| Contig-U10820-1 |
| Contig ID |
Contig-U10820-1 |
| Contig update |
2002.12.18 |
| Contig sequence |
 |
| Gap |
gap included |
| Contig length |
1632 |
| Chromosome number (1..6, M) |
1 |
| Chromosome length |
4919822 |
| Start point |
1455141 |
| End point |
1456757 |
| Strand (PLUS/MINUS) |
PLUS |
| Number of clones |
27 |
| Number of EST |
47 |
| Link to clone list |
U10820 |
| List of clone(s) |
est1=VFK677F,1,509
est2=AFI430F,6,610
est3=VFH721F,9,581
est4=VFL468F,12,608
est5=VSF140F,12,589
est6=CFI372F,18,608
est7=CFI886F,23,590
est8=AFN804F,24,674
est9=AFO851F,24,637
est10=SFK578F,24,472
est11=VFE306F,24,437
est12=VFK391F,24,607
est13=VFK491F,24,574
est14=VFL847F,24,595
est15=VFN874F,24,657
est16=VFL182F,27,404
est17=VFI838F,34,590
est18=SLH684F,35,684
est19=VFB233F,38,590
est20=VFG807F,38,591
est21=AFD808F,46,586
est22=VFA572F,47,643
est23=VFI838Z,685,1407
est24=VFL182Z,688,1407
est25=AFO851Z,689,1411
est26=VFB233Z,698,1396
est27=CFI886Z,699,1413
est28=VFA572Z,699,1396
est29=VFH721Z,721,1407
est30=VFK391Z,741,1416
est31=AFD808Z,751,1423
est32=AFK203Z,755,1414
est33=CFI372Z,758,1422
est34=VFN874Z,772,1339
est35=VFE306Z,832,1424
est36=SFK578Z,879,1630
est37=AFN804Z,907,1580
est38=VFL468Z,940,1407
est39=AFI430Z,948,1588
est40=VFL847Z,1024,1609
est41=SLA648Z,1026,1435
est42=VSF140Z,1029,1597
est43=SLH684Z,1045,1610
est44=VSH426E,1053,1637
est45=VSC446E,1169,1618
est46=CHE465Z,1171,1500
est47=VFK677Z,1224,1574
|
| Translated Amino Acid sequence |
|
| Translated Amino Acid sequence (All Frames) |
|
| own update |
2004. 6.10 |
| Homology vs CSM-cDNA |
|
| dna update |
2008.11.22 |
| Homology vs DNA |
Query= Contig-U10820-1 (Contig-U10820-1Q) /CSM_Contig/Contig-U10820-1Q.Seq.d
(1642 letters)
Database: ddbj_A
92,845,959 sequences; 95,242,211,685 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value N
(AU062121) Dictyostelium discoideum slug cDNA, clone SLH684. 1287 0.0 1
(BJ417783) Dictyostelium discoideum cDNA clone:ddv28d20, 5' ... 1249 0.0 1
(BJ329042) Dictyostelium discoideum cDNA clone:dda30f14, 5' ... 1209 0.0 1
(BJ411019) Dictyostelium discoideum cDNA clone:ddv2o17, 5' e... 1183 0.0 1
(BJ326643) Dictyostelium discoideum cDNA clone:dda17l08, 5' ... 1166 0.0 2
(BJ415209) Dictyostelium discoideum cDNA clone:ddv21f23, 5' ... 1158 0.0 1
(BJ361562) Dictyostelium discoideum cDNA clone:ddc17p17, 5' ... 1156 0.0 1
(BJ328415) Dictyostelium discoideum cDNA clone:dda28h02, 5' ... 1156 0.0 2
(BJ415748) Dictyostelium discoideum cDNA clone:ddv23h18, 5' ... 1150 0.0 2
(BJ329637) Dictyostelium discoideum cDNA clone:dda25b20, 5' ... 1130 0.0 1
(BJ415985) Dictyostelium discoideum cDNA clone:ddv24n12, 5' ... 1128 0.0 1
(BJ361821) Dictyostelium discoideum cDNA clone:ddc18l22, 5' ... 1126 0.0 1
(BJ330245) Dictyostelium discoideum cDNA clone:dda27i24, 5' ... 1124 0.0 1
(BJ414207) Dictyostelium discoideum cDNA clone:ddv18l10, 5' ... 1104 0.0 1
(AU264767) Dictyostelium discoideum vegetative cDNA clone:VS... 1092 0.0 1
(BJ413101) Dictyostelium discoideum cDNA clone:ddv14n02, 5' ... 1090 0.0 1
(BJ411160) Dictyostelium discoideum cDNA clone:ddv3a10, 5' e... 1090 0.0 1
