| Contig-U11233-1 |
| Contig ID |
Contig-U11233-1 |
| Contig update |
2002.12.18 |
| Contig sequence |
 |
| Gap |
gap included |
| Contig length |
2022 |
| Chromosome number (1..6, M) |
6 |
| Chromosome length |
3595308 |
| Start point |
3134919 |
| End point |
3132897 |
| Strand (PLUS/MINUS) |
MINUS |
| Number of clones |
10 |
| Number of EST |
16 |
| Link to clone list |
U11233 |
| List of clone(s) |
|
| Translated Amino Acid sequence |
|
| Translated Amino Acid sequence (All Frames) |
|
| own update |
2004. 6.10 |
| Homology vs CSM-cDNA |
|
| dna update |
2008.11.23 |
| Homology vs DNA |
Query= Contig-U11233-1 (Contig-U11233-1Q) /CSM_Contig/Contig-U11233-1Q.Seq.d
(2032 letters)
Database: ddbj_A
92,845,959 sequences; 95,242,211,685 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value N
(BJ439028) Dictyostelium discoideum cDNA clone:ddv39p05, 3' ... 1477 0.0 1
(BJ441830) Dictyostelium discoideum cDNA clone:ddv48b04, 3' ... 1461 0.0 1
(BJ356236) Dictyostelium discoideum cDNA clone:dda59n16, 3' ... 1241 0.0 1
(BJ349116) Dictyostelium discoideum cDNA clone:dda35n08, 3' ... 1237 0.0 1
(BJ436937) Dictyostelium discoideum cDNA clone:ddv32o13, 3' ... 1223 0.0 1
(BJ350204) Dictyostelium discoideum cDNA clone:dda39h01, 3' ... 1223 0.0 1
(BJ438506) Dictyostelium discoideum cDNA clone:ddv37j06, 3' ... 1219 0.0 1
(BJ423081) Dictyostelium discoideum cDNA clone:ddv48b04, 5' ... 1074 0.0 1
(BJ420413) Dictyostelium discoideum cDNA clone:ddv39p05, 5' ... 1074 0.0 1
(BJ332433) Dictyostelium discoideum cDNA clone:dda39h01, 5' ... 1074 0.0 1
(BJ337942) Dictyostelium discoideum cDNA clone:dda59c16, 5' ... 1066 0.0 2
(BJ419765) Dictyostelium discoideum cDNA clone:ddv37j06, 5' ... 1065 0.0 1
(BJ331455) Dictyostelium discoideum cDNA clone:dda35n08, 5' ... 1063 0.0 2
(BJ395847) Dictyostelium discoideum cDNA clone:dds40l10, 5' ... 1059 0.0 2
(BJ368848) Dictyostelium discoideum cDNA clone:ddc48f07, 5' ... 1047 0.0 2
(BJ418416) Dictyostelium discoideum cDNA clone:ddv32o13, 5' ... 1019 0.0 1
(CZ171224) MIAA-7L21c.b1 Meloidogyne incognita BAC end seque... 82 6e-11 2
(CZ177089) MIAA-20J22b.g1 Meloidogyne incognita BAC end sequ... 82 9e-11 1
(CP000001) Bacillus cereus E33L, complete genome. 72 9e-08 1
(DJ210601) Method for identification of useful proteins deri... 44 1e-06 3
(EX434605) GQ03916.B7_J05 GQ039 - Stem - Dormant Picea glauc... 68 1e-06 1
(DQ332565) Synthetic construct Saccharomyces cerevisiae clon... 44 5e-06 3
(EA397207) Sequence 46031 from patent US 7314974. 44 5e-06 3
(D76430) Saccharomyces cerevisiae for DIS3 protein, complete... 44 5e-06 3
(Z74763) S.cerevisiae chromosome XV reading frame ORF YOL021c. 44 1e-05 3
(DN610269) EST963319 Subtracted pine embryo library, Lib_B P... 48 1e-05 2
(DT627912) EST1156661 Subtracted pine embryo library, Lib_B ... 48 2e-05 2
(DR683139) EST1073215 Normalized pine embryo library, Lib_D ... 48 2e-05 2
(Z70718) Caenorhabditis elegans Cosmid C04G2. 64 2e-05 1
(CB403369) OSTR005H10_1 AD-wrmcDNA Caenorhabditis elegans cD... 64 2e-05 1
(BW991496) Chamaecyparis obtusa cDNA, clone: CO04345, 5' end... 64 2e-05 1
(AE017194) Bacillus cereus ATCC 10987, complete genome. 64 2e-05 1
(CB931685) ri61h04.y1 Meloidogyne chitwoodi J2 pDNR LIB Melo... 62 9e-05 1
(CU425491) Clytia hemisphaerica 5-PRIME EST from clone SA0AA... 58 2e-04 2
(CU425790) Clytia hemisphaerica 5-PRIME EST from clone SA0AA... 58 2e-04 2
(CU427587) Clytia hemisphaerica 5-PRIME EST from clone SA0AA... 58 2e-04 2
(CU430918) Clytia hemisphaerica 5-PRIME EST from clone SA0AA... 56 9e-04 2
(EB462679) AGENCOURT_74400601 NICHD_XGC_limb_m Xenopus laevi... 52 9e-04 2
(CU430353) Clytia hemisphaerica 5-PRIME EST from clone SA0AA... 56 0.001 2
(DQ048294) Pan troglodytes DIS3 gene, VIRTUAL TRANSCRIPT, pa... 40 0.001 3
(DQ048293) Homo sapiens DIS3 gene, VIRTUAL TRANSCRIPT, parti... 40 0.001 3
(ED462458) AUAC-aau55e02.b1 Ascaris suum whole genome shotgu... 58 0.001 1
(ED438809) AUAC-aan43b06.b1 Ascaris suum whole genome shotgu... 58 0.001 1
(ED413158) AUAC-aaw93d09.b1 Ascaris suum whole genome shotgu... 58 0.001 1
(ED299065) AUAC-aaj15a07.g1 Ascaris suum whole genome shotgu... 58 0.001 1
(CZ543488) SRAA-aad50c10.b1 Strongyloides ratti whole genome... 58 0.001 1
(FC820130) Sr_pAMT7_016m19_T7 S. ratti mixed stage pAMP Stro... 58 0.001 1
(AL080158) Homo sapiens mRNA; cDNA DKFZp434L194 (from clone ... 40 0.002 3
(CP000770) Candidatus Sulcia muelleri GWSS, complete genome. 36 0.002 17
(AB385417) Synthetic construct DNA, clone: pF1KA1008, Homo s... 40 0.003 3
(AK314715) Homo sapiens cDNA, FLJ95573, Homo sapiens mitotic... 40 0.003 3
(BC084092) Xenopus laevis hypothetical LOC495005, mRNA (cDNA... 52 0.003 2
(AL832266) Homo sapiens mRNA; cDNA DKFZp667L1817 (from clone... 40 0.003 3
(EJ130715) 1092343485279 Global-Ocean-Sampling_GS-27-01-01-1... 48 0.003 2
(AM398681) Flavobacterium psychrophilum JIP02/86 complete ge... 44 0.003 2
(AL929353) Plasmodium falciparum strain 3D7, chromosome 5, s... 34 0.004 16
(AB001743) Homo sapiens mRNA for DIS3, complete cds. 40 0.004 3
(BC038101) Homo sapiens DIS3 mitotic control homolog (S. cer... 40 0.004 3
(BC056143) Homo sapiens DIS3 mitotic control homolog (S. cer... 40 0.005 3
(EF410359) Synthetic construct Bacillus anthracis clone FLH2... 56 0.005 1
(FE708437) Pv055A_M13F_G01.ab1 Phaseolus vulgaris cv Early g... 56 0.005 1
(CP000903) Bacillus weihenstephanensis KBAB4, complete genome. 56 0.005 1
(CP000485) Bacillus thuringiensis str. Al Hakam, complete ge... 56 0.005 1
(AE017355) Bacillus thuringiensis serovar konkukian str. 97-... 56 0.005 1
(AE017334) Bacillus anthracis str. 'Ames Ancestor', complete... 56 0.005 1
(AE017225) Bacillus anthracis str. Sterne, complete genome. 56 0.005 1
(AE016879) Bacillus anthracis str. Ames, complete genome. 56 0.005 1
(AE016877) Bacillus cereus ATCC 14579, complete genome. 56 0.005 1
(AC115581) Dictyostelium discoideum chromosome 2 map complem... 48 0.006 8
(CQ725010) Sequence 10944 from Patent WO02068579. 40 0.008 3
(AB023225) Homo sapiens mRNA for KIAA1008 protein, partial cds. 40 0.008 3
(CQ412899) Sequence 19970 from Patent WO0170979. 40 0.008 3
(BW291002) Ciona intestinalis cDNA, clone:cigd043b10, 5' end... 54 0.009 2
(BW268518) Ciona intestinalis cDNA, clone:cign050d01, 5' end... 54 0.010 2
(BW265796) Ciona intestinalis cDNA, clone:cign041o04, 5' end... 54 0.010 2
(AC113401) Homo sapiens chromosome 5 clone RP11-454E20, comp... 34 0.011 9
(BW486574) Ciona intestinalis cDNA, clone:cima005d19, 5'end,... 54 0.013 2
(AC116956) Dictyostelium discoideum chromosome 2 map 1418423... 34 0.015 16
(CS044394) Sequence 4948 from Patent WO2005019258. 40 0.015 3
(CS035442) Sequence 4948 from Patent WO2005016962. 40 0.015 3
(AF330044) Homo sapiens KIAA1008 protein mRNA, complete cds. 40 0.015 3
(AY691418) Paracoccus nothofagicola cytochrome b (cytb) gene... 40 0.016 5
(EA380584) Sequence 29407 from patent US 7314974. 54 0.021 1
(U23514) Caenorhabditis elegans cosmid F48E8, complete seque... 54 0.021 1
(EK482725) 1095469529511 Global-Ocean-Sampling_GS-32-01-01-1... 54 0.021 1
(EC024225) 4007835 KZ41 Caenorhabditis elegans cDNA clone 17... 54 0.021 1
(C71372) Caenorhabditis elegans cDNA clone yk444d2 : 5' end,... 54 0.021 1
(C68843) Caenorhabditis elegans cDNA clone yk309h10 : 5' end... 54 0.021 1
(C65782) Caenorhabditis elegans cDNA clone yk395c2 : 5' end,... 54 0.021 1
(BW190487) Ciona intestinalis cDNA, clone:ciad090m03, 5' end... 54 0.021 1
(BJ775216) Caenorhabditis elegans cDNA clone:yk1362d05 : 3' ... 54 0.021 1
(CR936503) Lactobacillus sakei strain 23K complete genome. 54 0.021 1
(DX349312) OR_ABa0280G14.r OR_ABa Oryza ridleyi genomic clon... 48 0.038 2
(AE015927) Clostridium tetani E88, complete genome. 36 0.039 22
(BU383434) 603860350F1 CSEQCHN75 Gallus gallus cDNA clone Ch... 42 0.040 2
(BU233332) 603411872F1 CSEQCHN24 Gallus gallus cDNA clone Ch... 42 0.040 2
(BU359530) 603477433F1 CSEQCHN71 Gallus gallus cDNA clone Ch... 42 0.042 2
(EH631745) EST2852 LK04 Laupala kohalensis cDNA clone 106102... 48 0.047 2
(CP000361) Arcobacter butzleri RM4018, complete genome. 36 0.050 23
(BX293980) Mycoplasma mycoides subsp. mycoides SC str. PG1, ... 38 0.073 19
>(BJ439028) Dictyostelium discoideum cDNA clone:ddv39p05, 3' end,
single read.
