6e-38
EF101928_596(EF101928|pid:none) Acanthocystis turfacea Chlorella... 160 1e-37
CP000097_621(CP000097|pid:none) Synechococcus sp. CC9902, comple... 160 1e-37
CP000393_3023(CP000393|pid:none) Trichodesmium erythraeum IMS101... 160 1e-37
CT978603_1923(CT978603|pid:none) Synechococcus sp. RCC307 genomi... 159 2e-37
BA000022_3094(BA000022|pid:none) Synechocystis sp. PCC 6803 DNA,... 159 2e-37
BX548175_1925(BX548175|pid:none) Prochlorococcus marinus MIT9313... 159 2e-37
CP001618_2052(CP001618|pid:none) Beutenbergia cavernae DSM 12333... 159 2e-37
AM778930_54(AM778930|pid:none) Microcystis aeruginosa PCC 7806 g... 158 4e-37
CP000951_2212(CP000951|pid:none) Synechococcus sp. PCC 7002, com... 158 4e-37
AH1867(AH1867) hypothetical protein alr0489 [imported] - Nostoc ... 158 5e-37
CP001620_861(CP001620|pid:none) Corynebacterium kroppenstedtii D... 158 5e-37
AK316759_1(AK316759|pid:none) Arabidopsis thaliana AT1G70070 mRN... 157 9e-37
AP009493_5873(AP009493|pid:none) Streptomyces griseus subsp. gri... 157 9e-37
CT573213_2809(CT573213|pid:none) Frankia alni str. ACN14A chromo... 157 1e-36
AF387007_1(AF387007|pid:none) Arabidopsis thaliana Similar to Sy... 157 1e-36
CP000750_1879(CP000750|pid:none) Kineococcus radiotolerans SRS30... 156 2e-36
AE017126_1618(AE017126|pid:none) Prochlorococcus marinus subsp. ... 156 2e-36
CP000825_1730(CP000825|pid:none) Prochlorococcus marinus str. MI... 156 2e-36
BA000030_6702(BA000030|pid:none) Streptomyces avermitilis MA-468... 156 2e-36
CP000552_1646(CP000552|pid:none) Prochlorococcus marinus str. MI... 156 2e-36
CP000239_2521(CP000239|pid:none) Synechococcus sp. JA-3-3Ab, com... 156 2e-36
AP009044_1580(AP009044|pid:none) Corynebacterium glutamicum R DN... 155 3e-36
AM408590_2116(AM408590|pid:none) Mycobacterium bovis BCG Pasteur... 155 3e-36
CP000551_1665(CP000551|pid:none) Prochlorococcus marinus str. AS... 155 3e-36
CP000240_2349(CP000240|pid:none) Synechococcus sp. JA-2-3B'a(2-1... 155 3e-36
CP000850_2296(CP000850|pid:none) Salinispora arenicola CNS-205, ... 155 3e-36
(Q9ZBD8) RecName: Full=Probable helicase helY; EC=3.6.1... 155 4e-36
AL939109_187(AL939109|pid:none) Streptomyces coelicolor A3(2) co... 155 4e-36
AE016958_1828(AE016958|pid:none) Mycobacterium avium subsp. para... 154 6e-36
CP000480_3753(CP000480|pid:none) Mycobacterium smegmatis str. MC... 154 1e-35
CP000930_984(CP000930|pid:none) Heliobacterium modesticaldum Ice... 154 1e-35
CP000111_1710(CP000111|pid:none) Prochlorococcus marinus str. MI... 154 1e-35
BX548174_1708(BX548174|pid:none) Prochlorococcus marinus MED4 co... 154 1e-35
BA000039_349(BA000039|pid:none) Thermosynechococcus elongatus BP... 152 2e-35
CP000511_3384(CP000511|pid:none) Mycobacterium vanbaalenii PYR-1... 152 3e-35
CP000854_3042(CP000854|pid:none) Mycobacterium marinum M, comple... 151 6e-35
AP009389_2016(AP009389|pid:none) Pelotomaculum thermopropionicum... 150 1e-34
CP000325_1915(CP000325|pid:none) Mycobacterium ulcerans Agy99, c... 150 1e-34
CP000384_2462(CP000384|pid:none) Mycobacterium sp. MCS, complete... 149 2e-34
CP000828_3946(CP000828|pid:none) Acaryochloris marina MBIC11017,... 149 2e-34
CP000580_2484(CP000580|pid:none) Mycobacterium sp. JLS, complete... 149 2e-34
BX248357_178(BX248357|pid:none) Corynebacterium diphtheriae grav... 149 2e-34
BC014669_1(BC014669|pid:none) Homo sapiens superkiller viralicid... 149 2e-34
BC031779_1(BC031779|pid:none) Homo sapiens superkiller viralicid... 149 2e-34
CR931997_940(CR931997|pid:none) Corynebacterium jeikeium K411 co... 148 5e-34
BC014810_1(BC014810|pid:none) Mus musculus superkiller viralicid... 148 5e-34
CR954210_8(CR954210|pid:none) Ostreococcus tauri strain OTTH0595... 145 3e-33
CU458896_2167(CU458896|pid:none) Mycobacterium abscessus chromos... 145 3e-33
AP011115_573(AP011115|pid:none) Rhodococcus opacus B4 DNA, compl... 142 4e-32
AJ223310_1(AJ223310|pid:none) Streptomyces avermitilis sab3 gene... 137 1e-30
AK077924_1(AK077924|pid:none) Mus musculus 13 days embryo male t... 129 3e-28
AC002062_20(AC002062|pid:none) Sequence of BAC F20P5 from Arabid... 114 7e-24
BX294145_265(BX294145|pid:none) Rhodopirellula baltica SH 1 comp... 106 2e-21
