| Contig-U11030-1 |
| Contig ID |
Contig-U11030-1 |
| Contig update |
2002.12.18 |
| Contig sequence |
 |
| Gap |
gap included |
| Contig length |
1207 |
| Chromosome number (1..6, M) |
6 |
| Chromosome length |
3595308 |
| Start point |
3003844 |
| End point |
3005057 |
| Strand (PLUS/MINUS) |
PLUS |
| Number of clones |
3 |
| Number of EST |
4 |
| Link to clone list |
U11030 |
| List of clone(s) |
|
| Translated Amino Acid sequence |
|
| Translated Amino Acid sequence (All Frames) |
|
| own update |
2004. 6.10 |
| Homology vs CSM-cDNA |
|
| dna update |
2008.11.22 |
| Homology vs DNA |
Query= Contig-U11030-1 (Contig-U11030-1Q) /CSM_Contig/Contig-U11030-1Q.Seq.d
(1217 letters)
Database: ddbj_A
92,845,959 sequences; 95,242,211,685 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value N
(BJ343274) Dictyostelium discoideum cDNA clone:dda22f15, 3' ... 1197 0.0 1
(BJ330430) Dictyostelium discoideum cDNA clone:dda31d14, 5' ... 720 0.0 1
(BJ417953) Dictyostelium discoideum cDNA clone:ddv31l05, 5' ... 712 0.0 1
(BJ328000) Dictyostelium discoideum cDNA clone:dda22f15, 5' ... 702 0.0 1
(BE604008) GS365-T7 GS Lambda-Triplex, 10 day germinating sp... 68 4e-15 3
(AR549917) Sequence 5048 from patent US 6747137. 44 3e-07 3
(ES566745) TPAF-aaa36e08.g1 T.spiralis_EST Trichinella spira... 54 2e-05 2
(DV998368) GQ02749.B3_G08 GQ099: Mixed spruce tissues Picea ... 54 0.013 1
(DV977667) GQ00611.B3_L13 GQ006: Cambium and phloem from mat... 54 0.013 1
(DV975745) GQ00611.TB_L13 GQ006: Cambium and phloem from mat... 54 0.013 1
(FK136381) XABT171675.b1 Gateway compatible cien cDNA librar... 36 0.095 3
(AC189077) Zea mays chromosome 9 clone CH201-11M20; ZMMBBc00... 36 0.12 2
(AC148291) Medicago truncatula clone mth2-14n3, complete seq... 36 0.12 2
(AC148481) Medicago truncatula clone mth2-36d21, complete se... 36 0.12 2
(CT027573) Zebrafish DNA sequence from clone DKEY-177O9 in l... 50 0.20 1
(BX284693) Zebrafish DNA sequence from clone DKEY-179M13 in ... 50 0.20 1
(AL986746) Danio rerio genomic clone DKEY-37G20, genomic sur... 50 0.20 1
(BX215759) Danio rerio genomic clone DKEY-256B21, genomic su... 50 0.20 1
(BX197725) Danio rerio genomic clone DKEY-217F15, genomic su... 50 0.20 1
(AX287094) Sequence 4 from Patent WO0181602. 42 0.26 3
(AR890692) Sequence 4 from patent US 7060480. 42 0.26 3
(AR430204) Sequence 4 from patent US 6646182. 42 0.26 3
(AX287091) Sequence 1 from Patent WO0181602. 42 0.32 3
(AR890690) Sequence 1 from patent US 7060480. 42 0.32 3
(AR430202) Sequence 1 from patent US 6646182. 42 0.32 3
(DX572351) MTP_W22_0048 Maize TILLING Project Target Sequenc... 42 0.40 2
(U80927) Dictyostelium discoideum unknown protein gene, comp... 38 0.62 2
(AL807825) Mouse DNA sequence from clone RP23-453B22 on chro... 48 0.79 1
(CU468428) Pig DNA sequence *** SEQUENCING IN PROGRESS *** f... 48 0.79 1
(EF584428) Zea mays Mre11A gene, complete cds. 42 1.2 3
(DX572309) MTP_B73_0048 Maize TILLING Project Target Sequenc... 42 1.5 2
(AK115018) Ciona intestinalis cDNA, clone:cieg027d20, full i... 36 1.6 3
