| Contig-U11361-1 |
| Contig ID |
Contig-U11361-1 |
| Contig update |
2002.12.18 |
| Contig sequence |
 |
| Gap |
gap included |
| Contig length |
2542 |
| Chromosome number (1..6, M) |
4 |
| Chromosome length |
5430582 |
| Start point |
2679678 |
| End point |
2677129 |
| Strand (PLUS/MINUS) |
MINUS |
| Number of clones |
31 |
| Number of EST |
45 |
| Link to clone list |
U11361 |
| List of clone(s) |
est1=VHH689F,1,102
est2=VFN895E,2,1040
est3=AHJ767F,18,567
est4=VHJ295F,20,571
est5=VHA378F,33,666
est6=AHG784F,34,567
est7=VHA530F,34,678
est8=VHJ548F,34,566
est9=VHE308F,36,697
est10=VHA286F,38,570
est11=VHN313F,39,567
est12=VFB812F,42,511
est13=VHD642F,42,660
est14=VHG656F,42,567
est15=VHJ840F,42,570
est16=VFL862F,47,376
est17=AHJ320F,48,712
est18=VFO355E,48,1057
est19=VHH246F,72,711
est20=VHB317F,76,711
est21=VHN392F,190,696
est22=VHM636F,206,747
est23=VHL424F,265,702
est24=VFN584F,483,1030
est25=VFI859F,485,1061
est26=VFL862Z,521,1144
est27=VFB812Z,641,1138
est28=VFI859Z,1049,1767
est29=VHA286Z,1768,2532
est30=VHA839Z,1786,2542
est31=VHI717Z,1806,2546
est32=VHB317Z,1808,2546
est33=VHM636Z,1808,2546
est34=AHJ320Z,1809,2541
est35=VHA378Z,1809,2544
est36=VHJ548Z,1812,2542
est37=CHL789Z,1829,2540
est38=VHN392Z,1829,2546
est39=VHE308Z,1842,2546
est40=AHG784Z,1860,2542
est41=VHF591Z,1861,2496
est42=VHF428Z,1862,2542
est43=VHF130Z,1864,2496
est44=VHH246Z,1869,2545
est45=VHG656Z,1908,2541
|
| Translated Amino Acid sequence |
|
| Translated Amino Acid sequence (All Frames) |
|
| own update |
2004. 6.10 |
| Homology vs CSM-cDNA |
|
| dna update |
2008.11.24 |
| Homology vs DNA |
Query= Contig-U11361-1 (Contig-U11361-1Q) /CSM_Contig/Contig-U11361-1Q.Seq.d
(2552 letters)
Database: ddbj_A
92,845,959 sequences; 95,242,211,685 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value N
(BJ335143) Dictyostelium discoideum cDNA clone:dda49h05, 5' ... 1318 0.0 1
(BJ420409) Dictyostelium discoideum cDNA clone:ddv39p01, 5' ... 1306 0.0 1
(BJ418328) Dictyostelium discoideum cDNA clone:ddv32k07, 5' ... 1279 0.0 1
(BJ422268) Dictyostelium discoideum cDNA clone:ddv45k12, 5' ... 1269 0.0 1
(BJ418512) Dictyostelium discoideum cDNA clone:ddv33b05, 5' ... 1261 0.0 1
(BJ418175) Dictyostelium discoideum cDNA clone:ddv31l19, 5' ... 1255 0.0 1
(BJ420112) Dictyostelium discoideum cDNA clone:ddv38c12, 5' ... 1227 0.0 1
(BJ436048) Dictyostelium discoideum cDNA clone:ddv29n13, 3' ... 1217 0.0 3
(BJ435914) Dictyostelium discoideum cDNA clone:ddv28n24, 3' ... 1213 0.0 1
(BJ434683) Dictyostelium discoideum cDNA clone:ddv24l16, 3' ... 1193 0.0 1
(BJ414259) Dictyostelium discoideum cDNA clone:ddv18f16, 5' ... 1144 0.0 1
(BJ417795) Dictyostelium discoideum cDNA clone:ddv28g21, 5' ... 1086 0.0 1
(BJ423646) Dictyostelium discoideum cDNA clone:ddv49m24, 5' ... 1082 0.0 1
(BJ417824) Dictyostelium discoideum cDNA clone:ddv28n24, 5' ... 1068 0.0 1
(BJ335526) Dictyostelium discoideum cDNA clone:dda50f17, 5' ... 1066 0.0 1
(BJ334022) Dictyostelium discoideum cDNA clone:dda44h21, 5' ... 1059 0.0 1
(BJ423800) Dictyostelium discoideum cDNA clone:ddv50o11, 5' ... 1057 0.0 1
(BJ418172) Dictyostelium discoideum cDNA clone:ddv31k22, 5' ... 1049 0.0 1
(BJ426092) Dictyostelium discoideum cDNA clone:ddv57j03, 5' ... 1043 0.0 1
(BJ422060) Dictyostelium discoideum cDNA clone:ddv44o14, 5' ... 1043 0.0 1
(BJ425623) Dictyostelium discoideum cDNA clone:ddv56g10, 5' ... 1041 0.0 1
(BJ423805) Dictyostelium discoideum cDNA clone:ddv50p10, 5' ... 1041 0.0 1
(BJ444421) Dictyostelium discoideum cDNA clone:ddv56g10, 3' ... 987 0.0 6
(BJ442617) Dictyostelium discoideum cDNA clone:ddv50o11, 3' ... 987 0.0 3
(BJ441831) Dictyostelium discoideum cDNA clone:ddv48b05, 3' ... 987 0.0 3
(BJ441006) Dictyostelium discoideum cDNA clone:ddv45k12, 3' ... 987 0.0 2
(BJ439024) Dictyostelium discoideum cDNA clone:ddv39p01, 3' ... 987 0.0 3
(BJ437039) Dictyostelium discoideum cDNA clone:ddv33b05, 3' ... 987 0.0 3
(BJ436852) Dictyostelium discoideum cDNA clone:ddv32n10, 3' ... 987 0.0 3
(BJ382747) Dictyostelium discoideum cDNA clone:ddc45b23, 3' ... 987 0.0 3
(BJ353135) Dictyostelium discoideum cDNA clone:dda49h05, 3' ... 987 0.0 3
(BJ351859) Dictyostelium discoideum cDNA clone:dda44h21, 3' ... 987 0.0 2
(BJ439723) Dictyostelium discoideum cDNA clone:ddv41k07, 3' ... 981 0.0 2
(BJ436672) Dictyostelium discoideum cDNA clone:ddv31l19, 3' ... 975 0.0 3
(BJ440777) Dictyostelium discoideum cDNA clone:ddv44o14, 3' ... 959 0.0 2
(BJ440152) Dictyostelium discoideum cDNA clone:ddv42e23, 3' ... 954 0.0 2
(BJ444913) Dictyostelium discoideum cDNA clone:ddv57h23, 3' ... 894 0.0 6
(BJ439707) Dictyostelium discoideum cDNA clone:ddv41h08, 3' ... 729 0.0 3