FN357924_1(FN357924|pid:none) Schistosoma mansoni genome sequenc... 104 7e-21
(Q9V0A9) RecName: Full=Putative ski2-type helicase; EC=... 93 3e-17
CP001618_1436(CP001618|pid:none) Beutenbergia cavernae DSM 12333... 92 6e-17
(A7IB61) RecName: Full=Putative ski2-type helicase; EC=... 90 2e-16
(Q9P7T8) RecName: Full=Uncharacterized helicase C694.02; ... 89 4e-16
CP001404_2561(CP001404|pid:none) Sulfolobus islandicus Y.N.15.51... 89 5e-16
AM270315_26(AM270315|pid:none) Aspergillus niger contig An14c008... 89 5e-16
CP001400_249(CP001400|pid:none) Sulfolobus islandicus M.14.25, c... 89 5e-16
(Q97VY9) RecName: Full=Putative ski2-type helicase; EC=... 89 5e-16
CP001402_267(CP001402|pid:none) Sulfolobus islandicus M.16.4, co... 89 5e-16
(O59025) RecName: Full=Putative ski2-type helicase; EC=... 88 7e-16
CP001032_3764(CP001032|pid:none) Opitutus terrae PB90-1, complet... 88 9e-16
AE017261_1380(AE017261|pid:none) Picrophilus torridus DSM 9790, ... 86 3e-15
CP000816_1279(CP000816|pid:none) Ignicoccus hospitalis KIN4/I, c... 85 6e-15
CP000850_1667(CP000850|pid:none) Salinispora arenicola CNS-205, ... 85 6e-15
AY815485_1(AY815485|pid:none) Schistosoma japonicum SJCHGC09306 ... 84 1e-14
CT573213_3698(CT573213|pid:none) Frankia alni str. ACN14A chromo... 84 1e-14
AY322574_1(AY322574|pid:none) Schistosoma japonicum FE1 mRNA, pa... 84 1e-14
CP000580_5590(CP000580|pid:none) Mycobacterium sp. JLS, complete... 84 2e-14
CP000384_5240(CP000384|pid:none) Mycobacterium sp. MCS, complete... 84 2e-14
(O73946) RecName: Full=Putative ski2-type helicase; EC=... 84 2e-14
AM849034_1776(AM849034|pid:none) Clavibacter michiganensis subsp... 84 2e-14
(Q4JC00) RecName: Full=Putative ski2-type helicase; EC=... 83 2e-14
CP000477_786(CP000477|pid:none) Methanosaeta thermophila PT, com... 83 2e-14
AM711867_1526(AM711867|pid:none) Clavibacter michiganensis subsp... 83 2e-14
AM420293_5461(AM420293|pid:none) Saccharopolyspora erythraea NRR... 83 2e-14
CP000249_2233(CP000249|pid:none) Frankia sp. CcI3, complete geno... 83 3e-14
AM920436_247(AM920436|pid:none) Penicillium chrysogenum Wisconsi... 83 3e-14
CP000750_172(CP000750|pid:none) Kineococcus radiotolerans SRS302... 83 3e-14
CP000562_2487(CP000562|pid:none) Methanoculleus marisnigri JR1, ... 82 4e-14
AP009493_6318(AP009493|pid:none) Streptomyces griseus subsp. gri... 82 5e-14
AP009152_1197(AP009152|pid:none) Kocuria rhizophila DC2201 DNA, ... 82 6e-14
(Q97AI2) RecName: Full=Putative ski2-type helicase; EC=... 82 6e-14
CP001601_1460(CP001601|pid:none) Corynebacterium aurimucosum ATC... 81 8e-14
(Q974S1) RecName: Full=Putative ski2-type helicase; EC=... 81 1e-13
CP000454_2053(CP000454|pid:none) Arthrobacter sp. FB24, complete... 81 1e-13
CP001140_713(CP001140|pid:none) Desulfurococcus kamchatkensis 12... 81 1e-13
AP008957_2795(AP008957|pid:none) Rhodococcus erythropolis PR4 DN... 81 1e-13
CP001095_683(CP001095|pid:none) Bifidobacterium longum subsp. in... 81 1e-13
AM746676_4371(AM746676|pid:none) Sorangium cellulosum 'So ce 56'... 80 1e-13
CP000559_1734(CP000559|pid:none) Methanocorpusculum labreanum Z,... 80 2e-13
AP011115_6788(AP011115|pid:none) Rhodococcus opacus B4 DNA, comp... 80 2e-13
CP000431_6739(CP000431|pid:none) Rhodococcus jostii RHA1, comple... 80 2e-13
AE017283_2077(AE017283|pid:none) Propionibacterium acnes KPA1712... 80 2e-13
(Q5JGV6) RecName: Full=Putative ski2-type helicase; EC=... 80 2e-13
BA000030_1580(BA000030|pid:none) Streptomyces avermitilis MA-468... 80 2e-13
AP006618_3799(AP006618|pid:none) Nocardia farcinica IFM 10152 DN... 80 2e-13
AP009256_584(AP009256|pid:none) Bifidobacterium adolescentis ATC... 80 2e-13
(Q3IU46) RecName: Full=Putative ski2-type helicase; EC=... 79 3e-13
CP000504_1138(CP000504|pid:none) Pyrobaculum islandicum DSM 4184... 79 3e-13
CP000605_40(CP000605|pid:none) Bifidobacterium longum DJO10A, co... 79 3e-13
AE014295_28(AE014295|pid:none) Bifidobacterium longum NCC2705, c... 79 3e-13
CP000254_2385(CP000254|pid:none) Methanospirillum hungatei JF-1,... 79 4e-13
CP001398_871(CP001398|pid:none) Thermococcus gammatolerans EJ3, ... 79 5e-13
CP000682_1355(CP000682|pid:none) Metallosphaera sedula DSM 5348,... 79 5e-13