(BJ415210) Dictyostelium discoideum cDNA clone:ddv21f24, 5' ... 1086 0.0 1
(BJ324821) Dictyostelium discoideum cDNA clone:dda8p02, 5' e... 1049 0.0 1
(BJ413535) Dictyostelium discoideum cDNA clone:ddv16j05, 5' ... 872 0.0 4
(BJ401324) Dictyostelium discoideum cDNA clone:dds22k19, 3' ... 769 0.0 3
(BJ375177) Dictyostelium discoideum cDNA clone:ddc17p17, 3' ... 728 0.0 2
(BJ346981) Dictyostelium discoideum cDNA clone:dda25b20, 3' ... 728 0.0 2
(BJ432337) Dictyostelium discoideum cDNA clone:ddv18l10, 3' ... 720 0.0 3
(BJ434054) Dictyostelium discoideum cDNA clone:ddv23c21, 3' ... 714 0.0 2
(BJ346317) Dictyostelium discoideum cDNA clone:dda30f14, 3' ... 712 0.0 3
(BJ434182) Dictyostelium discoideum cDNA clone:ddv16j05, 3' ... 710 0.0 3
(BJ430885) Dictyostelium discoideum cDNA clone:ddv9l01, 3' e... 710 0.0 2
(BJ375491) Dictyostelium discoideum cDNA clone:ddc18l22, 3' ... 710 0.0 2
(BJ347690) Dictyostelium discoideum cDNA clone:dda27i24, 3' ... 710 0.0 2
(BJ429361) Dictyostelium discoideum cDNA clone:ddv3a10, 3' e... 694 0.0 4
(BJ429208) Dictyostelium discoideum cDNA clone:ddv2o17, 3' e... 692 0.0 3
(BJ433423) Dictyostelium discoideum cDNA clone:ddv21f23, 3' ... 609 0.0 5
(BJ341797) Dictyostelium discoideum cDNA clone:dda8p02, 3' e... 589 0.0 5
(BJ435877) Dictyostelium discoideum cDNA clone:ddv28d20, 3' ... 575 0.0 2
(BJ344937) Dictyostelium discoideum cDNA clone:dda21e02, 3' ... 573 0.0 4
(BJ345564) Dictyostelium discoideum cDNA clone:dda28h02, 3' ... 769 0.0 3
(BJ343851) Dictyostelium discoideum cDNA clone:dda17l08, 3' ... 769 0.0 3
(BJ415523) Dictyostelium discoideum cDNA clone:ddv22i20, 5' ... 959 0.0 1
(BJ434004) Dictyostelium discoideum cDNA clone:ddv23h18, 3' ... 710 0.0 2
(BJ390563) Dictyostelium discoideum cDNA clone:dds22k19, 5' ... 890 0.0 1
(BJ434616) Dictyostelium discoideum cDNA clone:ddv24n12, 3' ... 769 0.0 3
(BJ412593) Dictyostelium discoideum cDNA clone:ddv9l01, 5' e... 815 0.0 1
(AU264768) Dictyostelium discoideum vegetative cDNA clone:VS... 791 0.0 2
(AU039386) Dictyostelium discoideum slug cDNA, clone SLH684. 769 0.0 2
(AU033349) Dictyostelium discoideum slug cDNA, clone SLA648. 765 0.0 2
(AU267429) Dictyostelium discoideum vegetative cDNA clone:VS... 726 0.0 1
(BJ415793) Dictyostelium discoideum cDNA clone:ddv23c21, 5' ... 692 0.0 1
(AU262570) Dictyostelium discoideum vegetative cDNA clone:VS... 523 e-150 2
(AU267430) Dictyostelium discoideum vegetative cDNA clone:VS... 420 e-118 2
(BJ376904) Dictyostelium discoideum cDNA clone:ddc30b18, 3' ... 353 e-116 3
(BJ433759) Dictyostelium discoideum cDNA clone:ddv22i20, 3' ... 363 e-103 2
(AR547788) Sequence 2919 from patent US 6747137. 50 2e-14 3
(FF104057) CPAD-aac89h07.b1 PB2801_EST_CPAD1 Caenorhabditis ... 56 8e-14 3
(EB810397) 3501_F12 Botrytis cinerea expressed sequence tags... 90 3e-13 1
(AU211232) Caenorhabditis elegans cDNA clone:yk770a05 : 3' e... 50 3e-12 4
(AU218752) Caenorhabditis elegans cDNA clone:yk868f09 : 3' e... 50 3e-12 4
(BJ794426) Caenorhabditis elegans cDNA clone:yk1699h08 : 3' ... 50 3e-12 4
(BJ132006) Caenorhabditis elegans cDNA clone:yk1061b05 : 3' ... 50 3e-12 4