(BJ436669) Dictyostelium discoideum cDNA clone:ddv31k22, 3' ... 708 0.0 4
(BJ432394) Dictyostelium discoideum cDNA clone:ddv18f16, 3' ... 640 0.0 3
(BJ426016) Dictyostelium discoideum cDNA clone:ddv57h23, 5' ... 1005 0.0 1
(BJ417164) Dictyostelium discoideum cDNA clone:ddv29n13, 5' ... 993 0.0 1
(BJ429593) Dictyostelium discoideum cDNA clone:ddv4h04, 3' e... 938 0.0 1
(BJ411361) Dictyostelium discoideum cDNA clone:ddv4h04, 5' e... 906 0.0 1
(BJ424684) Dictyostelium discoideum cDNA clone:ddv53p06, 5' ... 753 0.0 2
(BJ416033) Dictyostelium discoideum cDNA clone:ddv24l16, 5' ... 613 e-174 2
(AR549455) Sequence 4586 from patent US 6747137. 84 6e-23 7
(BJ422691) Dictyostelium discoideum cDNA clone:ddv46a24, 5' ... 117 2e-21 1
(AX488917) Sequence 6217 from Patent WO02053728. 84 1e-20 7
(CB284695) DF1483 Dermatophagoides farinae cDNA library Derm... 66 5e-13 4
(BQ640813) TVEST006.B12 Tv30236_PT cDNA Library Trichomonas ... 62 3e-12 2
(BQ621473) TVEST006.B01 Tv30236_PT cDNA Library Trichomonas ... 62 3e-12 2
(DB747335) Apis mellifera head cDNA, RIKEN full-length enric... 56 6e-12 5
(EE133491) SiJWH07ADU Lausanne fire ant library Solenopsis i... 46 5e-10 4
(DT662586) He_wd2a1_74D09_M13R Heliconius erato wing disk 2 ... 44 1e-09 5
(AJ223010) Schizosaccharomyces pombe pmt2 gene. 46 1e-07 5
(EL596939) He_pwd_0169E02_M13R Heliconius erato pooled wing ... 36 2e-07 5
(AF307954) Saccharomyces servazzii 46.1 kDa protein, KAR4-li... 46 1e-06 6
(EL599307) He_pwd_0235D04_M13R Heliconius erato pooled wing ... 40 4e-06 4
(CZ544373) SRAA-aad55e06.g1 Strongyloides ratti whole genome... 66 7e-06 1
(CZ529120) SRAA-aac59d05.b1 Strongyloides ratti whole genome... 66 7e-06 1
(FH068440) CHO_OF3656xo14f1.ab1 CHO_OF3 Nicotiana tabacum ge... 62 1e-04 1
(BF187287) EST443574 potato stolon, Cornell University Solan... 62 1e-04 1
(ES451662) 26632 Myzus persicae 2001-12 (red), Fenton Myzus ... 48 2e-04 4
(DW096756) CLPY7767.b1_M21.ab1 CLP(XYZ) lettuce perennis Lac... 48 4e-04 4
(CZ946868) 298335 Tomato EcoRI BAC Library Solanum lycopersi... 60 4e-04 1
(CZ937624) 257298 Tomato EcoRI BAC Library Solanum lycopersi... 60 4e-04 1
(DB726239) Solanum lycopersicum cDNA, clone: LEFL2051M13, 5'... 60 4e-04 1
(DB720240) Solanum lycopersicum cDNA, clone: LEFL2034E17, 5'... 60 4e-04 1
(DB717993) Solanum lycopersicum cDNA, clone: LEFL2027K08, 5'... 60 4e-04 1
(BP879287) Solanum lycopersicum cDNA, clone: FA14BB09, 5' en... 60 4e-04 1
(BI920415) EST540350 potato microtubers, in vitro-grown Sola... 60 4e-04 1
(AC005139) Plasmodium falciparum chromosome 12, *** SEQUENCI... 40 0.001 16
(AM644376) Entamoeba moshkovskii FIC GSS, clone mosh009f06.q1k. 48 0.001 3
(CR940353) Theileria annulata genomic DNA chromosome 4. 44 0.001 2
(CF099307) rd70b01.y2 Meloidogyne incognita parasitic adult ... 52 0.001 3
(CJ396086) Molgula tectiformis cDNA, gonad clone:mtgd027e18,... 44 0.001 3
(BQ613234) rd03g08.y1 Meloidogyne incognita egg SL1 TOPO v1 ... 52 0.001 3
(CF099919) rd69f11.y2 Meloidogyne incognita parasitic adult ... 52 0.001 3
(CF099723) rd82d04.y1 Meloidogyne incognita parasitic adult ... 52 0.001 3
(CF099648) rd79a10.y1 Meloidogyne incognita parasitic adult ... 52 0.001 3
(EJ319519) 1095403341982 Global-Ocean-Sampling_GS-27-01-01-1... 58 0.002 1
(FE236985) CAPG4156.fwd CAPG Naegleria gruberi amoeba stage ... 52 0.002 3
(DR135507) 49259542 Drosophila pseudoobscura embryonic cDNA ... 44 0.002 2
(AC005507) Plasmodium falciparum chromosome 12 clone 3D7, **... 32 0.003 16
(CP000776) Campylobacter hominis ATCC BAA-381, complete genome. 42 0.003 21
(DC448333) Gryllus bimaculatus mRNA, clone:GBpAP011_C18, uns... 42 0.005 3
(AQ450296) 500010B06.x1 CpIOWAM13mp18gDNA1 Cryptosporidium p... 44 0.005 3
(AL439658) T3 end of clone BD0AA007A05 of library BD0AA from... 52 0.006 2
(AC121244) Medicago truncatula clone mth2-31b9, complete seq... 52 0.006 8
(EE003359) ROE00002150 Rhizopus oryzae Company Rhizopus oryz... 56 0.007 1
(CF387383) RTDR1_12_H08.g1_A015 Loblolly pine roots recoveri... 56 0.007 1
(DC441670) Gryllus bimaculatus mRNA, clone:GB00364-35_C03, 5... 42 0.012 3
(EC820471) SME00004985 esmbsro2 Sawyeria marylandensis cDNA,... 36 0.013 3
(CD749417) rd54d04.y1 Meloidogyne incognita parasitic adult ... 52 0.013 2
(AL111693) Botrytis cinerea strain T4 cDNA library. 54 0.015 2
(CF099392) rd72d01.y2 Meloidogyne incognita parasitic adult ... 52 0.016 2
(EC818997) SME00003383 esmbsro2 Sawyeria marylandensis cDNA,... 36 0.017 3
(BH167047) ENTTP81TF Entamoeba histolytica Sheared DNA Entam... 46 0.018 4
(EC820521) SME00000049 esmbsro2 Sawyeria marylandensis cDNA,... 36 0.022 3
>(BJ335143) Dictyostelium discoideum cDNA clone:dda49h05, 5' end,
single read.