BX248358_50(BX248358|pid:none) Corynebacterium diphtheriae gravi... 78 7e-13
CP000855_1350(CP000855|pid:none) Thermococcus onnurineus NA1, co... 78 7e-13
CP000660_110(CP000660|pid:none) Pyrobaculum arsenaticum DSM 1351... 78 7e-13
CP000769_3432(CP000769|pid:none) Anaeromyxobacter sp. Fw109-5, c... 77 1e-12
EU016599_11(EU016599|pid:none) Uncultured Group I marine crenarc... 77 2e-12
CP001628_1056(CP001628|pid:none) Micrococcus luteus NCTC 2665, c... 77 2e-12
DQ866868_1(DQ866868|pid:none) Mycobacterium smegmatis str. MC2 1... 77 2e-12
(Q58524) RecName: Full=Putative ski2-type helicase; EC=... 76 3e-12
EU016632_32(EU016632|pid:none) Uncultured Group I marine crenarc... 76 3e-12
AM180088_8(AM180088|pid:none) Haloquadratum walsbyi DSM 16790 co... 76 3e-12
FJ528581_1(FJ528581|pid:none) Sordaria macrospora meiotic helica... 75 4e-12
CP000609_691(CP000609|pid:none) Methanococcus maripaludis C5, co... 75 4e-12
CP000656_1006(CP000656|pid:none) Mycobacterium gilvum PYR-GCK, c... 75 4e-12
(Q9YFQ8) RecName: Full=Putative ski2-type helicase; EC=... 75 6e-12
E72775(E72775)probable helicase APE0191 - Aeropyrum pernix (stra... 75 6e-12
BA000035_1814(BA000035|pid:none) Corynebacterium efficiens YS-31... 74 1e-11
CP000867_1750(CP000867|pid:none) Methanococcus maripaludis C6, c... 74 1e-11
CP000099_3469(CP000099|pid:none) Methanosarcina barkeri str. Fus... 74 1e-11
(Q09475) RecName: Full=Uncharacterized helicase C28H8.3; ... 73 3e-11
AE010299_1372(AE010299|pid:none) Methanosarcina acetivorans str.... 73 3e-11
CP000511_5732(CP000511|pid:none) Mycobacterium vanbaalenii PYR-1... 73 3e-11
A88470(A88470)protein C28H8.3 [imported] - Caenorhabditis elegans 73 3e-11
CP000745_524(CP000745|pid:none) Methanococcus maripaludis C7, co... 73 3e-11
(A6UN73) RecName: Full=Putative ski2-type helicase; EC=... 72 4e-11
AE009441_614(AE009441|pid:none) Pyrobaculum aerophilum str. IM2,... 72 4e-11
CP001365_1195(CP001365|pid:none) Halorubrum lacusprofundi ATCC 4... 72 4e-11
AM180088_650(AM180088|pid:none) Haloquadratum walsbyi DSM 16790 ... 72 4e-11
CP001398_648(CP001398|pid:none) Thermococcus gammatolerans EJ3, ... 72 5e-11
AM180088_47(AM180088|pid:none) Haloquadratum walsbyi DSM 16790 c... 72 5e-11
BA000036_1924(BA000036|pid:none) Corynebacterium glutamicum ATCC... 72 5e-11
AE009439_111(AE009439|pid:none) Methanopyrus kandleri AV19, comp... 72 5e-11
AM502221_31(AM502221|pid:none) Leishmania infantum chromosome 3. 71 8e-11
AM055942_105(AM055942|pid:none) Toxoplasma gondii RH, genomic DN... 71 8e-11
CP000745_135(CP000745|pid:none) Methanococcus maripaludis C7, co... 71 8e-11
AP006878_567(AP006878|pid:none) Thermococcus kodakarensis KOD1 D... 71 8e-11
AE008384_2380(AE008384|pid:none) Methanosarcina mazei strain Goe... 71 1e-10
DQ372941_8(DQ372941|pid:none) Methanococcus voltae enolase (MVO1... 71 1e-10
DQ314493_11(DQ314493|pid:none) Haloquadratum walsbyi clone 2B08 ... 70 1e-10
AE000666_652(AE000666|pid:none) Methanothermobacter thermautotro... 70 1e-10
CP000575_208(CP000575|pid:none) Staphylothermus marinus F1, comp... 70 1e-10
AM114193_1760(AM114193|pid:none) Uncultured methanogenic archaeo... 70 2e-10
AP007155_372(AP007155|pid:none) Aspergillus oryzae RIB40 genomic... 70 2e-10
CP001365_2475(CP001365|pid:none) Halorubrum lacusprofundi ATCC 4... 69 3e-10
CP000678_839(CP000678|pid:none) Methanobrevibacter smithii ATCC ... 69 4e-10
(O26901) RecName: Full=Putative ski2-type helicase; EC=... 69 4e-10
CU633895_632(CU633895|pid:none) Podospora anserina genomic DNA c... 69 5e-10
AY915364_1(AY915364|pid:none) Schistosoma japonicum SJCHGC05303 ... 69 5e-10
CR936257_280(CR936257|pid:none) Natronomonas pharaonis DSM 2160 ... 69 5e-10
CP000742_585(CP000742|pid:none) Methanococcus vannielii SB, comp... 68 7e-10
BX950229_1284(BX950229|pid:none) Methanococcus maripaludis strai... 68 9e-10
CR940352_647(CR940352|pid:none) Theileria annulata strain Ankara... 68 9e-10
(Q0W6L1) RecName: Full=Putative ski2-type helicase; EC=... 68 9e-10
AM920437_215(AM920437|pid:none) Penicillium chrysogenum Wisconsi... 68 9e-10
AK001649_1(AK001649|pid:none) Homo sapiens cDNA FLJ10787 fis, cl... 67 2e-09