Length = 745
Score = 1477 bits (745), Expect = 0.0
Identities = 745/745 (100%)
Strand = Plus / Minus
Query: 675 attaatcaacacactggtgaaatcattgcagtcgaatatactaaaagtataattcgttca 734
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 745 attaatcaacacactggtgaaatcattgcagtcgaatatactaaaagtataattcgttca 686
Query: 735 tgtgcatctctaacctatgaacaagcacaaattagaattgatgataaatctcaaaatgat 794
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 685 tgtgcatctctaacctatgaacaagcacaaattagaattgatgataaatctcaaaatgat 626
Query: 795 caaatcacagtaaatcttagaaatttaaatagtttagcaaaaattcttagaaaacaacgt 854
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 625 caaatcacagtaaatcttagaaatttaaatagtttagcaaaaattcttagaaaacaacgt 566
Query: 855 ttcgataggggtgcactctatttagcttcaccacaagttaaattcaagactgaagaattg 914
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 565 ttcgataggggtgcactctatttagcttcaccacaagttaaattcaagactgaagaattg 506
Query: 915 ggtggtgatccatccgatgttgaaatttatcaacttcgtgaaacaaattcaatgattgaa 974
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 505 ggtggtgatccatccgatgttgaaatttatcaacttcgtgaaacaaattcaatgattgaa 446
Query: 975 gagtttatgttgttagcaaatatttgggttgccaagaaaatttataaacatttcccaggt 1034
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 445 gagtttatgttgttagcaaatatttgggttgccaagaaaatttataaacatttcccaggt 386
Query: 1035 tgtgctatgttacgtcgtcatccaactccaaataaagcagctttcgatttattgacaaag 1094
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 385 tgtgctatgttacgtcgtcatccaactccaaataaagcagctttcgatttattgacaaag 326
Query: 1095 ttaatcgagaataaaggttacaaattctcaaccaccacaagtaaagatttagcagattca 1154
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 325 ttaatcgagaataaaggttacaaattctcaaccaccacaagtaaagatttagcagattca 266
Query: 1155 ttggattccgctgtagataagaacgattcatactttaataccctatgtcgtattatgaca 1214
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 265 ttggattccgctgtagataagaacgattcatactttaataccctatgtcgtattatgaca 206
Query: 1215 acccgttgcatgtcaccagctaaatatttctcatcaggttcattaccatatgaagatttt 1274
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 205 acccgttgcatgtcaccagctaaatatttctcatcaggttcattaccatatgaagatttt 146
Query: 1275 aatcattatggtttggccactgatatttacactcatttcacatcaccaattcgtcgttat 1334
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 145 aatcattatggtttggccactgatatttacactcatttcacatcaccaattcgtcgttat 86
Query: 1335 ccagatattatagttcatcgtttattagcttctgcaattggtattcaatcagtttcatta 1394
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 85 ccagatattatagttcatcgtttattagcttctgcaattggtattcaatcagtttcatta 26
Query: 1395 aatttagagaataaaaccatttcag 1419
|||||||||||||||||||||||||
Sbjct: 25 aatttagagaataaaaccatttcag 1
Lambda K H
1.37 0.711 1.31
Matrix: blastn matrix:1 -3
Number of Sequences: 92845959
Number of Hits to DB: 2,323,806,744
Number of extensions: 146651651
Number of successful extensions: 12478715
Number of sequences better than 10.0: 414
Length of query: 2032
Length of database: 95,242,211,685
Length adjustment: 24
Effective length of query: 2008
Effective length of database: 97,308,875,965
Effective search space: 195396222937720
Effective search space used: 195396222937720
X1: 11 (21.8 bits)
S2: 23 (46.1 bits)
|
| protein update |
2009. 6.29 |
| Homology vs Protein |
Query= Contig-U11233-1 (Contig-U11233-1Q) /CSM_Contig/Contig-U11233-1Q.Seq.d
(2032 letters)
Database: nrp_A
3,204,285 sequences; 1,040,966,779 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
(Q9CSH3) RecName: Full=Exosome complex exonuclease RRP44; ... 338 3e-91
AL138695_5(AL138695|pid:none) Human DNA sequence from clone RP11... 337 1e-90
AF330044_1(AF330044|pid:none) Homo sapiens KIAA1008 protein mRNA... 337 1e-90
AL080158_1(AL080158|pid:none) Homo sapiens mRNA; cDNA DKFZp434L1... 337 1e-90
BC056143_1(BC056143|pid:none) Homo sapiens DIS3 mitotic control ... 337 1e-90
BC038101_1(BC038101|pid:none) Homo sapiens DIS3 mitotic control ... 337 1e-90
AE014297_3670(AE014297|pid:none) Drosophila melanogaster chromos... 335 4e-90
AY052150_1(AY052150|pid:none) Drosophila melanogaster SD10981 fu... 335 4e-90
AL832266_1(AL832266|pid:none) Homo sapiens mRNA; cDNA DKFZp667L1... 333 1e-89
BC161523_1(BC161523|pid:none) Xenopus tropicalis DIS3 mitotic co... 328 3e-88
AC099739_6(AC099739|pid:none) Oryza sativa (japonica cultivar-gr... 324 7e-87
BT061562_1(BT061562|pid:none) Zea mays full-length cDNA clone ZM... 323 1e-86
CR954211_343(CR954211|pid:none) Ostreococcus tauri strain OTTH05... 319 3e-85
CR380954_184(CR380954|pid:none) Candida glabrata strain CBS138 c... 310 1e-82
CP000591_320(CP000591|pid:none) Ostreococcus lucimarinus CCE9901... 308 4e-82
AC007584_6(AC007584|pid:none) Arabidopsis thaliana chromosome 2 ... 304 9e-81
FN392321_1071(FN392321|pid:none) Pichia pastoris GS115 chromosom... 298 4e-79
FM992688_1140(FM992688|pid:none) Candida dubliniensis CD36 chrom... 297 1e-78
CU928179_40(CU928179|pid:none) Zygosaccharomyces rouxii strain C... 296 2e-78
CU928180_555(CU928180|pid:none) Kluyveromyces thermotolerans str... 295 6e-78
AP000615_11(AP000615|pid:none) Oryza sativa Japonica Group genom... 293 2e-77
CR382139_417(CR382139|pid:none) Debaryomyces hansenii strain CBS... 287 9e-76
(Q17632) RecName: Full=Probable exosome complex exonuclease RRP4... 275 6e-72
AM494965_34(AM494965|pid:none) Leishmania braziliensis chromosom... 252 4e-65
AJ308998_1(AJ308998|pid:none) Trypanosoma brucei RRP44 gene for ... 246 2e-63
CR940347_726(CR940347|pid:none) Theileria annulata strain Ankara... 239 3e-61
BC126555_1(BC126555|pid:none) Bos taurus DIS3 mitotic control ho... 220 1e-55
(A0JN80) RecName: Full=DIS3-like exonuclease 1; EC=3.1.... 220 1e-55
(A2RV18) RecName: Full=DIS3-like exonuclease 1; EC=3.1.... 214 7e-54
(Q8TF46) RecName: Full=DIS3-like exonuclease 1; EC=3.1.... 207 2e-51
BC022089_1(BC022089|pid:none) Homo sapiens DIS3 mitotic control ... 207 2e-51
(Q6GN11) RecName: Full=DIS3-like exonuclease 1; EC=3.1.... 206 3e-51
BC073711_1(BC073711|pid:none) Xenopus laevis MGC83653 protein, m... 206 3e-51
(Q0P4R5) RecName: Full=DIS3-like exonuclease 1; EC=3.1.... 201 8e-50
AF496668_1(AF496668|pid:none) Trypanosoma cruzi Rrp44p-like prot... 185 6e-45
(Q0V9R3) RecName: Full=DIS3-like exonuclease 2; EC=3.1.... 177 1e-42
AX015910_1(AX015910|pid:none) Sequence 13 from Patent WO9950284. 173 2e-41
(Q8CI75) RecName: Full=DIS3-like exonuclease 2; EC=3.1.... 171 7e-41
(Q8IYB7) RecName: Full=DIS3-like exonuclease 2; EC=3.1.... 171 1e-40
AL844509_577(AL844509|pid:none) Plasmodium falciparum 3D7 chromo... 170 2e-40