Length = 665
Score = 1318 bits (665), Expect = 0.0
Identities = 665/665 (100%)
Strand = Plus / Plus
Query: 47 gtattaataaatatagatacacatatatataaactaaaatgggtcaaaagaaaaagaagt 106
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1 gtattaataaatatagatacacatatatataaactaaaatgggtcaaaagaaaaagaagt 60
Query: 107 tagccaagggtcgtttagataagttttactatatggccaaagagcaaggttatagatctc 166
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 61 tagccaagggtcgtttagataagttttactatatggccaaagagcaaggttatagatctc 120
Query: 167 gtgctgctttcaaattaattcaattaaataaaaaatacaattttttgggtaccgcaaaag 226
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 121 gtgctgctttcaaattaattcaattaaataaaaaatacaattttttgggtaccgcaaaag 180
Query: 227 cttgtttagatctttgtgctgcaccaggtggttggatgcaagttgcatcaaaatatatgc 286
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 181 cttgtttagatctttgtgctgcaccaggtggttggatgcaagttgcatcaaaatatatgc 240
Query: 287 cagttcaatcattaattgttggtgtagatttagtaccaattagacaagttagaaattgta 346
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 241 cagttcaatcattaattgttggtgtagatttagtaccaattagacaagttagaaattgta 300
Query: 347 ttggtttaacagaagatattacaacacaaaagtgtagaacagagattaaaaaagcattga 406
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 301 ttggtttaacagaagatattacaacacaaaagtgtagaacagagattaaaaaagcattga 360
Query: 407 aaacatggaaagttgatgtatgtttacatgatggtgcaccaaatatgggtacatcatggg 466
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 361 aaacatggaaagttgatgtatgtttacatgatggtgcaccaaatatgggtacatcatggg 420
Query: 467 tacaagatgcatatcaacaagcggaattaactttacatgcattaaagttggcaactgaat 526
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 421 tacaagatgcatatcaacaagcggaattaactttacatgcattaaagttggcaactgaat 480
Query: 527 tccttactactggtggttggtttgtaactaaagttttcagaggctcagattataattcat 586
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 481 tccttactactggtggttggtttgtaactaaagttttcagaggctcagattataattcat 540
Query: 587 tgatttgggtattcaacaaactctttaaaaaagttgaatctactaaaccaccatcatcac 646
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 541 tgatttgggtattcaacaaactctttaaaaaagttgaatctactaaaccaccatcatcac 600
Query: 647 gtaatgcatcagcagagattttcgtagtttgtcaaggctttttgaatccaaagagaatcg 706
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 601 gtaatgcatcagcagagattttcgtagtttgtcaaggctttttgaatccaaagagaatcg 660
Query: 707 atcca 711
|||||
Sbjct: 661 atcca 665
Lambda K H
1.37 0.711 1.31
Matrix: blastn matrix:1 -3
Number of Sequences: 92845959
Number of Hits to DB: 3,188,048,606
Number of extensions: 205503487
Number of successful extensions: 19046666
Number of sequences better than 10.0: 587
Length of query: 2552
Length of database: 95,242,211,685
Length adjustment: 25
Effective length of query: 2527
Effective length of database: 97,216,030,006
Effective search space: 245664907825162
Effective search space used: 245664907825162
X1: 11 (21.8 bits)
S2: 23 (46.1 bits)
|
| protein update |
2009. 6.29 |
| Homology vs Protein |
Query= Contig-U11361-1 (Contig-U11361-1Q) /CSM_Contig/Contig-U11361-1Q.Seq.d
(2552 letters)
Database: nrp_A
3,204,285 sequences; 1,040,966,779 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
(Q54NX0) RecName: Full=rRNA methyltransferase 3 homolog; ... 733 0.0
(Q4P6G5) RecName: Full=AdoMet-dependent rRNA methyltransferase S... 340 2e-91
(Q5ZKM1) RecName: Full=Putative rRNA methyltransferase 3; ... 337 2e-90
(Q5RJT2) RecName: Full=Putative rRNA methyltransferase 3; ... 331 7e-89
(Q5RAS1) RecName: Full=Putative rRNA methyltransferase 3; ... 329 3e-88
AK027463_1(AK027463|pid:none) Homo sapiens cDNA FLJ14557 fis, cl... 329 3e-88
BC012281_1(BC012281|pid:none) Mus musculus FtsJ homolog 3 (E. co... 328 6e-88
BC118406_1(BC118406|pid:none) Bos taurus FtsJ homolog 3 (E. coli... 328 6e-88
AP007166_278(AP007166|pid:none) Aspergillus oryzae RIB40 genomic... 328 8e-88
AB173423_1(AB173423|pid:none) Macaca fascicularis brain cDNA clo... 328 8e-88
(O42832) RecName: Full=AdoMet-dependent rRNA methyltransferase s... 326 2e-87
(Q9P6V8) RecName: Full=AdoMet-dependent rRNA methyltransferase s... 325 7e-87
T48834(T48834)hypothetical protein 68B2.180 [imported] - Neurosp... 325 7e-87
(Q4WVH3) RecName: Full=AdoMet-dependent rRNA methyltransferase s... 324 1e-86
(P25582) RecName: Full=AdoMet-dependent rRNA methyltransferase S... 324 1e-86
AM920436_722(AM920436|pid:none) Penicillium chrysogenum Wisconsi... 322 3e-86
(Q6BNQ8) RecName: Full=AdoMet-dependent rRNA methyltransferase S... 321 9e-86
(Q751U1) RecName: Full=AdoMet-dependent rRNA methyltransferase S... 320 2e-85
(Q6CV12) RecName: Full=AdoMet-dependent rRNA methyltransferase S... 317 2e-84
FM992693_398(FM992693|pid:none) Candida dubliniensis CD36 chromo... 315 5e-84
CP000500_379(CP000500|pid:none) Pichia stipitis CBS 6054 chromos... 314 9e-84
CU640366_349(CU640366|pid:none) Podospora anserina genomic DNA c... 314 1e-83
BC070677_1(BC070677|pid:none) Xenopus laevis hypothetical protei... 311 7e-83
BC124922_1(BC124922|pid:none) Xenopus laevis hypothetical protei... 311 7e-83
BC160685_1(BC160685|pid:none) Xenopus laevis hypothetical protei... 311 7e-83
CU928170_23(CU928170|pid:none) Kluyveromyces thermotolerans stra... 310 2e-82
CR954216_60(CR954216|pid:none) Ostreococcus tauri strain OTTH059... 301 8e-80
(Q5KM86) RecName: Full=AdoMet-dependent rRNA methyltransferase S... 300 2e-79
(Q6C9Q1) RecName: Full=AdoMet-dependent rRNA methyltransferase S... 292 4e-77
AC186746_2(AC186746|pid:none) Musa acuminata clone MA4_25J11, co... 291 6e-77
AC006651_6(AC006651|pid:none) Caenorhabditis elegans fosmid H06I... 290 2e-76
AP008211_1978(AP008211|pid:none) Oryza sativa (japonica cultivar... 286 3e-75
AC120986_13(AC120986|pid:none) Oryza sativa (japonica cultivar-g... 286 3e-75
FN357404_11(FN357404|pid:none) Schistosoma mansoni genome sequen... 271 1e-70