(CQ929198) Sequence 4231 from Patent WO2004083403. 30 1.6 3
(Z68216) Caenorhabditis elegans Cosmid F27C8. 44 1.8 2
(BV250798) S234P6101RD11.T0 EnglishShepherd Canis familiaris... 36 2.1 2
(FK131367) XABT168717.b1 Gateway compatible cien cDNA librar... 40 2.3 2
(FC760810) CBBN12295.fwd CBBN Lottia gigantea 3,4,5,6.5d Lar... 40 2.3 2
(AC069424) Homo sapiens chromosome 3 clone RP11-328P11, *** ... 36 2.5 5
(CJ745457) Ipomoea nil cDNA clone:jmsf31n01, 5' end. 36 2.6 2
(EK018150) 1092955254507 Global-Ocean-Sampling_GS-31-01-01-1... 42 2.6 2
(BJ339947) Dictyostelium discoideum cDNA clone:dda11f04, 3' ... 40 2.6 2
(FK061521) XABT124781.b1 Gateway compatible cien cDNA librar... 40 2.7 2
(FF775353) XABT76119.fwd Gateway compatible cien cDNA librar... 40 2.7 2
(FF690866) XABT103520.fwd Gateway compatible cien cDNA libra... 40 2.7 2
(BJ345511) Dictyostelium discoideum cDNA clone:dda23m22, 3' ... 40 2.7 2
(FF766735) XABT70515.fwd Gateway compatible cien cDNA librar... 40 2.9 2
(CU469584) Zebrafish DNA sequence from clone CH211-183D21 in... 46 3.1 1
(AM482397) Vitis vinifera contig VV78X161856.5, whole genome... 46 3.1 1
(AM424680) Vitis vinifera contig VV78X024421.12, whole genom... 46 3.1 1
(AC137522) Medicago truncatula clone mth2-9h8, complete sequ... 46 3.1 1
(AC162732) Loxodonta africana clone VMRC15-180G16, WORKING D... 46 3.1 1
(CU550665) Pig DNA sequence *** SEQUENCING IN PROGRESS *** f... 46 3.1 1
(AZ706239) RPCI-23-229B9.TV RPCI-23 Mus musculus genomic clo... 46 3.1 1
(FI133789) CsB10STC_03L21R_857 ends of BAC library of B10 li... 46 3.1 1
(EK104804) 1092963042530 Global-Ocean-Sampling_GS-31-01-01-1... 46 3.1 1
(EK100875) 1092963017011 Global-Ocean-Sampling_GS-31-01-01-1... 46 3.1 1
(CR332749) mte1-62G20RM1 BAC end, cultivar Jemalong A17 of M... 46 3.1 1
(CL861801) OR_CBa0093N19.f OR_CBa Oryza rufipogon genomic cl... 46 3.1 1
(ES938805) 46RDOAG_UP_067_G12_01FEB2006_084 Brassica olerace... 46 3.1 1
(ES904555) BNARO4GH_T3_020_D07_24NOV2006_057 Brassica napus ... 46 3.1 1
(EB035453) lk_hhL2_0003k17.pDNRF2 lk_hhL2 Hippoglossus hippo... 46 3.1 1
(BI958985) HVSMEn0017I22f Hordeum vulgare rachis EST library... 46 3.1 1
(FG572348) BN24DYSC_UP_018_E05_1FEB2008_039 BN24DYSC Brassic... 46 3.1 1
(FD405474) 1106514460131 Cryptosporidium muris (strain RN66)... 46 3.1 1
(FD399483) 1106514295934 Cryptosporidium muris (strain RN66)... 46 3.1 1
(FD397175) 1106514223798 Cryptosporidium muris (strain RN66)... 46 3.1 1
(FD395302) 1106162311135 Cryptosporidium muris (strain RN66)... 46 3.1 1
(AM456451) Vitis vinifera contig VV78X126553.12, whole genom... 42 4.2 3
(AB055424) Dictyostelium discoideum mRNA for DdAPN, complete... 40 6.0 2
(CZ017567) CH240_502J24.TV CHORI-240 Bos taurus genomic clon... 38 7.8 2
(CD162737) ML1-0081T-M263-F05-U.G ML1-0081 Schistosoma manso... 34 8.2 3
(AI976508) EST271102 Schistosoma mansoni female, Phil LoVerd... 34 8.8 3
(AF178433) Coprinus cinereus DNA repair and meiosis protein ... 36 8.9 3
>(BJ343274) Dictyostelium discoideum cDNA clone:dda22f15, 3' end,
single read.