BT047459_1(BT047459|pid:none) Salmo salar clone ssal-eve-506-161... 170 2e-40
AM910993_115(AM910993|pid:none) Plasmodium knowlesi strain H chr... 170 2e-40
T18925(T18925)hypothetical protein C04G2.6 - Caenorhabditis eleg... 163 2e-38
(Q09568) RecName: Full=Uncharacterized ribonuclease F48E8.6; ... 162 6e-38
AL138695_6(AL138695|pid:none) Human DNA sequence from clone RP11... 158 6e-37
BC027357_1(BC027357|pid:none) Mus musculus DIS3 mitotic control ... 157 1e-36
AK012840_1(AK012840|pid:none) Mus musculus 10, 11 days embryo wh... 156 2e-36
AE017347_244(AE017347|pid:none) Cryptococcus neoformans var. neo... 156 2e-36
AK029652_1(AK029652|pid:none) Mus musculus adult male testis cDN... 155 4e-36
BC104534_1(BC104534|pid:none) Bos taurus DIS3 mitotic control ho... 155 4e-36
CP000593_78(CP000593|pid:none) Ostreococcus lucimarinus CCE9901 ... 155 5e-36
(O14040) RecName: Full=Dis3-like exonuclease C2C4.07c; ... 154 1e-35
CR954215_45(CR954215|pid:none) Ostreococcus tauri strain OTTH059... 150 2e-34
AL590443_69(AL590443|pid:none) chromosome III of strain GB-M1 of... 150 2e-34
BT015237_1(BT015237|pid:none) Drosophila melanogaster RE03681 fu... 147 1e-33
CP001326_20(CP001326|pid:none) Micromonas sp. RCC299 chromosome ... 142 4e-32
AC012193_1(AC012193|pid:none) Arabidopsis thaliana chromosome 1 ... 139 5e-31
AY811539_1(AY811539|pid:none) Schistosoma japonicum SJCHGC07896 ... 137 2e-30
AP005012_8(AP005012|pid:none) Oryza sativa Japonica Group genomi... 130 2e-28
AX015899_1(AX015899|pid:none) Sequence 1 from Patent WO9950284. 128 9e-28
FN357307_53(FN357307|pid:none) Schistosoma mansoni genome sequen... 127 2e-27
FN357307_54(FN357307|pid:none) Schistosoma mansoni genome sequen... 127 2e-27
AJ309002_1(AJ309002|pid:none) Trypanosoma brucei ORF1 gene for p... 126 3e-27
AM494965_46(AM494965|pid:none) Leishmania braziliensis chromosom... 126 3e-27
AE015924_1470(AE015924|pid:none) Porphyromonas gingivalis W83, c... 125 4e-27
AE015928_3076(AE015928|pid:none) Bacteroides thetaiotaomicron VP... 125 8e-27
AP006841_4558(AP006841|pid:none) Bacteroides fragilis YCH46 DNA,... 124 1e-26
AP009380_396(AP009380|pid:none) Porphyromonas gingivalis ATCC 33... 124 1e-26
CP001229_661(CP001229|pid:none) Sulfurihydrogenibium azorense Az... 123 2e-26
CP000607_567(CP000607|pid:none) Chlorobium phaeovibrioides DSM 2... 120 2e-25
CP000096_513(CP000096|pid:none) Pelodictyon luteolum DSM 273, co... 118 7e-25
CP000140_3253(CP000140|pid:none) Parabacteroides distasonis ATCC... 117 1e-24
CP001357_652(CP001357|pid:none) Brachyspira hyodysenteriae WA1, ... 117 1e-24
CP001100_2604(CP001100|pid:none) Chloroherpeton thalassium ATCC ... 115 5e-24
CP001099_1357(CP001099|pid:none) Chlorobaculum parvum NCIB 8327,... 114 1e-23
AB245428_1(AB245428|pid:none) Colletotrichum lagenarium ClaSSD1 ... 114 1e-23
AP010656_203(AP010656|pid:none) Candidatus Azobacteroides pseudo... 114 1e-23
AM502246_30(AM502246|pid:none) Leishmania infantum chromosome 28. 114 1e-23
AM502250_31(AM502250|pid:none) Leishmania infantum chromosome 32. 114 1e-23
CP000721_630(CP000721|pid:none) Clostridium beijerinckii NCIMB 8... 114 2e-23
CT005266_45(CT005266|pid:none) Leishmania major strain Friedlin,... 113 2e-23
CP000698_2655(CP000698|pid:none) Geobacter uraniireducens Rf4, c... 113 3e-23
AP007169_229(AP007169|pid:none) Aspergillus oryzae RIB40 genomic... 113 3e-23
BA000028_2428(BA000028|pid:none) Oceanobacillus iheyensis HTE831... 112 7e-23
CP000724_3451(CP000724|pid:none) Alkaliphilus metalliredigens QY... 112 7e-23
AE009951_1184(AE009951|pid:none) Fusobacterium nucleatum subsp. ... 112 7e-23
CP001110_1774(CP001110|pid:none) Pelodictyon phaeoclathratiforme... 111 9e-23
AY118498_1(AY118498|pid:none) Drosophila melanogaster LD08354 fu... 110 3e-22
CP001108_650(CP001108|pid:none) Prosthecochloris aestuarii DSM 2... 109 3e-22
AK090419_1(AK090419|pid:none) Homo sapiens mRNA for FLJ00327 pro... 109 4e-22
AM270165_115(AM270165|pid:none) Aspergillus niger contig An08c01... 109 4e-22
A96988(A96988) FUSION ribonuclease and ribosomal protein S1 doma... 108 6e-22
CP000159_1492(CP000159|pid:none) Salinibacter ruber DSM 13855, c... 108 6e-22
CP000813_2985(CP000813|pid:none) Bacillus pumilus SAFR-032, comp... 108 1e-21
CP000679_1258(CP000679|pid:none) Caldicellulosiruptor saccharoly... 108 1e-21
CP000764_3494(CP000764|pid:none) Bacillus cereus subsp. cytotoxi... 108 1e-21
CU640366_629(CU640366|pid:none) Podospora anserina genomic DNA c... 107 1e-21
AY552545_56(AY552545|pid:none) Uncultured marine gamma proteobac... 107 1e-21
AL670011_20(AL670011|pid:none) Neurospora crassa DNA linkage gro... 107 1e-21
CP000141_289(CP000141|pid:none) Carboxydothermus hydrogenoforman... 107 1e-21
CP000803_475(CP000803|pid:none) Francisella tularensis subsp. ho... 107 2e-21
AM233362_556(AM233362|pid:none) Francisella tularensis subsp. ho... 107 2e-21
AM180355_3246(AM180355|pid:none) Clostridium difficile 630 compl... 106 3e-21
CP001390_3356(CP001390|pid:none) Geobacter sp. FRC-32, complete ... 106 3e-21
CP001130_1013(CP001130|pid:none) Hydrogenobaculum sp. Y04AAS1, c... 106 4e-21
CU207366_3263(CU207366|pid:none) Gramella forsetii KT0803 comple... 106 4e-21
CP000915_277(CP000915|pid:none) Francisella tularensis subsp. me... 105 5e-21
AJ749949_1553(AJ749949|pid:none) Francisella tularensis subsp. t... 105 5e-21
CP001407_5018(CP001407|pid:none) Bacillus cereus 03BB102, comple... 105 6e-21
CP000937_1215(CP000937|pid:none) Francisella philomiragia subsp.... 105 6e-21
BA000043_3044(BA000043|pid:none) Geobacillus kaustophilus HTA426... 105 6e-21
AE017180_1474(AE017180|pid:none) Geobacter sulfurreducens PCA, c... 105 8e-21
CP001056_2972(CP001056|pid:none) Clostridium botulinum B str. Ek... 105 8e-21
CP001078_2716(CP001078|pid:none) Clostridium botulinum E3 str. A... 104 1e-20
AE017333_3471(AE017333|pid:none) Bacillus licheniformis DSM 13, ... 104 1e-20
CP001022_2342(CP001022|pid:none) Exiguobacterium sibiricum 255-1... 104 1e-20
AE017355_4757(AE017355|pid:none) Bacillus thuringiensis serovar ... 104 1e-20
CP000557_2956(CP000557|pid:none) Geobacillus thermodenitrificans... 103 2e-20
CP000922_2469(CP000922|pid:none) Anoxybacillus flavithermus WK1,... 103 2e-20
CP001089_1226(CP001089|pid:none) Geobacter lovleyi SZ, complete ... 103 2e-20
AE017194_5197(AE017194|pid:none) Bacillus cereus ATCC 10987, com... 103 2e-20
CP001101_728(CP001101|pid:none) Chlorobium phaeobacteroides BS1,... 103 2e-20
EF089400_7(EF089400|pid:none) Uncultured marine bacterium EB0_41... 103 3e-20