BT062246_1(BT062246|pid:none) Zea mays full-length cDNA clone ZM... 265 8e-69
AL049480_1(AL049480|pid:none) Arabidopsis thaliana DNA chromosom... 261 7e-68
T04227(T04227)hypothetical protein F14M19.10 - Arabidopsis thali... 261 7e-68
AJ720063_1(AJ720063|pid:none) Gallus gallus mRNA for hypothetica... 258 8e-67
CP001327_76(CP001327|pid:none) Micromonas sp. RCC299 chromosome ... 253 2e-65
CR940353_761(CR940353|pid:none) Theileria annulata strain Ankara... 252 4e-65
AM494964_216(AM494964|pid:none) Leishmania braziliensis chromoso... 247 1e-63
AM502245_168(AM502245|pid:none) Leishmania infantum chromosome 27. 246 2e-63
FN313785_1(FN313785|pid:none) Schistosoma japonicum isolate Anhu... 244 1e-62
AL590447_135(AL590447|pid:none) chromosome VII of strain GB-M1 o... 234 2e-59
AM055943_69(AM055943|pid:none) Toxoplasma gondii RH, genomic DNA... 229 3e-58
AL844509_529(AL844509|pid:none) Plasmodium falciparum 3D7 chromo... 221 1e-55
EU976481_1(EU976481|pid:none) Zea mays clone 895794 unknown mRNA. 170 2e-40
AJ223010_1(AJ223010|pid:none) Schizosaccharomyces pombe pmt2 gen... 157 2e-36
A90135(A90135) SAM-dependent methyltransferase [imported] - Guil... 153 3e-35
AE016820_404(AE016820|pid:none) Ashbya gossypii (= Eremothecium ... 150 2e-34
CR382126_791(CR382126|pid:none) Kluyveromyces lactis strain NRRL... 150 3e-34
(P38238) RecName: Full=tRNA (uridine-2'-O-)-methyltransferase TR... 141 1e-31
CU928167_214(CU928167|pid:none) Kluyveromyces thermotolerans str... 140 2e-31
BT077658_1(BT077658|pid:none) Lepeophtheirus salmonis clone lsal... 140 2e-31
(Q58771) RecName: Full=Ribosomal RNA large subunit methyltransfe... 139 5e-31
AB170226_1(AB170226|pid:none) Macaca fascicularis brain cDNA clo... 139 7e-31
DQ443163_1(DQ443163|pid:none) Bombyx mori cell division protein ... 139 7e-31
AF063015_1(AF063015|pid:none) Homo sapiens cell division protein... 139 7e-31
(Q9UET6) RecName: Full=Putative ribosomal RNA methyltransferase ... 139 7e-31
AL805902_2(AL805902|pid:none) Mouse DNA sequence from clone RP23... 138 9e-31
BT002330_1(BT002330|pid:none) Arabidopsis thaliana clone C105386... 138 1e-30
CR380954_443(CR380954|pid:none) Candida glabrata strain CBS138 c... 138 1e-30
FJ168556_3(FJ168556|pid:none) Bodo saltans clone fosmid 93E01, c... 137 1e-30
FN392321_974(FN392321|pid:none) Pichia pastoris GS115 chromosome... 137 2e-30
FM992690_693(FM992690|pid:none) Candida dubliniensis CD36 chromo... 136 3e-30
CR857732_1(CR857732|pid:none) Pongo abelii mRNA; cDNA DKFZp469K1... 136 4e-30
AY087952_1(AY087952|pid:none) Arabidopsis thaliana clone 39878 m... 136 4e-30
CP000867_281(CP000867|pid:none) Methanococcus maripaludis C6, co... 135 7e-30
CU928181_268(CU928181|pid:none) Zygosaccharomyces rouxii strain ... 135 1e-29
CP000585_348(CP000585|pid:none) Ostreococcus lucimarinus CCE9901... 135 1e-29
(A6VJR0) RecName: Full=Ribosomal RNA large subunit methyltransfe... 134 2e-29
BC153564_1(BC153564|pid:none) Danio rerio FtsJ homolog 1 (E. col... 134 2e-29
BC085449_1(BC085449|pid:none) Danio rerio FtsJ homolog 1 (E. col... 134 2e-29
(A4FYM2) RecName: Full=Ribosomal RNA large subunit methyltransfe... 130 2e-28
B88422(B88422)protein R74.7 [imported] - Caenorhabditis elegans 129 4e-28
(A6USA0) RecName: Full=Ribosomal RNA large subunit methyltransfe... 129 4e-28
AL834482_1(AL834482|pid:none) Homo sapiens mRNA; cDNA DKFZp762O0... 129 7e-28
(Q8TR92) RecName: Full=Ribosomal RNA large subunit methyltransfe... 127 3e-27
(Q8PUP4) RecName: Full=Ribosomal RNA large subunit methyltransfe... 124 2e-26
(Q0W1F9) RecName: Full=Ribosomal RNA large subunit methyltransfe... 123 4e-26
CR382132_669(CR382132|pid:none) Yarrowia lipolytica strain CLIB1... 123 4e-26
AY810426_1(AY810426|pid:none) Schistosoma japonicum SJCHGC03585 ... 122 6e-26
FN314508_1(FN314508|pid:none) Schistosoma japonicum isolate Anhu... 122 6e-26
CP001159_234(CP001159|pid:none) Thalassiosira pseudonana CCMP133... 122 6e-26
FN357350_35(FN357350|pid:none) Schistosoma mansoni genome sequen... 122 8e-26
(Q12WR3) RecName: Full=Ribosomal RNA large subunit methyltransfe... 122 8e-26
(Q9VDD9) RecName: Full=Putative ribosomal RNA methyltransferase ... 119 5e-25
(Q466Q1) RecName: Full=Ribosomal RNA large subunit methyltransfe... 119 7e-25
AY119225_1(AY119225|pid:none) Drosophila melanogaster SD16956 fu... 119 7e-25
CP001365_431(CP001365|pid:none) Halorubrum lacusprofundi ATCC 49... 117 2e-24
DQ158856_105(DQ158856|pid:none) Bigelowiella natans nucleomorph ... 117 2e-24
CR954205_354(CR954205|pid:none) Ostreococcus tauri strain OTTH05... 116 5e-24
CP000078_39(CP000078|pid:none) Leishmania major strain Friedlin ... 115 6e-24
(Q3IT24) RecName: Full=Ribosomal RNA large subunit methyltransfe... 115 6e-24
(A5VFI9) RecName: Full=Ribosomal RNA large subunit methyltransfe... 115 6e-24
BC011144_1(BC011144|pid:none) Mus musculus FtsJ homolog 1 (E. co... 115 1e-23
(Q5UYP9) RecName: Full=Ribosomal RNA large subunit methyltransfe... 114 1e-23
(Q2NHD6) RecName: Full=Ribosomal RNA large subunit methyltransfe... 114 2e-23
AM494939_41(AM494939|pid:none) Leishmania braziliensis chromosom... 114 2e-23
(Q18E61) RecName: Full=Ribosomal RNA large subunit methyltransfe... 114 2e-23
AL137189_22(AL137189|pid:none) Arabidopsis thaliana DNA chromoso... 114 2e-23
(A5UKI5) RecName: Full=Ribosomal RNA large subunit methyltransfe... 113 3e-23
(Q4FMX1) RecName: Full=Ribosomal RNA large subunit methyltransfe... 113 4e-23
CP001050_542(CP001050|pid:none) Neisseria gonorrhoeae NCCP11945,... 112 7e-23
(Q5NQH8) RecName: Full=Ribosomal RNA large subunit methyltransfe... 112 7e-23
(Q5F9L0) RecName: Full=Ribosomal RNA large subunit methyltransfe... 112 7e-23
(Q5FNQ1) RecName: Full=Ribosomal RNA large subunit methyltransfe... 112 9e-23
(Q2GB53) RecName: Full=Ribosomal RNA large subunit methyltransfe... 111 1e-22