Length = 606
Score = 1197 bits (604), Expect = 0.0
Identities = 604/604 (100%)
Strand = Plus / Minus
Query: 614 aatcaaaagatgaatggttcaatattttagtacttcatcaaaatagggtagcccacaatc 673
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 605 aatcaaaagatgaatggttcaatattttagtacttcatcaaaatagggtagcccacaatc 546
Query: 674 caaagaattatgttcacgagaagatgatagaaagtttcatagatttcgttctatggggac 733
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 545 caaagaattatgttcacgagaagatgatagaaagtttcatagatttcgttctatggggac 486
Query: 734 acgaacatgaatgtttagtcaatccacaggcatcgtcagtgggagaattccatatttcac 793
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 485 acgaacatgaatgtttagtcaatccacaggcatcgtcagtgggagaattccatatttcac 426
Query: 794 aacctggttcttcagtagctacagctttatcagagggtgaatcaaaggataaatttgtag 853
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 425 aacctggttcttcagtagctacagctttatcagagggtgaatcaaaggataaatttgtag 366
Query: 854 gattgttggaggtttataaaaatcaattccgttttaaaccattcccattgaacacggtta 913
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 365 gattgttggaggtttataaaaatcaattccgttttaaaccattcccattgaacacggtta 306
Query: 914 gaccattcattatggatcaaatcatacttgcaaatagtaacatacatccaacacaacaga 973
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 305 gaccattcattatggatcaaatcatacttgcaaatagtaacatacatccaacacaacaga 246
Query: 974 atgatgtaattcaatggattgagcaaaaagtagaatcaatgattgaacaagccaaattaa 1033
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 245 atgatgtaattcaatggattgagcaaaaagtagaatcaatgattgaacaagccaaattaa 186
Query: 1034 aatctcaaggtaaacccaacgaatcaatgttaccattgataagattaaaagttgattata 1093
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 185 aatctcaaggtaaacccaacgaatcaatgttaccattgataagattaaaagttgattata 126
Query: 1094 ctggttatagtactatcaatcctcaaaagtttggtcaaagatttcaaggccgtgtagcaa 1153
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 125 ctggttatagtactatcaatcctcaaaagtttggtcaaagatttcaaggccgtgtagcaa 66
Query: 1154 atccaaatgatgttttattattccacagaaagaaaccaaccactttatcaagtaaaaaac 1213
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 65 atccaaatgatgttttattattccacagaaagaaaccaaccactttatcaagtaaaaaac 6
Query: 1214 aaaa 1217
||||
Sbjct: 5 aaaa 2
Lambda K H
1.37 0.711 1.31
Matrix: blastn matrix:1 -3
Number of Sequences: 92845959
Number of Hits to DB: 1,177,593,535
Number of extensions: 71561519
Number of successful extensions: 5229636
Number of sequences better than 10.0: 73
Length of query: 1217
Length of database: 95,242,211,685
Length adjustment: 24
Effective length of query: 1193
Effective length of database: 97,308,875,965
Effective search space: 116089489026245
Effective search space used: 116089489026245
X1: 11 (21.8 bits)
S2: 22 (44.1 bits)
|
| protein update |
2009. 6.29 |
| Homology vs Protein |
Query= Contig-U11030-1 (Contig-U11030-1Q) /CSM_Contig/Contig-U11030-1Q.Seq.d
(1217 letters)
Database: nrp_A
3,204,285 sequences; 1,040,966,779 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
(Q9XGM2) RecName: Full=Double-strand break repair protein MRE11;... 209 2e-52
AM049175_1(AM049175|pid:none) Triticum monococcum mRNA for meiot... 202 1e-50