CU928171_255(CU928171|pid:none) Kluyveromyces thermotolerans str... 102 4e-20
CP000903_4800(CP000903|pid:none) Bacillus weihenstephanensis KBA... 102 4e-20
CP000482_1153(CP000482|pid:none) Pelobacter propionicus DSM 2379... 102 5e-20
CP000422_448(CP000422|pid:none) Pediococcus pentosaceus ATCC 257... 102 7e-20
AK295363_1(AK295363|pid:none) Homo sapiens cDNA FLJ60550 complet... 101 1e-19
CP001357_2283(CP001357|pid:none) Brachyspira hyodysenteriae WA1,... 100 2e-19
CP000148_1370(CP000148|pid:none) Geobacter metallireducens GS-15... 100 2e-19
AP008955_5224(AP008955|pid:none) Brevibacillus brevis NBRC 10059... 100 3e-19
CP000860_318(CP000860|pid:none) Candidatus Desulforudis audaxvia... 100 3e-19
CP001107_1481(CP001107|pid:none) Eubacterium rectale ATCC 33656,... 100 3e-19
CP000920_898(CP000920|pid:none) Streptococcus pneumoniae P1031, ... 99 4e-19
CP001348_2200(CP001348|pid:none) Clostridium cellulolyticum H10,... 99 6e-19
CP000109_1489(CP000109|pid:none) Thiomicrospira crunogena XCL-2,... 99 6e-19
AM412317_230(AM412317|pid:none) Clostridium botulinum A str. ATC... 99 8e-19
AP008934_1907(AP008934|pid:none) Staphylococcus saprophyticus su... 98 1e-18
CR382123_455(CR382123|pid:none) Kluyveromyces lactis strain NRRL... 98 1e-18
CP000513_571(CP000513|pid:none) Dichelobacter nodosus VCS1703A, ... 98 1e-18
CP000924_1335(CP000924|pid:none) Thermoanaerobacter pseudethanol... 98 1e-18
CP001615_846(CP001615|pid:none) Exiguobacterium sp. AT1b, comple... 98 1e-18
AF012898_1(AF012898|pid:none) Candida albicans protein phosphata... 98 1e-18
CP000885_2835(CP000885|pid:none) Clostridium phytofermentans ISD... 98 1e-18
CP000448_269(CP000448|pid:none) Syntrophomonas wolfei subsp. wol... 97 2e-18
CP000728_226(CP000728|pid:none) Clostridium botulinum F str. Lan... 97 2e-18
CP000713_2217(CP000713|pid:none) Psychrobacter sp. PRwf-1, compl... 97 2e-18
AM180252_593(AM180252|pid:none) Lawsonia intracellularis PHE/MN1... 97 2e-18
CP001033_950(CP001033|pid:none) Streptococcus pneumoniae CGSP14,... 97 3e-18
AE005672_917(AE005672|pid:none) Streptococcus pneumoniae TIGR4, ... 97 3e-18
FM211187_858(FM211187|pid:none) Streptococcus pneumoniae ATCC 70... 97 3e-18
CP000725_698(CP000725|pid:none) Streptococcus gordonii str. Chal... 97 3e-18
CP000919_868(CP000919|pid:none) Streptococcus pneumoniae JJA, co... 97 3e-18
AP008971_652(AP008971|pid:none) Finegoldia magna ATCC 29328 DNA,... 97 3e-18
CP001015_888(CP001015|pid:none) Streptococcus pneumoniae G54, co... 96 4e-18
BX908798_1048(BX908798|pid:none) Parachlamydia-related symbiont ... 96 4e-18
CP001114_349(CP001114|pid:none) Deinococcus deserti VCD115, comp... 96 5e-18
AE017198_718(AE017198|pid:none) Lactobacillus johnsonii NCC 533,... 96 5e-18
CR380954_49(CR380954|pid:none) Candida glabrata strain CBS138 ch... 96 6e-18
CP001175_146(CP001175|pid:none) Listeria monocytogenes HCC23, co... 96 6e-18
AB1750(AB1750) exoribonuclease RNase-R homolog lin2543 [imported... 96 6e-18
CP001020_847(CP001020|pid:none) Coxiella burnetii CbuK_Q154, com... 96 6e-18
CP001098_1559(CP001098|pid:none) Halothermothrix orenii H 168, c... 96 6e-18
CP000112_2593(CP000112|pid:none) Desulfovibrio desulfuricans G20... 96 6e-18
CP000890_1067(CP000890|pid:none) Coxiella burnetii RSA 331, comp... 96 6e-18
AE016828_943(AE016828|pid:none) Coxiella burnetii RSA 493, compl... 96 6e-18
AE017262_2398(AE017262|pid:none) Listeria monocytogenes str. 4b ... 96 6e-18
AI1380(AI1380) exoribonuclease RNase-R homolog lmo2449 [imported... 95 8e-18
CP000783_181(CP000783|pid:none) Enterobacter sakazakii ATCC BAA-... 95 1e-17
AE014133_1456(AE014133|pid:none) Streptococcus mutans UA159, com... 95 1e-17
CP000387_1521(CP000387|pid:none) Streptococcus sanguinis SK36, c... 95 1e-17
CP001034_1978(CP001034|pid:none) Natranaerobius thermophilus JW/... 94 1e-17
AJ564267_1(AJ564267|pid:none) Staphylococcus aureus rnr gene for... 94 1e-17
AE017221_554(AE017221|pid:none) Thermus thermophilus HB27, compl... 94 1e-17
AP008226_910(AP008226|pid:none) Thermus thermophilus HB8 genomic... 94 1e-17
CR382139_868(CR382139|pid:none) Debaryomyces hansenii strain CBS... 94 2e-17
AM295250_431(AM295250|pid:none) Staphylococcus carnosus subsp. c... 94 2e-17
CP001016_3314(CP001016|pid:none) Beijerinckia indica subsp. indi... 94 2e-17
AE008691_921(AE008691|pid:none) Thermoanaerobacter tengcongensis... 94 2e-17
FM177140_1092(FM177140|pid:none) Lactobacillus casei BL23 comple... 94 2e-17
CP000490_21(CP000490|pid:none) Paracoccus denitrificans PD1222 c... 94 2e-17
AP006627_2995(AP006627|pid:none) Bacillus clausii KSM-K16 DNA, c... 94 2e-17
CP000936_986(CP000936|pid:none) Streptococcus pneumoniae Hungary... 94 2e-17
FM204883_1522(FM204883|pid:none) Streptococcus equi subsp. equi ... 94 2e-17
AP009351_754(AP009351|pid:none) Staphylococcus aureus subsp. aur... 94 2e-17
CR936503_1409(CR936503|pid:none) Lactobacillus sakei strain 23K ... 93 3e-17
CP000514_2356(CP000514|pid:none) Marinobacter aquaeolei VT8, com... 93 4e-17
CP000830_15(CP000830|pid:none) Dinoroseobacter shibae DFL 12, co... 92 5e-17
CR382132_572(CR382132|pid:none) Yarrowia lipolytica strain CLIB1... 92 5e-17
AJ564286_1(AJ564286|pid:none) Staphylococcus aureus rnr gene for... 92 5e-17
AM263198_2397(AM263198|pid:none) Listeria welshimeri serovar 6b ... 92 5e-17
CP000961_4172(CP000961|pid:none) Shewanella woodyi ATCC 51908, c... 92 5e-17
CP000142_2299(CP000142|pid:none) Pelobacter carbinolicus DSM 238... 92 7e-17
CP000916_1862(CP000916|pid:none) Thermotoga neapolitana DSM 4359... 92 7e-17
AM743169_1450(AM743169|pid:none) Stenotrophomonas maltophilia K2... 92 7e-17
CP000472_674(CP000472|pid:none) Shewanella piezotolerans WP3, co... 92 9e-17
CR954246_2902(CR954246|pid:none) Pseudoalteromonas haloplanktis ... 92 9e-17
CP000285_878(CP000285|pid:none) Chromohalobacter salexigens DSM ... 92 9e-17
AJ938182_736(AJ938182|pid:none) Staphylococcus aureus RF122 comp... 92 9e-17
CP000381_1031(CP000381|pid:none) Neisseria meningitidis 053442, ... 91 1e-16
CP001154_2553(CP001154|pid:none) Laribacter hongkongensis HLHK9,... 91 1e-16
CP000879_946(CP000879|pid:none) Petrotoga mobilis SJ95, complete... 91 1e-16
CP000388_987(CP000388|pid:none) Pseudoalteromonas atlantica T6c,... 91 1e-16
CP001050_1010(CP001050|pid:none) Neisseria gonorrhoeae NCCP11945... 91 1e-16
CP000033_431(CP000033|pid:none) Lactobacillus acidophilus NCFM, ... 91 1e-16
CP001150_2522(CP001150|pid:none) Rhodobacter sphaeroides KD131 c... 91 2e-16