(A1KT57) RecName: Full=Ribosomal RNA large subunit methyltransfe... 111 1e-22
(Q48E69) RecName: Full=Ribosomal RNA large subunit methyltransfe... 111 1e-22
AM181176_5144(AM181176|pid:none) Pseudomonas fluorescens SBW25 c... 110 2e-22
BT070128_1(BT070128|pid:none) Zea mays full-length cDNA clone ZM... 110 3e-22
EF107105_25(EF107105|pid:none) Uncultured marine bacterium EB80_... 110 3e-22
BT068985_1(BT068985|pid:none) Zea mays full-length cDNA clone ZM... 110 3e-22
(A2SSW7) RecName: Full=Ribosomal RNA large subunit methyltransfe... 109 4e-22
(Q086I0) RecName: Full=Ribosomal RNA large subunit methyltransfe... 109 4e-22
CP001029_3580(CP001029|pid:none) Methylobacterium populi BJ001, ... 109 4e-22
(O28228) RecName: Full=Ribosomal RNA large subunit methyltransfe... 109 4e-22
(A5F937) RecName: Full=Ribosomal RNA large subunit methyltransfe... 109 6e-22
(Q4KIG3) RecName: Full=Ribosomal RNA large subunit methyltransfe... 108 1e-21
(Q3SJR5) RecName: Full=Ribosomal RNA large subunit methyltransfe... 108 1e-21
AM889285_1865(AM889285|pid:none) Gluconacetobacter diazotrophicu... 107 2e-21
AL844509_95(AL844509|pid:none) Plasmodium falciparum 3D7 chromos... 107 2e-21
(Q6G0S9) RecName: Full=Ribosomal RNA large subunit methyltransfe... 107 3e-21
(B0KHY6) RecName: Full=Ribosomal RNA large subunit methyltransfe... 106 5e-21
(A9N8M5) RecName: Full=Ribosomal RNA large subunit methyltransfe... 105 1e-20
FM954972_2366(FM954972|pid:none) Vibrio splendidus LGP32 chromos... 105 1e-20
(A9KGE6) RecName: Full=Ribosomal RNA large subunit methyltransfe... 105 1e-20
(Q3J823) RecName: Full=Ribosomal RNA large subunit methyltransfe... 105 1e-20
(A1RGW7) RecName: Full=Ribosomal RNA large subunit methyltransfe... 104 1e-20
(Q2N843) RecName: Full=Ribosomal RNA large subunit methyltransfe... 104 1e-20
(Q8EHM3) RecName: Full=Ribosomal RNA large subunit methyltransfe... 104 1e-20
(B8CKG5) RecName: Full=Ribosomal RNA large subunit methyltransfe... 104 2e-20
(A7HSA5) RecName: Full=Ribosomal RNA large subunit methyltransfe... 104 2e-20
(A3M851) RecName: Full=Ribosomal RNA large subunit methyltransfe... 104 2e-20
(A0LGZ0) RecName: Full=Ribosomal RNA large subunit methyltransfe... 103 2e-20
(Q7NRI3) RecName: Full=Ribosomal RNA large subunit methyltransfe... 103 2e-20
(Q0HXS3) RecName: Full=Ribosomal RNA large subunit methyltransfe... 103 2e-20
(A6VCK9) RecName: Full=Ribosomal RNA large subunit methyltransfe... 103 3e-20
(Q1GPG3) RecName: Full=Ribosomal RNA large subunit methyltransfe... 103 3e-20
(A1S454) RecName: Full=Ribosomal RNA large subunit methyltransfe... 103 4e-20
(Q0VSS9) RecName: Full=Ribosomal RNA large subunit methyltransfe... 103 4e-20
AY730759_6(AY730759|pid:none) Bartonella vinsonii subsp. arupens... 103 4e-20
CP000961_3532(CP000961|pid:none) Shewanella woodyi ATCC 51908, c... 102 5e-20
(Q5PAN0) RecName: Full=Ribosomal RNA large subunit methyltransfe... 102 5e-20
CP001298_3590(CP001298|pid:none) Methylobacterium chloromethanic... 102 5e-20
AM270241_52(AM270241|pid:none) Aspergillus niger contig An11c024... 102 5e-20
(A8FYS8) RecName: Full=Ribosomal RNA large subunit methyltransfe... 102 5e-20
(A3D7L4) RecName: Full=Ribosomal RNA large subunit methyltransfe... 102 5e-20
(Q5P1G0) RecName: Full=Ribosomal RNA large subunit methyltransfe... 102 7e-20
(A9MBW8) RecName: Full=Ribosomal RNA large subunit methyltransfe... 102 9e-20
AE014292_661(AE014292|pid:none) Brucella suis 1330 chromosome II... 102 9e-20
(Q2RXU5) RecName: Full=Ribosomal RNA large subunit methyltransfe... 102 9e-20
CP000709_566(CP000709|pid:none) Brucella ovis ATCC 25840 chromos... 102 9e-20
(Q87LZ4) RecName: Full=Ribosomal RNA large subunit methyltransfe... 101 1e-19
(A4XYE8) RecName: Full=Ribosomal RNA large subunit methyltransfe... 101 1e-19
CP000927_2201(CP000927|pid:none) Caulobacter sp. K31, complete g... 101 1e-19
(B0T8J6) RecName: Full=Ribosomal RNA large subunit methyltransfe... 101 1e-19
CP001139_462(CP001139|pid:none) Vibrio fischeri MJ11 chromosome ... 101 2e-19
(A8H748) RecName: Full=Ribosomal RNA large subunit methyltransfe... 100 2e-19
CP001616_2221(CP001616|pid:none) Tolumonas auensis DSM 9187, com... 100 3e-19
(Q5E7M3) RecName: Full=Ribosomal RNA large subunit methyltransfe... 100 3e-19
AM920427_859(AM920427|pid:none) Penicillium chrysogenum Wisconsi... 100 3e-19
(A5WCU8) RecName: Full=Ribosomal RNA large subunit methyltransfe... 100 3e-19
(A1K598) RecName: Full=Ribosomal RNA large subunit methyltransfe... 100 4e-19
(Q6G4Z3) RecName: Full=Ribosomal RNA large subunit methyltransfe... 99 6e-19
AM942759_3380(AM942759|pid:none) Proteus mirabilis strain HI4320... 99 8e-19
(Q7MI01) RecName: Full=Ribosomal RNA large subunit methyltransfe... 99 8e-19
CP001391_52(CP001391|pid:none) Wolbachia sp. wRi, complete genome. 99 1e-18
(Q5WT13) RecName: Full=Ribosomal RNA large subunit methyltransfe... 99 1e-18
(Q138J5) RecName: Full=Ribosomal RNA large subunit methyltransfe... 99 1e-18
CP001013_2807(CP001013|pid:none) Leptothrix cholodnii SP-6, comp... 99 1e-18
(B6END5) RecName: Full=Ribosomal RNA large subunit methyltransfe... 99 1e-18
AM999887_606(AM999887|pid:none) Wolbachia endosymbiont of Culex ... 98 1e-18
CP001392_1447(CP001392|pid:none) Diaphorobacter sp. TPSY, comple... 98 1e-18
AY774111_1(AY774111|pid:none) Synthetic construct Francisella tu... 98 1e-18
AY967400_1(AY967400|pid:none) Synthetic construct isolate FTT091... 98 1e-18
(A1W8H0) RecName: Full=Ribosomal RNA large subunit methyltransfe... 98 1e-18
CP001340_1685(CP001340|pid:none) Caulobacter crescentus NA1000, ... 98 2e-18
(Q2IV68) RecName: Full=Ribosomal RNA large subunit methyltransfe... 98 2e-18
(A0KNF1) RecName: Full=Ribosomal RNA large subunit methyltransfe... 97 2e-18
AL590451_94(AL590451|pid:none) chromosome IX of strain GB-M1 of ... 97 3e-18