(BJ786544) Caenorhabditis elegans cDNA clone:yk1583d08 : 3' ... 50 3e-12 4
(BJ782083) Caenorhabditis elegans cDNA clone:yk1506g06 : 3' ... 50 3e-12 4
(BJ799216) Caenorhabditis elegans cDNA clone:yk1755g02 : 3' ... 50 3e-12 4
(BJ780938) Caenorhabditis elegans cDNA clone:yk1493d02 : 3' ... 50 4e-12 4
(BJ786126) Caenorhabditis elegans cDNA clone:yk1578e10 : 3' ... 50 4e-12 4
(BJ104546) Caenorhabditis elegans cDNA clone:yk1062h11 : 5' ... 50 2e-11 4
(EC030430) 6372057 KZ41 Caenorhabditis elegans cDNA clone 17... 50 8e-11 3
(DY526583) BAAC-PNP1311E18.g1 C.remanei EST SB146 Caenorhabd... 66 9e-10 3
(BJ132169) Caenorhabditis elegans cDNA clone:yk1062h11 : 3' ... 50 1e-09 3
(DY893715) CeleSEQ13134 Cunninghamella elegans pBluescript (... 48 1e-09 3
(AM812359) Nicotiana tabacum EST, clone nt005033010. 48 6e-09 3
(BJ150373) Caenorhabditis elegans cDNA clone:yk1098g11 : 3' ... 50 1e-08 3
(BJ792619) Caenorhabditis elegans cDNA clone:yk1666g12 : 3' ... 50 1e-08 3
(EA387414) Sequence 36238 from patent US 7314974. 50 2e-08 4
(CP000499) Pichia stipitis CBS 6054 chromosome 5, complete s... 74 2e-08 1
(DY527443) BAAC-PNP1299K06.g2 C.remanei EST SB146 Caenorhabd... 66 5e-08 2
(DR779079) BAAC-PNP1258M03.g1 C.remanei EST SB146 Caenorhabd... 66 5e-08 2
(X15647) Aspergillus nidulans gatA gene for gamma-amino-n-bu... 50 6e-08 4
(CZ287751) cp54d04.r Candida parapsilosis Random Genomic Lib... 72 7e-08 1
(CZ285291) cp40d06.f Candida parapsilosis Random Genomic Lib... 72 7e-08 1
(DY891460) CeleSEQ10159 Cunninghamella elegans pBluescript (... 48 8e-08 3
(Z69664) Caenorhabditis elegans Cosmid K04D7. 50 1e-07 5
(CR382138) Debaryomyces hansenii chromosome F of strain CBS7... 46 3e-07 2
(AR547789) Sequence 2920 from patent US 6747137. 70 3e-07 1
(DJ130334) Method for identification of useful proteins deri... 56 1e-06 2
(CR382135) Debaryomyces hansenii chromosome C of strain CBS7... 54 4e-06 2
(AM679855) Entamoeba terrapinae GSS, clone terra173d12.q1k. 54 5e-06 2
(AU210770) Caenorhabditis elegans cDNA clone:yk764d01 : 3' e... 50 5e-06 3
(CB403815) OSTR013A10_1 AD-wrmcDNA Caenorhabditis elegans cD... 50 6e-06 3
(BJ778291) Caenorhabditis elegans cDNA clone:yk1398e01 : 3' ... 50 7e-06 3
(BJ138572) Caenorhabditis elegans cDNA clone:yk1137a04 : 3' ... 50 7e-06 3
(BJ811056) Caenorhabditis elegans cDNA clone:yk1451e12 : 3' ... 50 7e-06 3
(EC000187) 7613980 CE04 Caenorhabditis elegans cDNA clone 27... 50 8e-06 3
(BJ788511) Caenorhabditis elegans cDNA clone:yk1607c10 : 3' ... 50 8e-06 3
(BJ798945) Caenorhabditis elegans cDNA clone:yk1752e09 : 3' ... 50 9e-06 3
(BJ782166) Caenorhabditis elegans cDNA clone:yk1507g03 : 3' ... 50 9e-06 3
(BJ151134) Caenorhabditis elegans cDNA clone:yk1292a08 : 3' ... 50 9e-06 3
(DY895477) CeleSEQ15318 Cunninghamella elegans pBluescript (... 48 1e-05 3
(FD673985) CBHU3107.fwd CBHU Mycosphaerella fijiensis MfEST3... 54 2e-05 2
(FD673984) CBHU3107.rev CBHU Mycosphaerella fijiensis MfEST3... 54 2e-05 2
(FD672075) CBHU2044.rev CBHU Mycosphaerella fijiensis MfEST3... 54 2e-05 2
>(AU062121) Dictyostelium discoideum slug cDNA, clone SLH684.