CP000143_2742(CP000143|pid:none) Rhodobacter sphaeroides 2.4.1 c... 91 2e-16
CP000851_3574(CP000851|pid:none) Shewanella pealeana ATCC 700345... 91 2e-16
CP000896_382(CP000896|pid:none) Acholeplasma laidlawii PG-8A, co... 91 2e-16
(Q98QL0) RecName: Full=Ribonuclease R; Short=RNase R; ... 91 2e-16
CU179680_209(CU179680|pid:none) Mycoplasma agalactiae PG2 chromo... 91 2e-16
EU890828_1(EU890828|pid:none) Escherichia coli strain TB182A put... 90 3e-16
CP000356_1220(CP000356|pid:none) Sphingopyxis alaskensis RB2256,... 90 3e-16
AP007281_389(AP007281|pid:none) Lactobacillus reuteri JCM 1112 D... 90 3e-16
CP000633_1293(CP000633|pid:none) Agrobacterium vitis S4 chromoso... 90 3e-16
CP000680_636(CP000680|pid:none) Pseudomonas mendocina ymp, compl... 90 3e-16
BA000031_1890(BA000031|pid:none) Vibrio parahaemolyticus RIMD 22... 90 3e-16
AL954747_350(AL954747|pid:none) Nitrosomonas europaea ATCC 19718... 90 4e-16
CP000774_2814(CP000774|pid:none) Parvibaculum lavamentivorans DS... 90 4e-16
CP001071_900(CP001071|pid:none) Akkermansia muciniphila ATCC BAA... 90 4e-16
CP000931_3643(CP000931|pid:none) Shewanella halifaxensis HAW-EB4... 90 4e-16
AM946015_512(AM946015|pid:none) Streptococcus uberis 0140J compl... 89 5e-16
AM902716_2718(AM902716|pid:none) Bordetella petrii strain DSM 12... 89 5e-16
AE014075_5154(AE014075|pid:none) Escherichia coli CFT073, comple... 89 5e-16
CP000266_4023(CP000266|pid:none) Shigella flexneri 5 str. 8401, ... 89 5e-16
CP000034_4062(CP000034|pid:none) Shigella dysenteriae Sd197, com... 89 5e-16
AP009240_4476(AP009240|pid:none) Escherichia coli SE11 DNA, comp... 89 5e-16
AM884176_649(AM884176|pid:none) Chlamydia trachomatis strain L2/... 89 5e-16
S56404(S56404;C31965;F65228) virulence-associated protein vacB h... 89 5e-16
CP000247_4375(CP000247|pid:none) Escherichia coli 536, complete ... 89 5e-16
AE015451_4814(AE015451|pid:none) Pseudomonas putida KT2440 compl... 89 6e-16
CP000038_4051(CP000038|pid:none) Shigella sonnei Ss046, complete... 89 6e-16
AE017243_33(AE017243|pid:none) Mycoplasma hyopneumoniae J, compl... 89 6e-16
CP000036_3968(CP000036|pid:none) Shigella boydii Sb227, complete... 89 6e-16
AM285303_16(AM285303|pid:none) Spiroplasma citri GII3-3X chromos... 89 6e-16
CP000716_1476(CP000716|pid:none) Thermosipho melanesiensis BI429... 89 6e-16
AE015929_565(AE015929|pid:none) Staphylococcus epidermidis ATCC ... 89 6e-16
CP000926_4904(CP000926|pid:none) Pseudomonas putida GB-1, comple... 89 6e-16
CP000057_906(CP000057|pid:none) Haemophilus influenzae 86-028NP,... 89 8e-16
AE017332_38(AE017332|pid:none) Mycoplasma hyopneumoniae 232, com... 88 1e-15
BX640430_239(BX640430|pid:none) Bordetella parapertussis strain ... 88 1e-15
BX640421_259(BX640421|pid:none) Bordetella pertussis strain Toha... 88 1e-15
(Q9WZI1) RecName: Full=Ribonuclease R; Short=RNase R; ... 88 1e-15
AX015901_1(AX015901|pid:none) Sequence 3 from Patent WO9950284. 88 1e-15
AP006716_2105(AP006716|pid:none) Staphylococcus haemolyticus JCS... 88 1e-15
AE017244_38(AE017244|pid:none) Mycoplasma hyopneumoniae 7448, co... 88 1e-15
AE016814_115(AE016814|pid:none) Ashbya gossypii (= Eremothecium ... 88 1e-15
CU459141_427(CU459141|pid:none) Acinetobacter baumannii str. AYE... 88 1e-15
CP000113_4099(CP000113|pid:none) Myxococcus xanthus DK 1622, com... 88 1e-15
CP000521_3340(CP000521|pid:none) Acinetobacter baumannii ATCC 17... 88 1e-15
CP000771_175(CP000771|pid:none) Fervidobacterium nodosum Rt17-B1... 88 1e-15
CU468230_429(CU468230|pid:none) Acinetobacter baumannii str. SDF... 88 1e-15
AE004439_1954(AE004439|pid:none) Pasteurella multocida subsp. mu... 88 1e-15
AE014299_3823(AE014299|pid:none) Shewanella oneidensis MR-1, com... 88 1e-15
CP001127_4300(CP001127|pid:none) Salmonella enterica subsp. ente... 87 2e-15
AE017220_4244(AE017220|pid:none) Salmonella enterica subsp. ente... 87 2e-15
CP000158_2241(CP000158|pid:none) Hyphomonas neptunium ATCC 15444... 87 2e-15
CP001185_1733(CP001185|pid:none) Thermosipho africanus TCF52B, c... 87 2e-15
AM406671_1288(AM406671|pid:none) Lactococcus lactis subsp. cremo... 87 2e-15
CP000029_443(CP000029|pid:none) Staphylococcus epidermidis RP62A... 87 2e-15
CP001157_740(CP001157|pid:none) Azotobacter vinelandii DJ, compl... 87 2e-15
FM872307_406(FM872307|pid:none) Chlamydia trachomatis B/TZ1A828/... 87 2e-15
(O84402) RecName: Full=Ribonuclease R; Short=RNase R; ... 87 2e-15
CP000051_417(CP000051|pid:none) Chlamydia trachomatis A/HAR-13, ... 87 2e-15
D11024_2(D11024|pid:none) Shigella flexneri vacB gene. 87 2e-15
BX294147_221(BX294147|pid:none) Rhodopirellula baltica SH 1 comp... 87 3e-15
CP000473_5179(CP000473|pid:none) Solibacter usitatus Ellin6076, ... 87 3e-15
CP000949_4644(CP000949|pid:none) Pseudomonas putida W619, comple... 87 3e-15
CP000083_4482(CP000083|pid:none) Colwellia psychrerythraea 34H, ... 87 3e-15
CU928179_698(CU928179|pid:none) Zygosaccharomyces rouxii strain ... 87 3e-15
CP001013_2844(CP001013|pid:none) Leptothrix cholodnii SP-6, comp... 86 4e-15
CP000264_356(CP000264|pid:none) Jannaschia sp. CCS1, complete ge... 86 4e-15
CP000260_415(CP000260|pid:none) Streptococcus pyogenes MGAS10270... 86 4e-15
AP009385_1527(AP009385|pid:none) Burkholderia multivorans ATCC 1... 86 4e-15
CP000425_916(CP000425|pid:none) Lactococcus lactis subsp. cremor... 86 4e-15
CP000702_207(CP000702|pid:none) Thermotoga petrophila RKU-1, com... 86 4e-15
CP000362_170(CP000362|pid:none) Roseobacter denitrificans OCh 11... 86 4e-15
CP000438_5250(CP000438|pid:none) Pseudomonas aeruginosa UCBPP-PA... 86 5e-15
CR848038_234(CR848038|pid:none) Chlamydophila abortus strain S26... 86 5e-15
AE004092_358(AE004092|pid:none) Streptococcus pyogenes M1 GAS, c... 86 5e-15
CP000407_1383(CP000407|pid:none) Streptococcus suis 05ZYH33, com... 86 5e-15
CP000031_3253(CP000031|pid:none) Ruegeria pomeroyi DSS-3, comple... 86 5e-15
AM167904_2121(AM167904|pid:none) Bordetella avium 197N complete ... 86 5e-15
AE004091_4933(AE004091|pid:none) Pseudomonas aeruginosa PAO1, co... 86 5e-15
FM209186_5323(FM209186|pid:none) Pseudomonas aeruginosa LESB58 c... 86 5e-15
CP000672_1286(CP000672|pid:none) Haemophilus influenzae PittGG, ... 86 5e-15
CP000507_3057(CP000507|pid:none) Shewanella amazonensis SB2B, co... 86 5e-15
CU466930_864(CU466930|pid:none) Candidatus Cloacamonas acidamino... 86 5e-15
CP000017_413(CP000017|pid:none) Streptococcus pyogenes MGAS5005,... 86 5e-15
CP000446_3250(CP000446|pid:none) Shewanella sp. MR-4, complete g... 86 7e-15