(Q5GS59) RecName: Full=Ribosomal RNA large subunit methyltransfe... 97 3e-18
(A7NAC9) RecName: Full=Ribosomal RNA large subunit methyltransfe... 97 3e-18
(A7I848) RecName: Full=Ribosomal RNA large subunit methyltransfe... 97 3e-18
CR382122_79(CR382122|pid:none) Kluyveromyces lactis strain NRRL ... 96 5e-18
(Q129M4) RecName: Full=Ribosomal RNA large subunit methyltransfe... 96 5e-18
CP000884_4908(CP000884|pid:none) Delftia acidovorans SPH-1, comp... 96 5e-18
(Q7VZ56) RecName: Full=Ribosomal RNA large subunit methyltransfe... 96 6e-18
(A4G4B0) RecName: Full=Ribosomal RNA large subunit methyltransfe... 96 6e-18
(Q2IPT3) RecName: Full=Ribosomal RNA large subunit methyltransfe... 96 8e-18
(Q7W8R6) RecName: Full=Ribosomal RNA large subunit methyltransfe... 96 8e-18
(A4SXL6) RecName: Full=Ribosomal RNA large subunit methyltransfe... 95 1e-17
(P57463) RecName: Full=Ribosomal RNA large subunit methyltransfe... 95 1e-17
CP001280_1310(CP001280|pid:none) Methylocella silvestris BL2, co... 95 1e-17
(A8EXN1) RecName: Full=Ribosomal RNA large subunit methyltransfe... 95 1e-17
(A9HYV0) RecName: Full=Ribosomal RNA large subunit methyltransfe... 95 1e-17
(B5XSW2) RecName: Full=Ribosomal RNA large subunit methyltransfe... 94 2e-17
(A9MP28) RecName: Full=Ribosomal RNA large subunit methyltransfe... 94 2e-17
(Q4UKG2) RecName: Full=Ribosomal RNA large subunit methyltransfe... 94 2e-17
(A9N744) RecName: Full=Ribosomal RNA large subunit methyltransfe... 94 2e-17
(A6TEJ8) RecName: Full=Ribosomal RNA large subunit methyltransfe... 94 2e-17
(Q3IE64) RecName: Full=Ribosomal RNA large subunit methyltransfe... 94 2e-17
(Q5PLC1) RecName: Full=Ribosomal RNA large subunit methyltransfe... 94 2e-17
(A8GMD3) RecName: Full=Ribosomal RNA large subunit methyltransfe... 94 2e-17
(Q47YJ3) RecName: Full=Ribosomal RNA large subunit methyltransfe... 94 2e-17
(A4VNP3) RecName: Full=Ribosomal RNA large subunit methyltransfe... 94 2e-17
(A1WXX3) RecName: Full=Ribosomal RNA large subunit methyltransfe... 94 2e-17
FN314507_1(FN314507|pid:none) Schistosoma japonicum isolate Anhu... 94 3e-17
(A1V319) RecName: Full=Ribosomal RNA large subunit methyltransfe... 94 3e-17
(Q11L51) RecName: Full=Ribosomal RNA large subunit methyltransfe... 94 3e-17
(Q92J64) RecName: Full=Ribosomal RNA large subunit methyltransfe... 94 3e-17
(Q5LSB0) RecName: Full=Ribosomal RNA large subunit methyltransfe... 94 3e-17
CP001408_1500(CP001408|pid:none) Burkholderia pseudomallei MSHR3... 94 3e-17
CP000783_3472(CP000783|pid:none) Enterobacter sakazakii ATCC BAA... 94 3e-17
(A5CX75) RecName: Full=Ribosomal RNA large subunit methyltransfe... 94 3e-17
(Q8Z3H3) RecName: Full=Ribosomal RNA large subunit methyltransfe... 94 3e-17
(Q28QW4) RecName: Full=Ribosomal RNA large subunit methyltransfe... 93 5e-17
CP001227_140(CP001227|pid:none) Rickettsia peacockii str. Rustic... 93 5e-17
(Q3J2Q5) RecName: Full=Ribosomal RNA large subunit methyltransfe... 93 5e-17
CP001150_1078(CP001150|pid:none) Rhodobacter sphaeroides KD131 c... 93 5e-17
CP000830_1665(CP000830|pid:none) Dinoroseobacter shibae DFL 12, ... 92 7e-17
CP001277_1771(CP001277|pid:none) Candidatus Hamiltonella defensa... 92 7e-17
CP001016_1891(CP001016|pid:none) Beijerinckia indica subsp. indi... 92 9e-17
AK000069_1(AK000069|pid:none) Homo sapiens cDNA FLJ20062 fis, cl... 92 9e-17
(A4TRJ0) RecName: Full=Ribosomal RNA large subunit methyltransfe... 92 9e-17
(Q1Q955) RecName: Full=Ribosomal RNA large subunit methyltransfe... 92 9e-17
(Q2SUW0) RecName: Full=Ribosomal RNA large subunit methyltransfe... 92 9e-17
AE009952_673(AE009952|pid:none) Yersinia pestis KIM, complete ge... 92 9e-17
(Q2GKK2) RecName: Full=Ribosomal RNA large subunit methyltransfe... 92 1e-16
AP009385_1196(AP009385|pid:none) Burkholderia multivorans ATCC 1... 92 1e-16
(Q4FQX1) RecName: Full=Ribosomal RNA large subunit methyltransfe... 92 1e-16
(B6JHM9) RecName: Full=Ribosomal RNA large subunit methyltransfe... 91 2e-16
(Q92RT9) RecName: Full=Ribosomal RNA large subunit methyltransfe... 91 2e-16
(Q1QKB6) RecName: Full=Ribosomal RNA large subunit methyltransfe... 91 2e-16
(Q7VQM8) RecName: Full=Ribosomal RNA large subunit methyltransfe... 91 2e-16
(Q0BGJ2) RecName: Full=Ribosomal RNA large subunit methyltransfe... 91 2e-16
CU633749_1929(CU633749|pid:none) Cupriavidus taiwanensis str. LM... 91 2e-16
(Q21WW8) RecName: Full=Ribosomal RNA large subunit methyltransfe... 91 3e-16
CP001339_963(CP001339|pid:none) Thioalkalivibrio sp. HL-EbGR7, c... 91 3e-16
(Q13W47) RecName: Full=Ribosomal RNA large subunit methyltransfe... 90 4e-16
(Q89AF1) RecName: Full=Ribosomal RNA large subunit methyltransfe... 90 4e-16
(B7J8G6) RecName: Full=Ribosomal RNA large subunit methyltransfe... 90 5e-16
CP001338_757(CP001338|pid:none) Candidatus Methanosphaerula palu... 90 5e-16
(Q0I2R1) RecName: Full=Ribosomal RNA large subunit methyltransfe... 90 5e-16
(Q8XZ79) RecName: Full=Ribosomal RNA large subunit methyltransfe... 90 5e-16
(Q1GHF1) RecName: Full=Ribosomal RNA large subunit methyltransfe... 90 5e-16
AC159420_26(AC159420|pid:none) Trypanosoma brucei chromosome 8 c... 89 6e-16
(Q3SQN7) RecName: Full=Ribosomal RNA large subunit methyltransfe... 89 6e-16
(Q30YX3) RecName: Full=Ribosomal RNA large subunit methyltransfe... 89 6e-16
(Q2NW30) RecName: Full=Ribosomal RNA large subunit methyltransfe... 89 6e-16
(Q87F66) RecName: Full=Ribosomal RNA large subunit methyltransfe... 89 8e-16
(A2SF90) RecName: Full=Ribosomal RNA large subunit methyltransfe... 89 8e-16
AJ871313_1(AJ871313|pid:none) Nyctotherus ovalis partial gene fo... 89 1e-15
(Q3BUR8) RecName: Full=Ribosomal RNA large subunit methyltransfe... 88 1e-15
CP001503_1099(CP001503|pid:none) Burkholderia glumae BGR1 chromo... 88 1e-15
(Q9PH52) RecName: Full=Ribosomal RNA large subunit methyltransfe... 88 1e-15