BC038115_1(BC038115|pid:none) Homo sapiens DEAD (Asp-Glu-Ala-Asp... 67 2e-09
(Q8IY21) RecName: Full=Probable ATP-dependent RNA helicase DDX60... 67 2e-09
AM494950_32(AM494950|pid:none) Leishmania braziliensis chromosom... 67 2e-09
AX877200_1(AX877200|pid:none) Sequence 12105 from Patent EP10746... 67 2e-09
(B0R7Q2) RecName: Full=Putative ski2-type helicase; EC=... 67 2e-09
AB180404_1(AB180404|pid:none) Coprinopsis cinerea mRNA for mer3,... 65 8e-09
CT005252_50(CT005252|pid:none) Leishmania major strain Friedlin,... 64 1e-08
DQ485348_1(DQ485348|pid:none) Trichomonas vaginalis strain NIH-C... 64 2e-08
CU928166_383(CU928166|pid:none) Kluyveromyces thermotolerans str... 63 2e-08
AC092558_6(AC092558|pid:none) Oryza sativa chromosome 3 BAC OSJN... 63 3e-08
(A2RUV5) RecName: Full=Probable ATP-dependent DNA helicase HFM1;... 62 4e-08
(P53327) RecName: Full=Antiviral helicase SLH1; EC=3.6.... 62 4e-08
(Q5H9U9) RecName: Full=Probable ATP-dependent RNA helicase DDX60... 61 9e-08
CR936257_2559(CR936257|pid:none) Natronomonas pharaonis DSM 2160... 61 9e-08
AK055595_1(AK055595|pid:none) Homo sapiens cDNA FLJ31033 fis, cl... 61 9e-08
CP001147_431(CP001147|pid:none) Thermodesulfovibrio yellowstonii... 61 9e-08
BA000023_161(BA000023|pid:none) Sulfolobus tokodaii str. 7 DNA, ... 61 9e-08
CP000102_99(CP000102|pid:none) Methanosphaera stadtmanae DSM 309... 61 1e-07
(P51979) RecName: Full=ATP-dependent DNA helicase MER3; ... 60 1e-07
U22156_1(U22156|pid:none) Saccharomyces cerevisiae Hfm1p (HFM1) ... 60 1e-07
S61610(S61610;S59815;S64277) HFM1 protein - yeast (Saccharomyces... 60 1e-07
AE016815_354(AE016815|pid:none) Ashbya gossypii (= Eremothecium ... 60 2e-07
FM992692_449(FM992692|pid:none) Candida dubliniensis CD36 chromo... 60 2e-07
CP000505_921(CP000505|pid:none) Thermofilum pendens Hrk 5, compl... 59 3e-07
(A2PYH4) RecName: Full=Probable ATP-dependent DNA helicase HFM1;... 59 3e-07
AY596297_2433(AY596297|pid:none) Haloarcula marismortui ATCC 430... 59 3e-07
AM774415_1729(AM774415|pid:none) Halobacterium salinarum complet... 59 3e-07
CP000496_352(CP000496|pid:none) Pichia stipitis CBS 6054 chromos... 59 3e-07
CP001017_83(CP001017|pid:none) Beijerinckia indica subsp. indica... 59 4e-07
FN392319_579(FN392319|pid:none) Pichia pastoris GS115 chromosome... 59 4e-07
CR382124_475(CR382124|pid:none) Kluyveromyces lactis strain NRRL... 59 4e-07
CR382139_871(CR382139|pid:none) Debaryomyces hansenii strain CBS... 59 4e-07
AM910987_263(AM910987|pid:none) Plasmodium knowlesi strain H chr... 59 4e-07
CP000656_4782(CP000656|pid:none) Mycobacterium gilvum PYR-GCK, c... 59 4e-07
AY812796_1(AY812796|pid:none) Schistosoma japonicum SJCHGC05845 ... 59 6e-07
(O75643) RecName: Full=U5 small nuclear ribonucleoprotein 200 kD... 58 7e-07
AL845368_1(AL845368|pid:none) Mouse DNA sequence from clone RP23... 58 7e-07
BC065924_1(BC065924|pid:none) Homo sapiens small nuclear ribonuc... 58 7e-07
BC007577_1(BC007577|pid:none) Homo sapiens small nuclear ribonuc... 58 7e-07
AK173025_1(AK173025|pid:none) Mus musculus mRNA for mKIAA0788 pr... 58 7e-07
A69140(A69140) ATP-dependent helicase - Methanobacterium thermoa... 58 1e-06
AM087123_6(AM087123|pid:none) Acidianus filamentous virus 8, par... 58 1e-06
AJ248286_177(AJ248286|pid:none) Pyrococcus abyssi complete genom... 58 1e-06
BA000001_1144(BA000001|pid:none) Pyrococcus horikoshii OT3 DNA, ... 57 1e-06
T27149(T27149)hypothetical protein Y54E2A.6 - Caenorhabditis ele... 57 1e-06
AY822649_1(AY822649|pid:none) Arabidopsis thaliana meiotic recom... 57 2e-06
CR380953_16(CR380953|pid:none) Candida glabrata strain CBS138 ch... 57 2e-06
AE017349_91(AE017349|pid:none) Cryptococcus neoformans var. neof... 57 2e-06
CP001196_223(CP001196|pid:none) Oligotropha carboxidovorans OM5 ... 57 2e-06
CP000254_571(CP000254|pid:none) Methanospirillum hungatei JF-1, ... 57 2e-06
CP000511_1610(CP000511|pid:none) Mycobacterium vanbaalenii PYR-1... 57 2e-06
AY051531_1(AY051531|pid:none) Drosophila melanogaster GH18520 fu... 57 2e-06
CP000561_1670(CP000561|pid:none) Pyrobaculum calidifontis JCM 11... 56 4e-06
CP001338_177(CP001338|pid:none) Candidatus Methanosphaerula palu... 56 4e-06