CP000259_413(CP000259|pid:none) Streptococcus pyogenes MGAS9429,... 86 7e-15
BA000034_1501(BA000034|pid:none) Streptococcus pyogenes SSI-1 DN... 86 7e-15
AL646052_1229(AL646052|pid:none) Ralstonia solanacearum GMI1000 ... 86 7e-15
CP000262_427(CP000262|pid:none) Streptococcus pyogenes MGAS10750... 86 7e-15
CP000822_3553(CP000822|pid:none) Citrobacter koseri ATCC BAA-895... 86 7e-15
CP000444_679(CP000444|pid:none) Shewanella sp. MR-7, complete ge... 86 7e-15
AE009949_420(AE009949|pid:none) Streptococcus pyogenes MGAS8232,... 86 7e-15
AY728030_1(AY728030|pid:none) Herminiimonas arsenicoxydans clone... 86 7e-15
AM295007_1433(AM295007|pid:none) Streptococcus pyogenes Manfredo... 86 7e-15
CP000769_1434(CP000769|pid:none) Anaeromyxobacter sp. Fw109-5, c... 86 7e-15
CP000076_567(CP000076|pid:none) Pseudomonas fluorescens Pf-5, co... 86 7e-15
AL766851_87(AL766851|pid:none) Streptococcus agalactiae NEM316 c... 85 9e-15
AE016827_473(AE016827|pid:none) Mannheimia succiniciproducens MB... 85 9e-15
AE017340_1931(AE017340|pid:none) Idiomarina loihiensis L2TR, com... 85 9e-15
(Q02146) RecName: Full=Ribonuclease R 2; Short=RNase R ... 85 9e-15
CP000284_1623(CP000284|pid:none) Methylobacillus flagellatus KT,... 85 9e-15
CP000425_1227(CP000425|pid:none) Lactococcus lactis subsp. cremo... 85 9e-15
CP000744_5589(CP000744|pid:none) Pseudomonas aeruginosa PA7, com... 85 1e-14
CP000157_1223(CP000157|pid:none) Erythrobacter litoralis HTCC259... 85 1e-14
CP000411_1295(CP000411|pid:none) Oenococcus oeni PSU-1, complete... 85 1e-14
AE015925_238(AE015925|pid:none) Chlamydophila caviae GPIC, compl... 85 1e-14
CP000687_1449(CP000687|pid:none) Actinobacillus pleuropneumoniae... 85 1e-14
CP000304_3576(CP000304|pid:none) Pseudomonas stutzeri A1501, com... 85 1e-14
CP000075_579(CP000075|pid:none) Pseudomonas syringae pv. syringa... 85 1e-14
CP000359_457(CP000359|pid:none) Deinococcus geothermalis DSM 113... 85 1e-14
CP000453_575(CP000453|pid:none) Alkalilimnicola ehrlichii MLHE-1... 84 1e-14
AE013598_2041(AE013598|pid:none) Xanthomonas oryzae pv. oryzae K... 84 1e-14
CP000316_2649(CP000316|pid:none) Polaromonas sp. JS666, complete... 84 2e-14
DQ490056_16(DQ490056|pid:none) Lactococcus phage Q54, complete g... 84 2e-14
CP001191_1285(CP001191|pid:none) Rhizobium leguminosarum bv. tri... 84 2e-14
CP000447_3329(CP000447|pid:none) Shewanella frigidimarina NCIMB ... 84 2e-14
AE008922_1493(AE008922|pid:none) Xanthomonas campestris pv. camp... 84 3e-14
AE008923_1543(AE008923|pid:none) Xanthomonas axonopodis pv. citr... 84 3e-14
CP000503_3385(CP000503|pid:none) Shewanella sp. W3-18-1, complet... 84 3e-14
CP000116_608(CP000116|pid:none) Thiobacillus denitrificans ATCC ... 84 3e-14
CP000082_2101(CP000082|pid:none) Psychrobacter arcticus 273-4, c... 84 3e-14
CP000449_1277(CP000449|pid:none) Maricaulis maris MCS10, complet... 84 3e-14
AM406671_1552(AM406671|pid:none) Lactococcus lactis subsp. cremo... 83 3e-14
CP000488_480(CP000488|pid:none) Candidatus Ruthia magnifica str.... 83 3e-14
CP000891_733(CP000891|pid:none) Shewanella baltica OS195, comple... 83 3e-14
AM286415_368(AM286415|pid:none) Yersinia enterocolitica subsp. e... 83 3e-14
AP009384_1859(AP009384|pid:none) Azorhizobium caulinodans ORS 57... 83 3e-14
BA000040_5112(BA000040|pid:none) Bradyrhizobium japonicum USDA 1... 83 4e-14
CP000529_2418(CP000529|pid:none) Polaromonas naphthalenivorans C... 83 4e-14
CP000964_4979(CP000964|pid:none) Klebsiella pneumoniae 342, comp... 83 4e-14
AE016853_4812(AE016853|pid:none) Pseudomonas syringae pv. tomato... 82 6e-14
CP000647_4505(CP000647|pid:none) Klebsiella pneumoniae subsp. pn... 82 6e-14
CP000248_1939(CP000248|pid:none) Novosphingobium aromaticivorans... 82 6e-14
CP000352_2085(CP000352|pid:none) Ralstonia metallidurans CH34, c... 82 6e-14
CP001389_1067(CP001389|pid:none) Rhizobium sp. NGR234, complete ... 82 6e-14
CP000644_645(CP000644|pid:none) Aeromonas salmonicida subsp. sal... 82 6e-14
CP000563_3585(CP000563|pid:none) Shewanella baltica OS155, compl... 82 6e-14
CP000927_1494(CP000927|pid:none) Caulobacter sp. K31, complete g... 82 6e-14
CP000416_635(CP000416|pid:none) Lactobacillus brevis ATCC 367, c... 82 7e-14
AM181176_517(AM181176|pid:none) Pseudomonas fluorescens SBW25 co... 82 7e-14
CP001048_448(CP001048|pid:none) Yersinia pseudotuberculosis PB1/... 82 7e-14
AM889285_44(AM889285|pid:none) Gluconacetobacter diazotrophicus ... 82 7e-14
AD0047(AD0047) ribonuclease R (EC 3.1.-.-) [imported] - Yersinia... 82 7e-14
CP001091_1486(CP001091|pid:none) Actinobacillus pleuropneumoniae... 82 7e-14
CP000789_84(CP000789|pid:none) Vibrio harveyi ATCC BAA-1116 chro... 82 7e-14
AE017143_589(AE017143|pid:none) Haemophilus ducreyi strain 35000... 82 7e-14
AE016823_35(AE016823|pid:none) Leptospira interrogans serovar Co... 82 1e-13
CP000024_602(CP000024|pid:none) Streptococcus thermophilus CNRZ1... 82 1e-13
CP000912_558(CP000912|pid:none) Brucella suis ATCC 23445 chromos... 82 1e-13
CP000709_505(CP000709|pid:none) Brucella ovis ATCC 25840 chromos... 82 1e-13
CP001068_1053(CP001068|pid:none) Ralstonia pickettii 12J chromos... 82 1e-13
AE008918_666(AE008918|pid:none) Brucella melitensis 16M chromoso... 82 1e-13
CP001132_1525(CP001132|pid:none) Acidithiobacillus ferrooxidans ... 82 1e-13
CU633749_1844(CU633749|pid:none) Cupriavidus taiwanensis str. LM... 81 1e-13
AE017282_1868(AE017282|pid:none) Methylococcus capsulatus str. B... 81 1e-13
CP000115_1706(CP000115|pid:none) Nitrobacter winogradskyi Nb-255... 81 2e-13
CP000655_1263(CP000655|pid:none) Polynucleobacter necessarius su... 81 2e-13
CP000908_2346(CP000908|pid:none) Methylobacterium extorquens PA1... 81 2e-13
CP001298_2527(CP001298|pid:none) Methylobacterium chloromethanic... 81 2e-13
CP000302_506(CP000302|pid:none) Shewanella denitrificans OS217, ... 81 2e-13
AL591688_1304(AL591688|pid:none) Sinorhizobium meliloti 1021 com... 81 2e-13
AK001346_1(AK001346|pid:none) Homo sapiens cDNA FLJ10484 fis, cl... 80 2e-13
CP000414_1641(CP000414|pid:none) Leuconostoc mesenteroides subsp... 80 2e-13
CP000103_1939(CP000103|pid:none) Nitrosospira multiformis ATCC 2... 80 2e-13
CP000390_1344(CP000390|pid:none) Mesorhizobium sp. BNC1, complet... 80 2e-13
CP001280_3743(CP001280|pid:none) Methylocella silvestris BL2, co... 80 2e-13
CP000462_678(CP000462|pid:none) Aeromonas hydrophila subsp. hydr... 80 2e-13
AM260479_2293(AM260479|pid:none) Ralstonia eutropha H16 chromoso... 80 2e-13
CP001011_846(CP001011|pid:none) Xylella fastidiosa M23, complete... 80 2e-13