Length = 650
Score = 1287 bits (649), Expect = 0.0
Identities = 649/649 (100%)
Strand = Plus / Plus
Query: 35 attaaaacaaacaatgtcttcatcaagattaattaaatgtttaagttcaaacaattatat 94
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1 attaaaacaaacaatgtcttcatcaagattaattaaatgtttaagttcaaacaattatat 60
Query: 95 tgttagatctttctcaaaatcatcaattccaaccacaccaacaccagattttccaggtga 154
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 61 tgttagatctttctcaaaatcatcaattccaaccacaccaacaccagattttccaggtga 120
Query: 155 atataaagaaccaattgtaaagacacaaatcccaggtccacaatctaaagctttaattga 214
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 121 atataaagaaccaattgtaaagacacaaatcccaggtccacaatctaaagctttaattga 180
Query: 215 aagattaaataaactccaagatccaagagctgctcatttctttgctgattatgcaaattc 274
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 181 aagattaaataaactccaagatccaagagctgctcatttctttgctgattatgcaaattc 240
Query: 275 aagaggtaattatatttcagatgttgatggtaatattttattagatttatattgtcaaat 334
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 241 aagaggtaattatatttcagatgttgatggtaatattttattagatttatattgtcaaat 300
Query: 335 tgcatcaattccaattggttataataatccagaattaattaaagcagcaaaatctgatag 394
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 301 tgcatcaattccaattggttataataatccagaattaattaaagcagcaaaatctgatag 360
Query: 395 atgggtatcagcaattattaatcgtccatcattgggtgtacttccaccaaaggattggcc 454
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 361 atgggtatcagcaattattaatcgtccatcattgggtgtacttccaccaaaggattggcc 420
Query: 455 agcattaattgagaattcatttatgcaagtatcaccaaaaggtttgaatcaagtattcac 514
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 421 agcattaattgagaattcatttatgcaagtatcaccaaaaggtttgaatcaagtattcac 480
Query: 515 agcaatgtgtggatcatgtgcaaatgaatgtgcctacaaagcagttttcatgcattatca 574
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 481 agcaatgtgtggatcatgtgcaaatgaatgtgcctacaaagcagttttcatgcattatca 540
Query: 575 acatgttaaacgtggtggtaaaccatttacaccagaggagttatcatcatgtatgaagaa 634
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 541 acatgttaaacgtggtggtaaaccatttacaccagaggagttatcatcatgtatgaagaa 600
Query: 635 tcaagagccaggttcaccatcactttcaattctctcctttaagaagggt 683
|||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 601 tcaagagccaggttcaccatcactttcaattctctcctttaagaagggt 649
Lambda K H
1.37 0.711 1.31
Matrix: blastn matrix:1 -3
Number of Sequences: 92845959
Number of Hits to DB: 1,643,518,786
Number of extensions: 95170967
Number of successful extensions: 7147895
Number of sequences better than 10.0: 252
Length of query: 1642
Length of database: 95,242,211,685
Length adjustment: 24
Effective length of query: 1618
Effective length of database: 97,308,875,965
Effective search space: 157445761311370
Effective search space used: 157445761311370
X1: 11 (21.8 bits)
S2: 22 (44.1 bits)
|
| protein update |
2009. 6.28 |
| Homology vs Protein |
Query= Contig-U10820-1 (Contig-U10820-1Q) /CSM_Contig/Contig-U10820-1Q.Seq.d
(1642 letters)
Database: nrp_A
3,204,285 sequences; 1,040,966,779 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AM270386_4(AM270386|pid:none) Aspergillus niger contig An17c0040... 369 e-125