AM910994_671(AM910994|pid:none) Plasmodium knowlesi strain H chr... 56 4e-06
(O60072) RecName: Full=Putative helicase mug81; EC=3.6.... 55 5e-06
AL035477_19(AL035477|pid:none) Plasmodium falciparum MAL4P4. &A... 55 5e-06
CP000513_162(CP000513|pid:none) Dichelobacter nodosus VCS1703A, ... 55 6e-06
CP000504_612(CP000504|pid:none) Pyrobaculum islandicum DSM 4184,... 55 6e-06
T17399(T17399) probable DEAH ATP-dependent helicase vrlS - Diche... 55 6e-06
(Q54G57) RecName: Full=Activating signal cointegrator 1 complex ... 55 8e-06
AP009386_612(AP009386|pid:none) Burkholderia multivorans ATCC 17... 55 8e-06
CP000477_1208(CP000477|pid:none) Methanosaeta thermophila PT, co... 55 8e-06
CP001575_330(CP001575|pid:none) Micromonas sp. RCC299 chromosome... 55 8e-06
AL121965_1(AL121965|pid:none) Human DNA sequence from clone RP1-... 54 1e-05
CP000361_2136(CP000361|pid:none) Arcobacter butzleri RM4018, com... 54 1e-05
BC059917_1(BC059917|pid:none) Mus musculus activating signal coi... 54 1e-05
AP008208_1864(AP008208|pid:none) Oryza sativa (japonica cultivar... 54 1e-05
CP000562_418(CP000562|pid:none) Methanoculleus marisnigri JR1, c... 54 1e-05
FJ008126_1(FJ008126|pid:none) Oryza sativa Japonica Group cultiv... 54 1e-05
CP001069_108(CP001069|pid:none) Ralstonia pickettii 12J chromoso... 54 1e-05
BC132823_1(BC132823|pid:none) Homo sapiens HFM1, ATP-dependent D... 54 1e-05
CP000780_2233(CP000780|pid:none) Candidatus Methanoregula boonei... 54 2e-05
CP000077_1391(CP000077|pid:none) Sulfolobus acidocaldarius DSM 6... 54 2e-05
AE014187_368(AE014187|pid:none) Plasmodium falciparum 3D7 chromo... 53 2e-05
CP000250_2535(CP000250|pid:none) Rhodopseudomonas palustris HaA2... 53 2e-05
AP007162_213(AP007162|pid:none) Aspergillus oryzae RIB40 genomic... 53 2e-05
CP000088_710(CP000088|pid:none) Thermobifida fusca YX, complete ... 53 2e-05
CP001338_2002(CP001338|pid:none) Candidatus Methanosphaerula pal... 53 2e-05
AE009950_1051(AE009950|pid:none) Pyrococcus furiosus DSM 3638, c... 53 2e-05
AM270320_30(AM270320|pid:none) Aspergillus niger contig An14c013... 53 2e-05
AE016820_482(AE016820|pid:none) Ashbya gossypii (= Eremothecium ... 53 2e-05
AM114193_1965(AM114193|pid:none) Uncultured methanogenic archaeo... 53 2e-05
CP001359_1144(CP001359|pid:none) Anaeromyxobacter dehalogenans 2... 53 3e-05
CP001324_473(CP001324|pid:none) Micromonas sp. RCC299 chromosome... 53 3e-05
CP000561_1043(CP000561|pid:none) Pyrobaculum calidifontis JCM 11... 53 3e-05
CR382123_770(CR382123|pid:none) Kluyveromyces lactis strain NRRL... 53 3e-05
AP007151_603(AP007151|pid:none) Aspergillus oryzae RIB40 genomic... 53 3e-05
AM087122_4(AM087122|pid:none) Acidianus filamentous virus 7, par... 53 3e-05
CP000912_747(CP000912|pid:none) Brucella suis ATCC 23445 chromos... 52 4e-05
CP000562_1247(CP000562|pid:none) Methanoculleus marisnigri JR1, ... 52 4e-05
FM992689_376(FM992689|pid:none) Candida dubliniensis CD36 chromo... 52 4e-05
CP000780_1672(CP000780|pid:none) Candidatus Methanoregula boonei... 52 4e-05
AM087121_9(AM087121|pid:none) Acidianus filamentous virus 6, par... 52 4e-05
CP000393_3214(CP000393|pid:none) Trichodesmium erythraeum IMS101... 52 4e-05
AM910995_250(AM910995|pid:none) Plasmodium knowlesi strain H chr... 52 5e-05
CP000254_2422(CP000254|pid:none) Methanospirillum hungatei JF-1,... 52 5e-05
AY449461_9(AY449461|pid:none) Oikopleura dioica clone BACOIKO005... 52 5e-05
AL939128_161(AL939128|pid:none) Streptomyces coelicolor A3(2) co... 52 5e-05
CR378668_63(CR378668|pid:none) Photobacterium profundum SS9; seg... 52 5e-05
CP000759_1283(CP000759|pid:none) Ochrobactrum anthropi ATCC 4918... 52 5e-05
CP000559_1561(CP000559|pid:none) Methanocorpusculum labreanum Z,... 52 5e-05
(Q9U2G0) RecName: Full=Putative U5 small nuclear ribonucleoprote... 52 7e-05
AB006696_13(AB006696|pid:none) Arabidopsis thaliana genomic DNA,... 52 7e-05
CP001074_608(CP001074|pid:none) Rhizobium etli CIAT 652, complet... 52 7e-05
EU545650_10(EU545650|pid:none) Acidianus filamentous virus 9, co... 52 7e-05
CU928171_598(CU928171|pid:none) Kluyveromyces thermotolerans str... 51 9e-05
AY233333_19(AY233333|pid:none) Escherichia coli strain ECOR31 hi... 51 9e-05