CP000539_2470(CP000539|pid:none) Acidovorax sp. JS42, complete g... 80 2e-13
CP001184_63(CP001184|pid:none) Ureaplasma urealyticum serovar 10... 80 2e-13
CP000527_772(CP000527|pid:none) Desulfovibrio vulgaris subsp. vu... 80 3e-13
AE007869_1277(AE007869|pid:none) Agrobacterium tumefaciens str. ... 80 3e-13
AF447860_1(AF447860|pid:none) Methylococcus capsulatus Rnr-like ... 80 3e-13
AE017285_2454(AE017285|pid:none) Desulfovibrio vulgaris subsp. v... 80 3e-13
CP000348_61(CP000348|pid:none) Leptospira borgpetersenii serovar... 80 4e-13
AP009247_467(AP009247|pid:none) Candidatus Vesicomyosocius okuta... 79 5e-13
CP000301_2213(CP000301|pid:none) Rhodopseudomonas palustris BisB... 79 5e-13
CU234118_4274(CU234118|pid:none) Bradyrhizobium sp. ORS278,compl... 79 5e-13
CP000282_1052(CP000282|pid:none) Saccharophagus degradans 2-40, ... 79 6e-13
AE016795_1214(AE016795|pid:none) Vibrio vulnificus CMCP6 chromos... 79 6e-13
(Q9CH00) RecName: Full=Ribonuclease R 1; Short=RNase R ... 79 6e-13
BA000037_3061(BA000037|pid:none) Vibrio vulnificus YJ016 DNA, ch... 79 6e-13
CP001321_1351(CP001321|pid:none) Haemophilus parasuis SH0165, co... 79 8e-13
BX571965_1890(BX571965|pid:none) Burkholderia pseudomallei strai... 79 8e-13
CP000230_3193(CP000230|pid:none) Rhodospirillum rubrum ATCC 1117... 79 8e-13
CP000572_1797(CP000572|pid:none) Burkholderia pseudomallei 1106a... 79 8e-13
CP001277_284(CP001277|pid:none) Candidatus Hamiltonella defensa ... 78 1e-12
CP001010_587(CP001010|pid:none) Polynucleobacter necessarius sub... 78 1e-12
CP000151_1500(CP000151|pid:none) Burkholderia sp. 383 chromosome... 78 1e-12
CP000627_2119(CP000627|pid:none) Vibrio cholerae O395 chromosome... 77 2e-12
CP000283_3020(CP000283|pid:none) Rhodopseudomonas palustris BisB... 77 2e-12
CP000155_5313(CP000155|pid:none) Hahella chejuensis KCTC 2396, c... 77 2e-12
CP001349_7096(CP001349|pid:none) Methylobacterium nodulans ORS 2... 77 2e-12
AM746676_7443(AM746676|pid:none) Sorangium cellulosum 'So ce 56'... 77 2e-12
CP000378_1057(CP000378|pid:none) Burkholderia cenocepacia AU 105... 77 2e-12
AM747720_1547(AM747720|pid:none) Burkholderia cenocepacia J2315 ... 77 2e-12
CP000394_803(CP000394|pid:none) Granulibacter bethesdensis CGDNI... 77 2e-12
CP001096_3473(CP001096|pid:none) Rhodopseudomonas palustris TIE-... 77 3e-12
BX571874_116(BX571874|pid:none) Photorhabdus luminescens subsp. ... 77 3e-12
FP236842_506(FP236842|pid:none) Erwinia pyrifoliae strain Ep1/96... 76 4e-12
CP000699_4019(CP000699|pid:none) Sphingomonas wittichii RW1, com... 76 4e-12
BX572603_41(BX572603|pid:none) Rhodopseudomonas palustris CGA009... 76 4e-12
CP000155_1634(CP000155|pid:none) Hahella chejuensis KCTC 2396, c... 76 4e-12
CP000675_110(CP000675|pid:none) Legionella pneumophila str. Corb... 76 4e-12
CP000512_2937(CP000512|pid:none) Acidovorax citrulli AAC00-1, co... 76 5e-12
CP000826_436(CP000826|pid:none) Serratia proteamaculans 568, com... 76 5e-12
AE017263_210(AE017263|pid:none) Mesoplasma florum L1 complete ge... 75 7e-12
AF174645_1(AF174645|pid:none) Brucella abortus virulence-associa... 75 7e-12
AE017308_265(AE017308|pid:none) Mycoplasma mobile 163K complete ... 75 9e-12
CP000463_3351(CP000463|pid:none) Rhodopseudomonas palustris BisA... 75 1e-11
(P57628) RecName: Full=Ribonuclease R; Short=RNase R; ... 75 1e-11
CR378673_270(CR378673|pid:none) Photobacterium profundum SS9; se... 75 1e-11
CP000360_3960(CP000360|pid:none) Acidobacteria bacterium Ellin34... 75 1e-11
CP001161_519(CP001161|pid:none) Buchnera aphidicola str. 5A (Acy... 75 1e-11
CP001158_517(CP001158|pid:none) Buchnera aphidicola str. Tuc7 (A... 75 1e-11
BA000003_527(BA000003|pid:none) Buchnera aphidicola str. APS (Ac... 75 1e-11
CP000267_1939(CP000267|pid:none) Rhodoferax ferrireducens T118, ... 74 2e-11
CP001503_1860(CP001503|pid:none) Burkholderia glumae BGR1 chromo... 74 2e-11
CP001025_1452(CP001025|pid:none) Burkholderia ambifaria MC40-6 c... 74 2e-11
CP001472_1920(CP001472|pid:none) Acidobacterium capsulatum ATCC ... 74 2e-11
CP000792_1313(CP000792|pid:none) Campylobacter concisus 13826, c... 74 3e-11
AM942759_3341(AM942759|pid:none) Proteus mirabilis strain HI4320... 73 3e-11
CP000777_22(CP000777|pid:none) Leptospira biflexa serovar Patoc ... 73 3e-11
CP000943_6335(CP000943|pid:none) Methylobacterium sp. 4-46, comp... 73 3e-11
CP000524_793(CP000524|pid:none) Bartonella bacilliformis KC583, ... 73 4e-11
CP000251_2424(CP000251|pid:none) Anaeromyxobacter dehalogenans 2... 73 4e-11
AM260522_224(AM260522|pid:none) Helicobacter acinonychis str. Sh... 73 4e-11
AM260525_1001(AM260525|pid:none) Bartonella tribocorum CIP 10547... 72 6e-11
AE017125_534(AE017125|pid:none) Helicobacter hepaticus ATCC 5144... 72 6e-11
CP001032_2652(CP001032|pid:none) Opitutus terrae PB90-1, complet... 72 8e-11
AE015450_458(AE015450|pid:none) Mycoplasma gallisepticum strain ... 72 1e-10
EF583992_5(EF583992|pid:none) Uncultured haloarchaeon clone fosm... 71 1e-10
AM180088_2251(AM180088|pid:none) Haloquadratum walsbyi DSM 16790... 71 1e-10
CP001001_3521(CP001001|pid:none) Methylobacterium radiotolerans ... 70 2e-10
CP001279_1210(CP001279|pid:none) Nautilia profundicola AmH, comp... 70 3e-10
CP000361_228(CP000361|pid:none) Arcobacter butzleri RM4018, comp... 70 3e-10
(P56123) RecName: Full=Ribonuclease R; Short=RNase R; ... 69 5e-10
AM910989_33(AM910989|pid:none) Plasmodium knowlesi strain H chro... 69 5e-10
BA000026_334(BA000026|pid:none) Mycoplasma penetrans HF-2 DNA, c... 69 5e-10
CP000117_547(CP000117|pid:none) Anabaena variabilis ATCC 29413, ... 69 8e-10
(P75529) RecName: Full=Ribonuclease R; Short=RNase R; ... 69 8e-10
AB027825_1(AB027825|pid:none) Schizosaccharomyces pombe gene for... 68 1e-09
CP000241_1192(CP000241|pid:none) Helicobacter pylori HPAG1, comp... 68 1e-09
CP001472_2574(CP001472|pid:none) Acidobacterium capsulatum ATCC ... 68 1e-09
CP000767_694(CP000767|pid:none) Campylobacter curvus 525.92, com... 67 2e-09
CP001173_1167(CP001173|pid:none) Helicobacter pylori G27, comple... 67 2e-09
AM910993_336(AM910993|pid:none) Plasmodium knowlesi strain H chr... 67 2e-09
CR382399_67(CR382399|pid:none) Plasmodium falciparum chromosome ... 66 4e-09
CP000932_905(CP000932|pid:none) Campylobacter lari RM2100, compl... 66 4e-09
AL844505_152(AL844505|pid:none) Plasmodium falciparum 3D7 chromo... 66 4e-09
CP001037_5703(CP001037|pid:none) Nostoc punctiforme PCC 73102, c... 66 5e-09
AP009178_1162(AP009178|pid:none) Nitratiruptor sp. SB155-2 genom... 66 5e-09