AM049169_1(AM049169|pid:none) Triticum monococcum mre11 gene for... 202 1e-50
AM049171_1(AM049171|pid:none) Triticum turgidum mre11 gene for m... 201 3e-50
AM049172_1(AM049172|pid:none) Triticum turgidum mre11 gene for m... 201 3e-50
AM049170_1(AM049170|pid:none) Aegilops tauschii mre11 gene for m... 201 3e-50
AM049174_1(AM049174|pid:none) Triticum turgidum mRNA for meiotic... 201 3e-50
AC126013_21(AC126013|pid:none) Medicago truncatula clone mth2-32... 201 4e-50
AL512546_11(AL512546|pid:none) Oryza sativa genomic DNA, chromos... 201 6e-50
BT053847_1(BT053847|pid:none) Zea mays full-length cDNA clone ZM... 200 7e-50
EF584428_1(EF584428|pid:none) Zea mays Mre11A gene, complete cds. 200 7e-50
AC130811_24(AC130811|pid:none) Medicago truncatula clone mth2-26... 190 1e-46
FJ219105_1(FJ219105|pid:none) Drosophila melanogaster strain NC3... 187 6e-46
FJ219089_1(FJ219089|pid:none) Drosophila simulans strain w501 me... 186 1e-45
FJ219091_1(FJ219091|pid:none) Drosophila melanogaster strain MW2... 186 1e-45
FJ219092_1(FJ219092|pid:none) Drosophila melanogaster strain MW2... 186 1e-45
FJ219116_1(FJ219116|pid:none) Drosophila melanogaster strain MW9... 186 1e-45
FJ219107_1(FJ219107|pid:none) Drosophila melanogaster strain MW3... 186 1e-45
FJ219087_1(FJ219087|pid:none) Drosophila simulans strain md106 m... 184 5e-45
FJ219112_1(FJ219112|pid:none) Drosophila melanogaster strain MW6... 184 7e-45
FJ219083_1(FJ219083|pid:none) Drosophila yakuba strain yak meiot... 184 7e-45
FJ219104_1(FJ219104|pid:none) Drosophila melanogaster strain NC3... 184 7e-45
AE014134_2144(AE014134|pid:none) Drosophila melanogaster chromos... 183 9e-45
FJ219101_1(FJ219101|pid:none) Drosophila melanogaster strain NC3... 183 9e-45
FJ219114_1(FJ219114|pid:none) Drosophila melanogaster strain NC7... 183 9e-45
FJ219099_1(FJ219099|pid:none) Drosophila melanogaster strain NC3... 181 4e-44
CP000594_330(CP000594|pid:none) Ostreococcus lucimarinus CCE9901... 179 2e-43
(Q09683) RecName: Full=DNA repair protein rad32; &CU329670_177(... 178 3e-43
CR954207_2(CR954207|pid:none) Ostreococcus tauri strain OTTH0595... 178 4e-43
AX287091_1(AX287091|pid:none) Sequence 1 from Patent WO0181602. 177 5e-43
(Q9JIM0) RecName: Full=Double-strand break repair protein MRE11A... 175 3e-42
BC157691_1(BC157691|pid:none) Xenopus tropicalis hypothetical pr... 172 2e-41
(Q9W6K1) RecName: Full=Double-strand break repair protein MRE11;... 172 2e-41
CU633898_66(CU633898|pid:none) Podospora anserina genomic DNA ch... 172 3e-41
AK041248_1(AK041248|pid:none) Mus musculus adult male aorta and ... 170 8e-41
(Q60HE6) RecName: Full=Double-strand break repair protein MRE11A... 168 3e-40
(P49959) RecName: Full=Double-strand break repair protein MRE11A... 168 4e-40
BC017823_1(BC017823|pid:none) Homo sapiens MRE11 meiotic recombi... 168 4e-40
U37359_1(U37359|pid:none) Homo sapiens MRE11 homologue hMre11 mR... 168 4e-40
AP007157_421(AP007157|pid:none) Aspergillus oryzae RIB40 genomic... 167 9e-40
AP003878_8(AP003878|pid:none) Oryza sativa Japonica Group genomi... 166 2e-39