CP000852_1842(CP000852|pid:none) Caldivirga maquilingensis IC-16... 51 9e-05
CP000682_2075(CP000682|pid:none) Metallosphaera sedula DSM 5348,... 51 9e-05
CP000493_942(CP000493|pid:none) Hyperthermus butylicus DSM 5456,... 51 9e-05
CP000504_944(CP000504|pid:none) Pyrobaculum islandicum DSM 4184,... 51 9e-05
AP008208_388(AP008208|pid:none) Oryza sativa (japonica cultivar-... 51 1e-04
CP000270_2628(CP000270|pid:none) Burkholderia xenovorans LB400 c... 51 1e-04
CP001014_1469(CP001014|pid:none) Thermoproteus neutrophilus V24S... 51 1e-04
CR555306_2836(CR555306|pid:none) Azoarcus sp. EbN1 complete geno... 51 1e-04
CP000301_3018(CP000301|pid:none) Rhodopseudomonas palustris BisB... 51 1e-04
AK302582_1(AK302582|pid:none) Homo sapiens cDNA FLJ50297 complet... 50 2e-04
CP000866_88(CP000866|pid:none) Nitrosopumilus maritimus SCM1, co... 50 2e-04
CP001615_3008(CP001615|pid:none) Exiguobacterium sp. AT1b, compl... 50 2e-04
AL591688_542(AL591688|pid:none) Sinorhizobium meliloti 1021 comp... 50 2e-04
CP000880_221(CP000880|pid:none) Salmonella enterica subsp. arizo... 50 2e-04
CP000559_754(CP000559|pid:none) Methanocorpusculum labreanum Z, ... 50 2e-04
CP000816_1165(CP000816|pid:none) Ignicoccus hospitalis KIN4/I, c... 50 2e-04
BA000011_644(BA000011|pid:none) Thermoplasma volcanium GSS1 DNA,... 50 2e-04
(P95949) RecName: Full=Uncharacterized ATP-dependent helicase SS... 50 2e-04
CP000384_1257(CP000384|pid:none) Mycobacterium sp. MCS, complete... 50 2e-04
AM920435_941(AM920435|pid:none) Penicillium chrysogenum Wisconsi... 50 2e-04
CP001034_1504(CP001034|pid:none) Natranaerobius thermophilus JW/... 50 2e-04
AM746676_7700(AM746676|pid:none) Sorangium cellulosum 'So ce 56'... 50 2e-04
CP000588_191(CP000588|pid:none) Ostreococcus lucimarinus CCE9901... 50 2e-04
CU928158_1325(CU928158|pid:none) Escherichia fergusonii ATCC 354... 50 3e-04
CP001399_2011(CP001399|pid:none) Sulfolobus islandicus L.S.2.15,... 50 3e-04
CP001401_1929(CP001401|pid:none) Sulfolobus islandicus M.16.27, ... 50 3e-04
CP000580_1282(CP000580|pid:none) Mycobacterium sp. JLS, complete... 50 3e-04
AY714861_9(AY714861|pid:none) Uncultured archaeon GZfos34H10 clo... 50 3e-04
CP001014_1301(CP001014|pid:none) Thermoproteus neutrophilus V24S... 50 3e-04
CU928163_1912(CU928163|pid:none) Escherichia coli UMN026 chromos... 50 3e-04
AM236080_588(AM236080|pid:none) Rhizobium leguminosarum bv. vici... 50 3e-04
AE008384_1917(AE008384|pid:none) Methanosarcina mazei strain Goe... 50 3e-04
CP000852_95(CP000852|pid:none) Caldivirga maquilingensis IC-167,... 49 3e-04
CP000609_1143(CP000609|pid:none) Methanococcus maripaludis C5, c... 49 3e-04
CP000866_940(CP000866|pid:none) Nitrosopumilus maritimus SCM1, c... 49 3e-04
CP001016_367(CP001016|pid:none) Beijerinckia indica subsp. indic... 49 3e-04
CP000284_1215(CP000284|pid:none) Methylobacillus flagellatus KT,... 49 3e-04
CP000530_148(CP000530|pid:none) Polaromonas naphthalenivorans CJ... 49 3e-04
AM270376_37(AM270376|pid:none) Aspergillus niger contig An16c024... 49 3e-04
CR936257_1991(CR936257|pid:none) Natronomonas pharaonis DSM 2160... 49 4e-04
BA000012_4344(BA000012|pid:none) Mesorhizobium loti MAFF303099 D... 49 4e-04
AE017224_382(AE017224|pid:none) Brucella abortus biovar 1 str. 9... 49 4e-04
CP000578_386(CP000578|pid:none) Rhodobacter sphaeroides ATCC 170... 49 4e-04
AP009179_1028(AP009179|pid:none) Sulfurovum sp. NBC37-1 genomic ... 49 4e-04
CP000319_1899(CP000319|pid:none) Nitrobacter hamburgensis X14, c... 49 4e-04
CP000660_1502(CP000660|pid:none) Pyrobaculum arsenaticum DSM 135... 49 4e-04
AE017333_2247(AE017333|pid:none) Bacillus licheniformis DSM 13, ... 49 4e-04
CP000970_1483(CP000970|pid:none) Escherichia coli SMS-3-5, compl... 49 6e-04
CP000816_191(CP000816|pid:none) Ignicoccus hospitalis KIN4/I, co... 49 6e-04
EU900478_1(EU900478|pid:none) Escherichia coli strain TB182A pro... 49 6e-04
CP001404_706(CP001404|pid:none) Sulfolobus islandicus Y.N.15.51,... 49 6e-04
CP000660_798(CP000660|pid:none) Pyrobaculum arsenaticum DSM 1351... 49 6e-04
CP000745_12(CP000745|pid:none) Methanococcus maripaludis C7, com... 49 6e-04