AE013598_2892(AE013598|pid:none) Xanthomonas oryzae pv. oryzae K... 88 1e-15
(A7H9A5) RecName: Full=Ribosomal RNA large subunit methyltransfe... 88 2e-15
(Q1LLA8) RecName: Full=Ribosomal RNA large subunit methyltransfe... 88 2e-15
(B2FKA1) RecName: Full=Ribosomal RNA large subunit methyltransfe... 88 2e-15
(A4YSS3) RecName: Full=Ribosomal RNA large subunit methyltransfe... 87 2e-15
AB260935_6(AB260935|pid:none) Uncultured bacterium DNA, salt-str... 87 2e-15
C97434(C97434)hypothetical protein AGR_C_1101 [imported] - Agrob... 87 2e-15
(Q8UHR0) RecName: Full=Ribosomal RNA large subunit methyltransfe... 87 2e-15
(B5ZR94) RecName: Full=Ribosomal RNA large subunit methyltransfe... 87 3e-15
(Q6L1E2) RecName: Full=Ribosomal RNA large subunit methyltransfe... 87 3e-15
(Q1ML15) RecName: Full=Ribosomal RNA large subunit methyltransfe... 87 4e-15
(Q1LSK2) RecName: Full=Ribosomal RNA large subunit methyltransfe... 87 4e-15
(Q46Z98) RecName: Full=Ribosomal RNA large subunit methyltransfe... 87 4e-15
(A1VC40) RecName: Full=Ribosomal RNA large subunit methyltransfe... 86 5e-15
BC159355_1(BC159355|pid:none) Xenopus tropicalis hypothetical pr... 86 5e-15
AM502241_56(AM502241|pid:none) Leishmania infantum chromosome 23. 86 7e-15
(P78860) RecName: Full=Putative ribosomal RNA methyltransferase ... 86 7e-15
(A9FQE4) RecName: Full=Ribosomal RNA large subunit methyltransfe... 86 7e-15
(Q9HIH4) RecName: Full=Ribosomal RNA large subunit methyltransfe... 86 9e-15
(Q9ZE00) RecName: Full=Ribosomal RNA large subunit methyltransfe... 86 9e-15
(Q1D841) RecName: Full=Ribosomal RNA large subunit methyltransfe... 85 1e-14
(A5EXB6) RecName: Full=Ribosomal RNA large subunit methyltransfe... 85 1e-14
AB005230_4(AB005230|pid:none) Arabidopsis thaliana genomic DNA, ... 84 2e-14
(Q8K9G7) RecName: Full=Ribosomal RNA large subunit methyltransfe... 84 2e-14
(Q820A2) RecName: Full=Ribosomal RNA large subunit methyltransfe... 84 3e-14
(Q9UI43) RecName: Full=Putative ribosomal RNA methyltransferase ... 83 4e-14
BC114564_1(BC114564|pid:none) Homo sapiens FtsJ homolog 2 (E. co... 83 4e-14
(Q4QKJ2) RecName: Full=Ribosomal RNA large subunit methyltransfe... 83 4e-14
CP000859_372(CP000859|pid:none) Desulfococcus oleovorans Hxd3, c... 83 6e-14
CR382133_37(CR382133|pid:none) Debaryomyces hansenii strain CBS7... 82 1e-13
(A3CVJ3) RecName: Full=Ribosomal RNA large subunit methyltransfe... 82 1e-13
(Q7VLF2) RecName: Full=Ribosomal RNA large subunit methyltransfe... 82 1e-13
(A3MZW0) RecName: Full=Ribosomal RNA large subunit methyltransfe... 82 1e-13
(P45162) RecName: Full=Ribosomal RNA large subunit methyltransfe... 82 1e-13
BT080282_1(BT080282|pid:none) Caligus clemensi clone ccle-evs-50... 82 1e-13
CT005262_56(CT005262|pid:none) Leishmania major strain Friedlin,... 82 1e-13
(B8DNJ4) RecName: Full=Ribosomal RNA large subunit methyltransfe... 81 2e-13
(O83687) RecName: Full=Ribosomal RNA large subunit methyltransfe... 80 4e-13
CP000496_91(CP000496|pid:none) Pichia stipitis CBS 6054 chromoso... 80 5e-13
CU633895_311(CU633895|pid:none) Podospora anserina genomic DNA c... 80 5e-13
BT074283_1(BT074283|pid:none) Oncorhynchus mykiss clone omyk-evo... 78 1e-12
(Q8D2X0) RecName: Full=Ribosomal RNA large subunit methyltransfe... 78 1e-12
(Q9VDT6) RecName: Full=Putative ribosomal RNA methyltransferase ... 78 2e-12
(Q661V2) RecName: Full=Ribosomal RNA large subunit methyltransfe... 78 2e-12
AP008209_3092(AP008209|pid:none) Oryza sativa (japonica cultivar... 77 2e-12
(Q057J5) RecName: Full=Ribosomal RNA large subunit methyltransfe... 77 2e-12
CP001087_394(CP001087|pid:none) Desulfobacterium autotrophicum H... 74 3e-11
(O51293) RecName: Full=Ribosomal RNA large subunit methyltransfe... 73 6e-11
BC049003_1(BC049003|pid:none) Xenopus laevis Ftsj homolog (E. co... 72 1e-10
CP000049_306(CP000049|pid:none) Borrelia turicatae 91E135, compl... 69 6e-10
AL844508_86(AL844508|pid:none) Plasmodium falciparum 3D7 chromos... 69 6e-10
CP001010_724(CP001010|pid:none) Polynucleobacter necessarius sub... 69 6e-10
CP000976_308(CP000976|pid:none) Borrelia duttonii Ly, complete g... 69 6e-10
CP000048_304(CP000048|pid:none) Borrelia hermsii DAH, complete g... 68 2e-09
CU633455_39(CU633455|pid:none) Podospora anserina genomic DNA ch... 68 2e-09
AM910989_60(AM910989|pid:none) Plasmodium knowlesi strain H chro... 67 4e-09
FN357418_30(FN357418|pid:none) Schistosoma mansoni genome sequen... 63 6e-08
EU969132_1(EU969132|pid:none) Zea mays clone 326222 unknown mRNA. 63 6e-08
AK297486_1(AK297486|pid:none) Homo sapiens cDNA FLJ52916 complet... 62 8e-08
CR380954_387(CR380954|pid:none) Candida glabrata strain CBS138 c... 61 2e-07
CU928180_153(CU928180|pid:none) Kluyveromyces thermotolerans str... 60 3e-07
(Q3YRW8) RecName: Full=Ribosomal RNA large subunit methyltransfe... 60 3e-07
D89210_1(D89210|pid:none) Schizosaccharomyces pombe mRNA, partia... 58 1e-06
AB174358_1(AB174358|pid:none) Macaca fascicularis brain cDNA clo... 58 1e-06
(P53123) RecName: Full=Ribosomal RNA methyltransferase MRM2, mit... 57 3e-06
AM270041_2(AM270041|pid:none) Aspergillus niger contig An02c0480... 57 4e-06
FN392319_486(FN392319|pid:none) Pichia pastoris GS115 chromosome... 52 1e-04
AL590734_45(AL590734|pid:none) Leishmania major strain Friedlin ... 52 1e-04
AY815547_1(AY815547|pid:none) Schistosoma japonicum SJCHGC04749 ... 52 1e-04
BT076458_1(BT076458|pid:none) Caligus rogercresseyi clone crog-e... 49 7e-04
DQ813662_70(DQ813662|pid:none) Anticarsia gemmatalis nucleopolyh... 48 0.002
AF325155_65(AF325155|pid:none) Spodoptera litura nucleopolyhedro... 48 0.002
EF035042_87(EF035042|pid:none) Spodoptera frugiperda MNPV isolat... 47 0.004
EU839994_102(EU839994|pid:none) Agrotis ipsilon multiple nucleop... 47 0.004
AF451898_37(AF451898|pid:none) Heliothis zea virus 1, complete g... 47 0.004