BT007965_1(BT007965|pid:none) Synthetic construct Homo sapiens M... 165 3e-39
AM920436_2205(AM920436|pid:none) Penicillium chrysogenum Wiscons... 165 3e-39
CT030247_1(CT030247|pid:none) Mouse DNA sequence from clone RP23... 163 1e-38
CT030247_5(CT030247|pid:none) Mouse DNA sequence from clone RP23... 163 1e-38
(Q9C291) RecName: Full=Double-strand break repair protein mus-23... 162 2e-38
AL513409_5(AL513409|pid:none) Neurospora crassa DNA linkage grou... 162 2e-38
EF599099_1(EF599099|pid:none) Zea mays MRE11B (Mre11B) mRNA, com... 161 5e-38
AK146234_1(AK146234|pid:none) Mus musculus CRL-1722 L5178Y-R cDN... 160 8e-38
CR382138_692(CR382138|pid:none) Debaryomyces hansenii strain CBS... 160 1e-37
AB091331_1(AB091331|pid:none) Magnaporthe grisea mhm11 gene for ... 159 2e-37
FN392321_869(FN392321|pid:none) Pichia pastoris GS115 chromosome... 159 2e-37
AB038379_1(AB038379|pid:none) Bombyx mori mRNA for Mre11, comple... 158 3e-37
FN357512_11(FN357512|pid:none) Schistosoma mansoni genome sequen... 157 5e-37
AE016819_786(AE016819|pid:none) Ashbya gossypii (= Eremothecium ... 157 5e-37
CR382128_567(CR382128|pid:none) Yarrowia lipolytica strain CLIB1... 157 9e-37
AM502245_157(AM502245|pid:none) Leishmania infantum chromosome 27. 146 1e-33
(P32829) RecName: Full=Double-strand break repair protein MRE11;... 146 2e-33
U60829_1(U60829|pid:none) Saccharomyces cerevisiae Mre11p (MRE11... 146 2e-33
CU928173_245(CU928173|pid:none) Zygosaccharomyces rouxii strain ... 145 4e-33
AM494964_203(AM494964|pid:none) Leishmania braziliensis chromoso... 144 5e-33
DQ889944_1(DQ889944|pid:none) Saccharomyces pastorianus strain 9... 144 8e-33
CR380959_487(CR380959|pid:none) Candida glabrata strain CBS138 c... 142 2e-32
AJ426461_1(AJ426461|pid:none) Trypanosoma brucei Mre11 gene. 142 2e-32
AC007865_53(AC007865|pid:none) Trypanosoma brucei chromosome 2 c... 142 3e-32
(Q23255) RecName: Full=Double-strand break repair protein mre-11... 139 3e-31
AL590445_131(AL590445|pid:none) chromosome V of strain GB-M1 of ... 130 9e-29
DQ863295_1(DQ863295|pid:none) Penicillium marneffei MRE11-like p... 127 6e-28
AL031745_69(AL031745|pid:none) Plasmodium falciparum DNA from MA... 101 6e-20
AM910984_55(AM910984|pid:none) Plasmodium knowlesi strain H chro... 100 8e-20
CT030247_4(CT030247|pid:none) Mouse DNA sequence from clone RP23... 96 2e-18
AM180088_720(AM180088|pid:none) Haloquadratum walsbyi DSM 16790 ... 52 3e-05
CP001229_2(CP001229|pid:none) Sulfurihydrogenibium azorense Az-F... 50 1e-04
(Q8TRL2) RecName: Full=DNA double-strand break repair protein mr... 49 3e-04
CP000099_349(CP000099|pid:none) Methanosarcina barkeri str. Fusa... 48 8e-04
CP000743_702(CP000743|pid:none) Methanococcus aeolicus Nankai-3,... 47 0.002
CR936257_756(CR936257|pid:none) Natronomonas pharaonis DSM 2160 ... 45 0.005
(Q8U1N9) RecName: Full=DNA double-strand break repair protein mr... 45 0.005
CP000855_1428(CP000855|pid:none) Thermococcus onnurineus NA1, co... 45 0.005
(Q58719) RecName: Full=DNA double-strand break repair protein mr... 45 0.007