CP000053_378(CP000053|pid:none) Rickettsia felis URRWXCal2, comp... 49 6e-04
CP000248_3298(CP000248|pid:none) Novosphingobium aromaticivorans... 49 6e-04
(P32639) RecName: Full=Pre-mRNA-splicing helicase BRR2; ... 49 6e-04
EU900477_1(EU900477|pid:none) Escherichia coli strain 87-14 prob... 48 8e-04
AE008918_463(AE008918|pid:none) Brucella melitensis 16M chromoso... 48 8e-04
B97419(B97419)probable ATP-dependent helicase mj0294 [imported] ... 48 8e-04
BA000031_903(BA000031|pid:none) Vibrio parahaemolyticus RIMD 221... 48 8e-04
AC2637(AC2637) large atp-dependant helicase-related protein [imp... 48 8e-04
CP000477_521(CP000477|pid:none) Methanosaeta thermophila PT, com... 48 8e-04
AM180088_1816(AM180088|pid:none) Haloquadratum walsbyi DSM 16790... 48 8e-04
CP001037_3083(CP001037|pid:none) Nostoc punctiforme PCC 73102, c... 48 0.001
CP001140_1177(CP001140|pid:none) Desulfurococcus kamchatkensis 1... 48 0.001
CU928164_1396(CU928164|pid:none) Escherichia coli IAI39 chromoso... 48 0.001
BA000037_269(BA000037|pid:none) Vibrio vulnificus YJ016 DNA, chr... 47 0.001
FN357476_26(FN357476|pid:none) Schistosoma mansoni genome sequen... 47 0.002
CU638744_229(CU638744|pid:none) Podospora anserina genomic DNA c... 47 0.002
CP001510_2394(CP001510|pid:none) Methylobacterium extorquens AM1... 47 0.002
CP000769_1708(CP000769|pid:none) Anaeromyxobacter sp. Fw109-5, c... 47 0.002
AM420293_5017(AM420293|pid:none) Saccharopolyspora erythraea NRR... 47 0.002
AB018114_13(AB018114|pid:none) Arabidopsis thaliana genomic DNA,... 47 0.002
AE001437_767(AE001437|pid:none) Clostridium acetobutylicum ATCC ... 47 0.002
(O27830) RecName: Full=Uncharacterized ATP-dependent helicase MT... 47 0.002
AK294754_1(AK294754|pid:none) Homo sapiens cDNA FLJ50147 complet... 47 0.002
CP001400_1862(CP001400|pid:none) Sulfolobus islandicus M.14.25, ... 47 0.002
AE004437_966(AE004437|pid:none) Halobacterium sp. NRC-1, complet... 47 0.002
CP000412_1099(CP000412|pid:none) Lactobacillus delbrueckii subsp... 47 0.002
CP000102_350(CP000102|pid:none) Methanosphaera stadtmanae DSM 30... 47 0.002
BA000023_1530(BA000023|pid:none) Sulfolobus tokodaii str. 7 DNA,... 47 0.002
AY596297_1006(AY596297|pid:none) Haloarcula marismortui ATCC 430... 47 0.002
CR954253_1315(CR954253|pid:none) Lactobacillus delbrueckii subsp... 47 0.002
CP000155_3290(CP000155|pid:none) Hahella chejuensis KCTC 2396, c... 46 0.003
AY812381_1(AY812381|pid:none) Schistosoma japonicum SJCHGC05170 ... 46 0.003
CR954211_135(CR954211|pid:none) Ostreococcus tauri strain OTTH05... 46 0.003
(P50830) RecName: Full=Uncharacterized ATP-dependent helicase yp... 46 0.003
BX649197_32(BX649197|pid:none) uncultured archaeon clone 0418F12... 46 0.003
AP009493_1760(AP009493|pid:none) Streptomyces griseus subsp. gri... 46 0.003
AP008230_672(AP008230|pid:none) Desulfitobacterium hafniense Y51... 46 0.004
CP001132_1962(CP001132|pid:none) Acidithiobacillus ferrooxidans ... 46 0.004
AM849034_401(AM849034|pid:none) Clavibacter michiganensis subsp.... 46 0.004
BA000030_2506(BA000030|pid:none) Streptomyces avermitilis MA-468... 46 0.004
CP000099_925(CP000099|pid:none) Methanosarcina barkeri str. Fusa... 46 0.004
AY714837_24(AY714837|pid:none) Uncultured archaeon GZfos24D9 clo... 45 0.005
AE006914_901(AE006914|pid:none) Rickettsia conorii str. Malish 7... 45 0.005
EU016623_11(EU016623|pid:none) Uncultured marine microorganism H... 45 0.005
AL445064_259(AL445064|pid:none) Thermoplasma acidophilum complet... 45 0.005
CP000852_1276(CP000852|pid:none) Caldivirga maquilingensis IC-16... 45 0.005
CP000766_937(CP000766|pid:none) Rickettsia rickettsii str. Iowa,... 45 0.005
CP001227_442(CP001227|pid:none) Rickettsia peacockii str. Rustic... 45 0.005
CP000031_3028(CP000031|pid:none) Ruegeria pomeroyi DSS-3, comple... 45 0.006
CP000449_527(CP000449|pid:none) Maricaulis maris MCS10, complete... 45 0.006
CP000683_661(CP000683|pid:none) Rickettsia massiliae MTU5, compl... 45 0.006
CP000083_36(CP000083|pid:none) Colwellia psychrerythraea 34H, co... 45 0.006
CP000968_1294(CP000968|pid:none) Candidatus Korarchaeum cryptofi... 45 0.006
CP000505_1339(CP000505|pid:none) Thermofilum pendens Hrk 5, comp... 45 0.006