AL845506_5(AL845506|pid:none) Mouse DNA sequence from clone RP23... 65 9e-09
AL845506_4(AL845506|pid:none) Mouse DNA sequence from clone RP23... 65 9e-09
BC172937_1(BC172937|pid:none) Synthetic construct Mus musculus c... 65 9e-09
AP009179_431(AP009179|pid:none) Sulfurovum sp. NBC37-1 genomic D... 64 2e-08
CP000153_541(CP000153|pid:none) Sulfurimonas denitrificans DSM 1... 64 2e-08
CP001072_1226(CP001072|pid:none) Helicobacter pylori Shi470, com... 64 3e-08
(A7MMD8) RecName: Full=Exoribonuclease 2; EC=3.1.13.1; ... 63 4e-08
CP000828_4108(CP000828|pid:none) Acaryochloris marina MBIC11017,... 62 6e-08
CP000814_588(CP000814|pid:none) Campylobacter jejuni subsp. jeju... 62 8e-08
CP000025_716(CP000025|pid:none) Campylobacter jejuni RM1221, com... 62 8e-08
AL111168_595(AL111168|pid:none) Campylobacter jejuni subsp. jeju... 62 1e-07
CP000487_1077(CP000487|pid:none) Campylobacter fetus subsp. fetu... 62 1e-07
AY811507_1(AY811507|pid:none) Schistosoma japonicum SJCHGC05889 ... 61 2e-07
CR378676_119(CR378676|pid:none) Photobacterium profundum SS9 chr... 61 2e-07
AY920334_3(AY920334|pid:none) Campylobacter jejuni type I restri... 61 2e-07
(A8AG96) RecName: Full=Exoribonuclease 2; EC=3.1.13.1; ... 60 4e-07
AY596297_1840(AY596297|pid:none) Haloarcula marismortui ATCC 430... 60 4e-07
(P59107) RecName: Full=Exoribonuclease 2; EC=3.1.13.1; ... 59 5e-07
(Q0T5B1) RecName: Full=Exoribonuclease 2; EC=3.1.13.1; ... 59 5e-07
CP000473_5428(CP000473|pid:none) Solibacter usitatus Ellin6076, ... 59 9e-07
CP000254_1112(CP000254|pid:none) Methanospirillum hungatei JF-1,... 59 9e-07
(Q32GP4) RecName: Full=Exoribonuclease 2; EC=3.1.13.1; ... 58 1e-06
AL929355_59(AL929355|pid:none) Plasmodium falciparum strain 3D7,... 58 1e-06
AL844508_60(AL844508|pid:none) Plasmodium falciparum 3D7 chromos... 58 1e-06
FM180568_1480(FM180568|pid:none) Escherichia coli 0127:H6 E2348/... 58 1e-06
(Q31ZY2) RecName: Full=Exoribonuclease 2; EC=3.1.13.1; ... 58 1e-06
EU901693_1(EU901693|pid:none) Escherichia coli strain TB182A RNa... 58 1e-06
AE005174_2226(AE005174|pid:none) Escherichia coli O157:H7 EDL933... 58 1e-06
(Q3Z135) RecName: Full=Exoribonuclease 2; EC=3.1.13.1; ... 58 1e-06
CU928162_1466(CU928162|pid:none) Escherichia coli ED1a chromosom... 58 1e-06
CP001113_1724(CP001113|pid:none) Salmonella enterica subsp. ente... 58 1e-06
(A1AAQ4) RecName: Full=Exoribonuclease 2; EC=3.1.13.1; ... 58 1e-06
(B7N4A3) RecName: Full=Exoribonuclease 2; EC=3.1.13.1; ... 58 1e-06
(B7LY47) RecName: Full=Exoribonuclease 2; EC=3.1.13.1; ... 58 1e-06
(A7ZLA9) RecName: Full=Exoribonuclease 2; EC=3.1.13.1; ... 58 1e-06
CR522870_1688(CR522870|pid:none) Desulfotalea psychrophila LSv54... 58 1e-06
AE004437_2036(AE004437|pid:none) Halobacterium sp. NRC-1, comple... 57 3e-06
(Q5PCZ6) RecName: Full=Exoribonuclease 2; EC=3.1.13.1; ... 57 3e-06
CP001600_1736(CP001600|pid:none) Edwardsiella ictaluri 93-146, c... 57 3e-06
(Q57NV9) RecName: Full=Exoribonuclease 2; EC=3.1.13.1; ... 56 4e-06
(A9MWU8) RecName: Full=Exoribonuclease 2; EC=3.1.13.1; ... 56 4e-06
AM933173_1374(AM933173|pid:none) Salmonella enterica subsp. ente... 56 4e-06
>(Q9CSH3) RecName: Full=Exosome complex exonuclease RRP44;
EC=3.1.13.-; AltName: Full=Ribosomal RNA-processing
protein 44; AltName: Full=Protein DIS3 homolog;
Length = 958
Score = 338 bits (868), Expect = 3e-91
Identities = 187/377 (49%), Positives = 242/377 (64%), Gaps = 2/377 (0%)
Frame = +3
Query: 684 HTGEIIAVEYTKSIIRSCASLTYEQAQIRIDDKSQNDQITVNLRNLNSLAKILRKQRFDR 863
H EI+ +TKS+I S ASLTY +AQ+RID + ND IT +LR LN LAKIL+K R ++
Sbjct: 568 HNAEILKTRFTKSVINSKASLTYAEAQMRIDSAAMNDDITTSLRGLNQLAKILKKGRIEK 627
Query: 864 GALYLASPQVKFKTEELGGDPSDVEIYQLRETNSMIEEFMLLANIWVAKKIYKHFPGCAM 1043
GAL L+SP+++F + DP D++ +LRETNSM+EEFMLLANI VAKKI++ F A+
Sbjct: 628 GALTLSSPEIRFHMDSETHDPIDLQTKELRETNSMVEEFMLLANISVAKKIHEEFSEHAL 687
Query: 1044 LRRHPTPNKAAFDLLTKLIENKGYKFSTTTSKDLADSLDSAVDKNDSYFNTLCRIMTTRC 1223
LR+HP P + +D+L K ++K + T T+K LADSLD A + Y NTL RI+ TRC
Sbjct: 688 LRKHPAPPPSNYDILVKAAKSKNLQIKTDTAKSLADSLDRAESPDFPYLNTLLRILATRC 747
Query: 1224 MSPAKYFSSGSLPYEDFNHYGLATDIYTHFTSPIRRYPDIIVHRLLASAIGIQSVSLNLE 1403
M A YF SG DF+HYGLA+ IYTHFTSPIRRY DIIVHRLLA AIG L
Sbjct: 748 MMQAVYFCSGM--DNDFHHYGLASPIYTHFTSPIRRYADIIVHRLLAVAIGADCTYPELT 805
Query: 1404 NK-TISALTENNNFRHKMAQYASRGSTQLHTLIFFKGRKSV-EDAYIIRVKANAFVVLVP 1577
+K +S + +N NFRHKMAQYA R S HT +FFK + V E+AYI+ V+ NA VVL+P
Sbjct: 806 DKHKLSDICKNLNFRHKMAQYAQRASVAFHTQLFFKSKGIVSEEAYILFVRKNAIVVLIP 865
Query: 1578 RYGFEGTVYVSDPXXXXXXXXXXXXXXXIYNYNHEDQTLGNGIHTFRVFDKVTVEIYVDD 1757
+YG EGTV+ + Y+ E +L F VFDKV V+I +D
Sbjct: 866 KYGLEGTVFFEEKDKPKPRLA----------YDDEIPSLRIEGTVFHVFDKVKVKITLDS 915
Query: 1758 SKAHDQKLKINCINPNI 1808
S QK+++ + P I
Sbjct: 916 SNLQHQKIRMALVEPQI 932
Score = 156 bits (395), Expect = 2e-36
Identities = 85/211 (40%), Positives = 124/211 (58%), Gaps = 11/211 (5%)
Frame = +3
Query: 66 MQSNKCFYKATKKGTIIKVVNEIYLRDDIPCGHDSCKEC-------KIKLERRTTVEDRA 224
M +K F K T+ G ++K+V E YLRDDI CG +C C ++L+ R
Sbjct: 1 MLRSKTFLKKTRAGGVVKIVREHYLRDDIGCGAPACSACGGAHAGPALELQPRDQASSLC 60
Query: 225 LLSNEINTIDSDKILILDTNVILHQIDLLEDPTIKNCIILSTVLDEVKSQNRAIFNRIRD 404
+ L+ DTNV+LHQID+LE P I+N I+L TV+ EV++++ I+ RIRD
Sbjct: 61 PWPH---------YLLPDTNVLLHQIDVLEHPAIRNVIVLQTVMQEVRNRSAPIYKRIRD 111
Query: 405 VIKESSRKFYVYSNEYSTFTSITRENGESPNDRNDRAIRVATQWYKSHLHKYS----IKV 572
V + FY ++NE+ T I +E GE+ NDRNDRAIRVA +WY HL + + ++V
Sbjct: 112 VTNNQEKHFYTFTNEHHKETYIEQEQGENANDRNDRAIRVAAKWYNEHLKRVAADSQLQV 171
Query: 573 LLITNDKDNLKKAKSLGLDCQTIQDLVFELS 665
+LITND+ N +KA G+ T ++ V L+
Sbjct: 172 ILITNDRKNKEKAVQEGIPAFTCEEYVKSLT 202
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3204285
Number of Hits to DB: 2,570,596,649
Number of extensions: 46808692
Number of successful extensions: 119453
Number of sequences better than 10.0: 620
Number of HSP's gapped: 118413
Number of HSP's successfully gapped: 677
Length of query: 677
Length of database: 1,040,966,779
Length adjustment: 135
Effective length of query: 542
Effective length of database: 608,388,304
Effective search space: 329746460768
Effective search space used: 329746460768
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 32 (16.9 bits)
|
| PSORT |
|
| VS (DIR, S) |
0 |
| VH (FL, L) |
4 |
| VF (FL, S) |
0 |
| AH (FL, L) |
4 |
| AF (FL, S) |
0 |
| SL (DIR, L) |
0 |
| SS (DIR, S) |
0 |
| SH (FL, L) |
1 |
| SF (FL, S) |
0 |
| CH (FL, L) |
1 |
| CF (FL, S) |
0 |
| FCL (DIR, L) |
0 |
| FC (DIR, S) |
0 |
| FC-IC (SUB) |
0 |