CP000742_642(CP000742|pid:none) Methanococcus vannielii SB, comp... 45 0.007
AE009950_1166(AE009950|pid:none) Pyrococcus furiosus DSM 3638, c... 44 0.009
(P62130) RecName: Full=DNA double-strand break repair protein mr... 44 0.009
CP000609_237(CP000609|pid:none) Methanococcus maripaludis C5, co... 44 0.009
AY596297_1641(AY596297|pid:none) Haloarcula marismortui ATCC 430... 44 0.012
CP000745_580(CP000745|pid:none) Methanococcus maripaludis C7, co... 43 0.026
CP000300_1385(CP000300|pid:none) Methanococcoides burtonii DSM 6... 42 0.034
(O58686) RecName: Full=DNA double-strand break repair protein mr... 42 0.044
CP000504_295(CP000504|pid:none) Pyrobaculum islandicum DSM 4184,... 40 0.17
AP009389_1666(AP009389|pid:none) Pelotomaculum thermopropionicum... 40 0.22
CP000828_3130(CP000828|pid:none) Acaryochloris marina MBIC11017,... 40 0.22
CP001184_30(CP001184|pid:none) Ureaplasma urealyticum serovar 10... 40 0.22
CP001014_1779(CP001014|pid:none) Thermoproteus neutrophilus V24S... 39 0.28
(Q9UZC9) RecName: Full=DNA double-strand break repair protein mr... 39 0.28
AE000513_1881(AE000513|pid:none) Deinococcus radiodurans R1 chro... 39 0.37
AF485826_1(AF485826|pid:none) Giardia intestinalis Mre11 gene, c... 39 0.37
AP007281_986(AP007281|pid:none) Lactobacillus reuteri JCM 1112 D... 38 0.63
CP001185_925(CP001185|pid:none) Thermosipho africanus TCF52B, co... 38 0.83
CP000866_1208(CP000866|pid:none) Nitrosopumilus maritimus SCM1, ... 37 1.1
CP001251_1557(CP001251|pid:none) Dictyoglomus turgidum DSM 6724,... 37 1.1
CP001131_1561(CP001131|pid:none) Anaeromyxobacter sp. K, complet... 37 1.1
CP001098_398(CP001098|pid:none) Halothermothrix orenii H 168, co... 37 1.4
CP001359_1635(CP001359|pid:none) Anaeromyxobacter dehalogenans 2... 37 1.4
CP000678_121(CP000678|pid:none) Methanobrevibacter smithii ATCC ... 37 1.8
CP000110_1735(CP000110|pid:none) Synechococcus sp. CC9605, compl... 37 1.8
CP000423_657(CP000423|pid:none) Lactobacillus casei ATCC 334, co... 36 2.4
(O26641) RecName: Full=DNA double-strand break repair protein mr... 36 2.4
CP001404_63(CP001404|pid:none) Sulfolobus islandicus Y.N.15.51, ... 36 3.1
CP001366_350(CP001366|pid:none) Halorubrum lacusprofundi ATCC 49... 36 3.1
CP000240_1917(CP000240|pid:none) Synechococcus sp. JA-2-3B'a(2-1... 36 3.1
(Q9PRB5) RecName: Full=Uncharacterized protein UU030; &AE002102... 35 4.1
AE009951_1099(AE009951|pid:none) Fusobacterium nucleatum subsp. ... 35 4.1
CP000569_1912(CP000569|pid:none) Actinobacillus pleuropneumoniae... 35 4.1
CP000100_1250(CP000100|pid:none) Synechococcus elongatus PCC 794... 35 4.1
AM114193_395(AM114193|pid:none) Uncultured methanogenic archaeon... 35 4.1
CP000854_3543(CP000854|pid:none) Mycobacterium marinum M, comple... 35 5.4
AE015929_1425(AE015929|pid:none) Staphylococcus epidermidis ATCC... 35 5.4
AE001437_2696(AE001437|pid:none) Clostridium acetobutylicum ATCC... 35 5.4
AP008971_701(AP008971|pid:none) Finegoldia magna ATCC 29328 DNA,... 35 5.4
(Q97C75) RecName: Full=DNA double-strand break repair protein mr... 35 5.4
CP000687_1930(CP000687|pid:none) Actinobacillus pleuropneumoniae... 35 5.4