AY327402_66(AY327402|pid:none) Choristoneura fumiferana defectiv... 46 0.008
AP009046_81(AP009046|pid:none) Hyphantria cunea nucleopolyhedrov... 45 0.017
AX969292_1(AX969292|pid:none) Sequence 95 from Patent EP1104808. 45 0.017
EF207986_83(EF207986|pid:none) Antheraea pernyi nucleopolyhedrov... 44 0.029
AM502249_68(AM502249|pid:none) Leishmania infantum chromosome 31. 44 0.038
(P41469) RecName: Full=Uncharacterized 30.4 kDa protein in LEF3-... 43 0.065
EU780426_92(EU780426|pid:none) Spodoptera litura nucleopolyhedro... 43 0.065
EF214896_1(EF214896|pid:none) Callithrix jacchus clone M19-49.1_... 42 0.085
(Q7ZVS8) RecName: Full=FtsJ methyltransferase domain-containing ... 42 0.14
AF271059_62(AF271059|pid:none) Heliocoverpa armigera nucleopolyh... 41 0.25
(P0C968) RecName: Full=Probable methyltransferase EP424R; ... 41 0.25
AF117649_1(AF117649|pid:none) Drosophila melanogaster Adrift (ad... 40 0.32
AF334030_65(AF334030|pid:none) Helicoverpa zea single nucleocaps... 40 0.42
AP010907_65(AP010907|pid:none) Helicoverpa armigera SNPV NNg1 DN... 40 0.42
(Q8JJX1) RecName: Full=Non-structural polyprotein; AltName: Full... 40 0.55
T33464(T33464)hypothetical protein Y40D12A.1 - Caenorhabditis el... 40 0.55
(P0C970) RecName: Full=Probable methyltransferase EP424R; ... 39 0.94
(Q65148) RecName: Full=Probable methyltransferase EP424R; ... 39 0.94
(P0C969) RecName: Full=Probable methyltransferase EP424R; ... 38 2.1
CP000875_4284(CP000875|pid:none) Herpetosiphon aurantiacus ATCC ... 38 2.1
CR940352_152(CR940352|pid:none) Theileria annulata strain Ankara... 38 2.1
AM180252_326(AM180252|pid:none) Lawsonia intracellularis PHE/MN1... 38 2.1
AK060050_1(AK060050|pid:none) Oryza sativa Japonica Group cDNA c... 37 3.6
AF015310_1(AF015310|pid:none) Brassica napus BTH1 mRNA, complete... 37 4.6
CP000758_360(CP000758|pid:none) Ochrobactrum anthropi ATCC 49188... 36 6.1
>(Q54NX0) RecName: Full=rRNA methyltransferase 3 homolog;
EC=2.1.1.-; AltName: Full=rRNA
(uridine-2'-O-)-methyltransferase 3;
Length = 833
Score = 733 bits (1891), Expect(2) = 0.0
Identities = 387/525 (73%), Positives = 388/525 (73%)
Frame = +1
Query: 130 FYYMAKEQGYRSRAAFKLIQLNKKYNFLGTAKACLDLCAAPGGWMQVASKYMPVQSLIVG 309
FYYMAKEQGYRSRAAFKLIQLNKKYNFLGTAKACLDLCAAPGGWMQVASKYMPVQSLIVG
Sbjct: 16 FYYMAKEQGYRSRAAFKLIQLNKKYNFLGTAKACLDLCAAPGGWMQVASKYMPVQSLIVG 75
Query: 310 VDLVPIRQVRNCIGLTEDITTQKCRTEIKKALKTWKVDVCLHDGAPNMGTSWVQDAYQQA 489
VDLVPIRQVRNCIGLTEDITTQKCRTEIKKALKTWKVDVCLHDGAPNMGTSWVQDAYQQA
Sbjct: 76 VDLVPIRQVRNCIGLTEDITTQKCRTEIKKALKTWKVDVCLHDGAPNMGTSWVQDAYQQA 135
Query: 490 ELTLHALKLATEFLTTGGWFVTKVFRGSDYNSLIWVFNKLFKKVESTKPPSSRNASAEIF 669
ELTLHALKLATEFLTTGGWFVTKVFRGSDYNSLIWVFNKLFKKVESTKPPSSRNASAEIF
Sbjct: 136 ELTLHALKLATEFLTTGGWFVTKVFRGSDYNSLIWVFNKLFKKVESTKPPSSRNASAEIF 195
Query: 670 VVCQGFLNPKRIDPKLLDPKFVFKEIQEVKKVDVLSEKKKVNRAGYEDGVTVLYKKGFIS 849
VVCQGFLNPKRIDPKLLDPKFVFKEIQEVKKVDVLSEKKKVNRAGYEDGVTVLYKKGFIS
Sbjct: 196 VVCQGFLNPKRIDPKLLDPKFVFKEIQEVKKVDVLSEKKKVNRAGYEDGVTVLYKKGFIS 255
Query: 850 DFVNSNEHLQDLXXXXXXXXXXXXKIFEQHELTTPEIKELVKDLKVLNKNDFQKIIKWKK 1029
DFVNSNEHLQDL KIFEQHELTTPEIKELVKDLKVLNKNDFQKIIKWKK
Sbjct: 256 DFVNSNEHLQDLANFNAFEFDEAAKIFEQHELTTPEIKELVKDLKVLNKNDFQKIIKWKK 315
Query: 1030 AMAAYKEKLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYLALVXXXXXXXXXXXXXX 1209
AMAAYKEKL YLALV
Sbjct: 316 AMAAYKEKLDNPDEEETEKPEEKKELTAEEMEENLQEEMKEYLALVEKKKRKEKKRQNEL 375
Query: 1210 XXXHQRKIELTMHIPGDRIEETTDGDLYSMKGKDEFDEDIVAXXXXXXXXXXXXXXXXXX 1389
HQRKIELTMHIPGD+IEETTDGDLYSMKGKDEFDEDIVA
Sbjct: 376 KRKHQRKIELTMHIPGDKIEETTDGDLYSMKGKDEFDEDIVADHSDISSDEFDSDDSDDD 435
Query: 1390 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRIRXXXXXXXXXXXXXXXIGQDGYNXXXX 1569
RIR IGQDGYN
Sbjct: 436 DDDDNNGDSKLIDDDEYLEQQLDEQYKLYQQRIRKKAAKLDDVKVKKDKIGQDGYNEDDE 495
Query: 1570 XXXXXXXXSNPLLVGNKRKEPDAQAVSSLFFDNELFGGVEYRNPG 1704
SNPLLVGNKRKEPDAQAVSSLFFDNELFGGVEYRNPG
Sbjct: 496 EFVEEQEESNPLLVGNKRKEPDAQAVSSLFFDNELFGGVEYRNPG 540
Score = 317 bits (813), Expect(2) = 0.0
Identities = 174/258 (67%), Positives = 174/258 (67%)
Frame = +3
Query: 1776 QAAQPITKKQKTTNSAEFGKQKSKYQKNPTLXXXXXXXXXXXXGNSIKGFXXXXXXXXXX 1955
QAAQPITKKQKTTNSAEFGKQKSKYQKNPTL GNSIKGF
Sbjct: 573 QAAQPITKKQKTTNSAEFGKQKSKYQKNPTLDDKDDQDDDDDKGNSIKGFEEVPVQEEVE 632
Query: 1956 XXXXXXXXXXXXXXTKALGEFLIRKKSRQDLIDDSFNKYAFNDTGLPNWFTDDENRHNKA 2135
TKALGEFLIRKKSRQDLIDDSFNKYAFNDTGLPNWFTDDENRHNKA
Sbjct: 633 YESDSDEDIDDKIKTKALGEFLIRKKSRQDLIDDSFNKYAFNDTGLPNWFTDDENRHNKA 692
Query: 2136 QTPLTKEMVDEIRRKIKEIDDRPXXXXXXXXXXXXYRLGKKMEKTRDKASSIVDNPEMSN 2315
QTPLTKEMVDEIRRKIKEIDDRP YRLGKKMEKTRDKASSIVDNPEMSN
Sbjct: 693 QTPLTKEMVDEIRRKIKEIDDRPIKKIAEAKARKKYRLGKKMEKTRDKASSIVDNPEMSN 752
Query: 2316 REKSKAIEKLYSGTDXXXXXXXXXXXXXXXXXXXXXXXXXYKIVDKRMKKDLRAQKNKLK 2495
REKSKAIEKLYSGTD YKIVDKRMKKDLRAQKNKLK
Sbjct: 753 REKSKAIEKLYSGTDKKNMKPKKIIMIAKKSKTAGGGTGKYKIVDKRMKKDLRAQKNKLK 812
Query: 2496 TVGRXXXXXXXXXPRG*K 2549
TVGR P G K
Sbjct: 813 TVGRSKDSSKKSKPSGGK 830
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3204285
Number of Hits to DB: 3,123,543,489
Number of extensions: 54833266
Number of successful extensions: 132596
Number of sequences better than 10.0: 357
Number of HSP's gapped: 132191
Number of HSP's successfully gapped: 441
Length of query: 850
Length of database: 1,040,966,779
Length adjustment: 137
Effective length of query: 713
Effective length of database: 601,979,734
Effective search space: 429211550342
Effective search space used: 429211550342
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 32 (16.9 bits)
|
| PSORT |
|
| VS (DIR, S) |
0 |
| VH (FL, L) |
21 |
| VF (FL, S) |
6 |
| AH (FL, L) |
3 |
| AF (FL, S) |
0 |
| SL (DIR, L) |
0 |
| SS (DIR, S) |
0 |
| SH (FL, L) |
0 |
| SF (FL, S) |
0 |
| CH (FL, L) |
1 |
| CF (FL, S) |
0 |
| FCL (DIR, L) |
0 |
| FC (DIR, S) |
0 |
| FC-IC (SUB) |
0 |