CP000697_1590(CP000697|pid:none) Acidiphilium cryptum JF-5, comp... 45 0.006
CP001157_965(CP001157|pid:none) Azotobacter vinelandii DJ, compl... 45 0.006
CP000481_1492(CP000481|pid:none) Acidothermus cellulolyticus 11B... 45 0.008
CP001293_134(CP001293|pid:none) Cyanothece sp. PCC 7424 plasmid ... 45 0.008
CP000562_1502(CP000562|pid:none) Methanoculleus marisnigri JR1, ... 45 0.008
CP001403_1788(CP001403|pid:none) Sulfolobus islandicus Y.G.57.14... 45 0.008
CU459003_3981(CU459003|pid:none) Magnetospirillum gryphiswaldens... 45 0.008
CP001339_150(CP001339|pid:none) Thioalkalivibrio sp. HL-EbGR7, c... 45 0.008
CP000682_54(CP000682|pid:none) Metallosphaera sedula DSM 5348, c... 45 0.008
AE017346_423(AE017346|pid:none) Cryptococcus neoformans var. neo... 45 0.008
CP000585_404(CP000585|pid:none) Ostreococcus lucimarinus CCE9901... 45 0.008
CP000820_6585(CP000820|pid:none) Frankia sp. EAN1pec, complete g... 45 0.008
CR382124_500(CR382124|pid:none) Kluyveromyces lactis strain NRRL... 44 0.011
CP000701_87(CP000701|pid:none) Sphingomonas wittichii RW1 plasmi... 44 0.011
BA000001_1370(BA000001|pid:none) Pyrococcus horikoshii OT3 DNA, ... 44 0.011
BA000023_441(BA000023|pid:none) Sulfolobus tokodaii str. 7 DNA, ... 44 0.011
CP000820_1202(CP000820|pid:none) Frankia sp. EAN1pec, complete g... 44 0.011
AE006470_1024(AE006470|pid:none) Chlorobium tepidum TLS, complet... 44 0.011
CP000413_1489(CP000413|pid:none) Lactobacillus gasseri ATCC 3332... 44 0.011
CP000316_2315(CP000316|pid:none) Polaromonas sp. JS666, complete... 44 0.011
CP001029_692(CP001029|pid:none) Methylobacterium populi BJ001, c... 44 0.011
CP001298_703(CP001298|pid:none) Methylobacterium chloromethanicu... 44 0.011
>CR382127_374(CR382127|pid:none) Yarrowia lipolytica strain CLIB122
chromosome A complete sequence.
Length = 1260
Score = 283 bits (723), Expect = 1e-74
Identities = 137/191 (71%), Positives = 166/191 (86%)
Frame = +3
Query: 18 KEITSPLSDLITNPAIEYPFDLDSFQKQAIVHMEQGESVFITAHTSAGKTVIAEYAIAMA 197
KEIT+ S+L+ PA E+PF+LD+FQK+A+ H+EQG+SVF+ AHTSAGKTVIAEYAIAMA
Sbjct: 268 KEITN-FSELVPQPAREFPFELDTFQKEAVYHLEQGDSVFVAAHTSAGKTVIAEYAIAMA 326
Query: 198 AKNMTRAIYTSPIKALSNQKFRDFKNTSNDVGLITGDVSISPSSSCLVLTTEILRSMLYK 377
+NMT+AIYTSPIKALSNQKFRDFK+ +DVG++TGDV I+ +S L++TTEILRSMLY+
Sbjct: 327 QRNMTKAIYTSPIKALSNQKFRDFKSEFDDVGILTGDVQINAEASSLIMTTEILRSMLYR 386
Query: 378 GADLIRDIEWVIFDEVHYLNDLERGVVWEEVIIMLPPYVKMVFLSATVSNPLEFAQWIGR 557
GADLIRD+E+VIFDEVHY+ND +RGVVWEEVIIMLP +VK + LSATV N EFA W+GR
Sbjct: 387 GADLIRDVEFVIFDEVHYVNDADRGVVWEEVIIMLPEHVKFILLSATVPNTFEFANWVGR 446
Query: 558 TKQLPIYVIGT 590
TKQ IYVI T
Sbjct: 447 TKQKDIYVIST 457
Score = 176 bits (445), Expect = 2e-42
Identities = 92/228 (40%), Positives = 150/228 (65%), Gaps = 4/228 (1%)
Frame = +3
Query: 690 YEQTEKRYQLQYAIRDAKYTASDENLKLMPQFNIRLDILHELGYIDDENTVTLKGRVSRE 869
Y Q + YQL+ I + + + +DENL+L+P + R+++L +L Y+D N V LKGRV+ E
Sbjct: 1034 YTQEYEEYQLKETIANLRKSLNDENLELLPDYEQRVEVLKDLNYVDTNNIVLLKGRVACE 1093
Query: 870 INTCEDLVITELIFENAFINLEPSEVVSVLSCLIFQ-EKDAVQP-SLTPRLEEAKQNLIK 1043
+N+ +L I+EL+ +N + EP E+V++LS +++ +D +P S+TPRL++ ++ + +
Sbjct: 1094 VNSGFELFISELVMDNFLGDYEPEEIVALLSAFVYEGSRDVEEPVSVTPRLDKGRERIKE 1153
Query: 1044 TAEKTYKVESDKGLDVVPDDK--LETTLKFGLMQVVYEWARGTPFNDICTLTNVLEGSIV 1217
V + + + D++ LE +FGL++VVYEWARG F I LT+ EG IV
Sbjct: 1154 LVANVMDVLEKRQVIMTSDEQQFLERG-RFGLIEVVYEWARGMTFEAISELTSAQEGIIV 1212
Query: 1218 RAITRIGETCQEVRNAARVIGDTKLLQKMEEAMRLIKRDIVFTSSLYV 1361
R ++R+ E C+EV++AAR+IGD L +KM+ A IKRDI+F +SLY+
Sbjct: 1213 RVVSRLDEVCREVKSAARIIGDATLQEKMDVAQEKIKRDIIFCASLYL 1260
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3236559
Number of Hits to DB: 2,082,650,964
Number of extensions: 40160743
Number of successful extensions: 102965
Number of sequences better than 10.0: 955
Number of HSP's gapped: 102182
Number of HSP's successfully gapped: 1089
Length of query: 472
Length of database: 1,051,180,864
Length adjustment: 132
Effective length of query: 340
Effective length of database: 623,955,076
Effective search space: 212144725840
Effective search space used: 212144725840
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 32 (16.9 bits)
|