AP008232_269(AP008232|pid:none) Sodalis glossinidius str. 'morsi... 35 5.4
AE000512_1608(AE000512|pid:none) Thermotoga maritima MSB8, compl... 35 5.4
CP000939_499(CP000939|pid:none) Clostridium botulinum B1 str. Ok... 35 5.4
CP000969_1281(CP000969|pid:none) Thermotoga sp. RQ2, complete ge... 35 7.0
AY760067_1(AY760067|pid:none) Muntiacus muntjak vaginalis meioti... 35 7.0
CP000142_1484(CP000142|pid:none) Pelobacter carbinolicus DSM 238... 35 7.0
CP000702_1141(CP000702|pid:none) Thermotoga petrophila RKU-1, co... 35 7.0
AL935256_152(AL935256|pid:none) Lactobacillus plantarum strain W... 34 9.1
CR954247_54(CR954247|pid:none) Pseudoalteromonas haloplanktis st... 34 9.1
>(Q9XGM2) RecName: Full=Double-strand break repair protein MRE11;
&AB010695_8(AB010695|pid:none)
&AJ243822_1(AJ243822|pid:none) &T52564(T52564)
Length = 720
Score = 209 bits (531), Expect = 2e-52
Identities = 99/187 (52%), Positives = 140/187 (74%), Gaps = 1/187 (0%)
Frame = +1
Query: 625 EWFNILVLHQNRVAHNPKNYVHEKMIESFIDFVLWGHEHECLVNPQASSVGEFHISQPGS 804
+WFNILVLHQNRV NPKN + E + F+DF++WGHEHECL++PQ S FHI+QPGS
Sbjct: 214 DWFNILVLHQNRVKSNPKNAISEHFLPRFLDFIVWGHEHECLIDPQEVSGMGFHITQPGS 273
Query: 805 SVATALSEGESKDKFVGLLEVYKNQFRFKPFPLNTVRPFIMDQIILAN-SNIHPTQQNDV 981
SVAT+L +GESK K V LLE+ NQ+R PL +VRPF +I+L + S+I P QN +
Sbjct: 274 SVATSLIDGESKPKHVLLLEIKGNQYRPTKIPLTSVRPFEYTEIVLKDESDIDPNDQNSI 333
Query: 982 IQWIEQKVESMIEQAKLKSQGKPNESMLPLIRLKVDYTGYSTINPQKFGQRFQGRVANPN 1161
++ +++ V ++IE+A K+ + +E LPL+R+KVDY+G+ TINPQ+FGQ++ G+VANP
Sbjct: 334 LEHLDKVVRNLIEKASKKAVNR-SEIKLPLVRIKVDYSGFMTINPQRFGQKYVGKVANPQ 392
Query: 1162 DVLLFHR 1182
D+L+F +
Sbjct: 393 DILIFSK 399
Score = 166 bits (420), Expect = 2e-39
Identities = 74/119 (62%), Positives = 94/119 (78%)
Frame = +3
Query: 243 MRILVATDNHLGYLERDPIRGDDSFNSFEEILKYAHTLKVDMVLLGGDLFHDNKPSRSCL 422
+R+LVATD HLGY+E+D IR DSF +FEEI A +VD +LLGGDLFH+NKPSR+ L
Sbjct: 10 LRVLVATDCHLGYMEKDEIRRHDSFKAFEEICSIAEEKQVDFLLLGGDLFHENKPSRTTL 69
Query: 423 YRTMELFRKYCLGDSPVRIQFLSDQSVNFSNQFHTVNYEDPNFNISLPIFSIHGNHDDP 599
+ +E+ R++CL D PV+ Q +SDQ+VNF N F VNYEDP+FN+ LP+FSIHGNHDDP
Sbjct: 70 VKAIEILRRHCLNDKPVQFQVVSDQTVNFQNAFGQVNYEDPHFNVGLPVFSIHGNHDDP 128
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3204285
Number of Hits to DB: 1,764,498,805
Number of extensions: 34483280
Number of successful extensions: 82276
Number of sequences better than 10.0: 142
Number of HSP's gapped: 82053
Number of HSP's successfully gapped: 243
Length of query: 405
Length of database: 1,040,966,779
Length adjustment: 131
Effective length of query: 274
Effective length of database: 621,205,444
Effective search space: 170210291656
Effective search space used: 170210291656
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 32 (16.9 bits)
|
| PSORT |
|
| VS (DIR, S) |
0 |
| VH (FL, L) |
1 |
| VF (FL, S) |
0 |
| AH (FL, L) |
1 |
| AF (FL, S) |
1 |
| SL (DIR, L) |
0 |
| SS (DIR, S) |
0 |
| SH (FL, L) |
0 |
| SF (FL, S) |
0 |
| CH (FL, L) |
0 |
| CF (FL, S) |
0 |
| FCL (DIR, L) |
0 |
| FC (DIR, S) |
0 |
| FC-IC (SUB) |
0 |