S68116(S68116) 4-aminobutyrate transaminase homolog - smut fungu... 365 e-125
BC074179_1(BC074179|pid:none) Xenopus laevis hypothetical protei... 340 e-120
BC061933_1(BC061933|pid:none) Xenopus laevis hypothetical protei... 339 e-120
CU633900_632(CU633900|pid:none) Podospora anserina genomic DNA c... 352 e-119
BC060364_1(BC060364|pid:none) Xenopus laevis hypothetical protei... 335 e-118
(P80147) RecName: Full=4-aminobutyrate aminotransferase, mitocho... 334 e-117
BT044845_1(BT044845|pid:none) Salmo salar clone ssal-rgf-505-165... 331 e-117
BT045250_1(BT045250|pid:none) Salmo salar clone ssal-rgf-516-187... 330 e-117
M84802_1(M84802|pid:none) Sus scrofa 4-aminobutyrate aminotransf... 334 e-117
AF271266_1(AF271266|pid:none) Cladosporium fulvum gamma-aminobut... 350 e-116
AK132282_1(AK132282|pid:none) Mus musculus 18 days pregnant adul... 333 e-116
(P80404) RecName: Full=4-aminobutyrate aminotransferase, mitocho... 328 e-115
AK293983_1(AK293983|pid:none) Homo sapiens cDNA FLJ56034 complet... 326 e-114
FM992689_334(FM992689|pid:none) Candida dubliniensis CD36 chromo... 339 e-114
CR382138_402(CR382138|pid:none) Debaryomyces hansenii strain CBS... 327 e-114
CR382131_746(CR382131|pid:none) Yarrowia lipolytica strain CLIB1... 333 e-111
CP000496_152(CP000496|pid:none) Pichia stipitis CBS 6054 chromos... 320 e-108
U80226_1(U80226|pid:none) Human gamma-aminobutyric acid transami... 300 e-107
CR382126_886(CR382126|pid:none) Kluyveromyces lactis strain NRRL... 312 e-106
(Q9BGI0) RecName: Full=4-aminobutyrate aminotransferase, mitocho... 293 e-105
BT045024_1(BT045024|pid:none) Salmo salar clone ssal-rgf-510-046... 305 e-104
FN392322_704(FN392322|pid:none) Pichia pastoris GS115 chromosome... 315 e-103
CR380950_174(CR380950|pid:none) Candida glabrata strain CBS138 c... 317 e-101
AE017345_191(AE017345|pid:none) Cryptococcus neoformans var. neo... 298 e-101
CP000499_406(CP000499|pid:none) Pichia stipitis CBS 6054 chromos... 314 e-100
FM992689_383(FM992689|pid:none) Candida dubliniensis CD36 chromo... 305 e-100
CR954210_220(CR954210|pid:none) Ostreococcus tauri strain OTTH05... 279 1e-98
(Q21217) RecName: Full=Probable 4-aminobutyrate aminotransferase... 286 3e-98
AM746676_9211(AM746676|pid:none) Sorangium cellulosum 'So ce 56'... 262 7e-98
DQ512722_1(DQ512722|pid:none) Lachancea kluyveri GABA aminotrans... 289 1e-97
DQ512723_1(DQ512723|pid:none) Saccharomyces cerevisiae strain NR... 294 2e-97
(P17649) RecName: Full=4-aminobutyrate aminotransferase; ... 292 8e-97
CP001328_286(CP001328|pid:none) Micromonas sp. RCC299 chromosome... 258 7e-96
FN392320_110(FN392320|pid:none) Pichia pastoris GS115 chromosome... 295 3e-95
BC045433_1(BC045433|pid:none) Danio rerio 4-aminobutyrate aminot... 261 3e-94
BT076975_1(BT076975|pid:none) Caligus rogercresseyi clone crog-e... 276 3e-93
AK036128_1(AK036128|pid:none) Mus musculus 16 days neonate cereb... 251 4e-65
DQ287923_1(DQ287923|pid:none) Carassius auratus gamma-aminobutyr... 214 2e-54
AK160802_1(AK160802|pid:none) Mus musculus 17 days embryo head c... 167 1e-39
CP000142_2606(CP000142|pid:none) Pelobacter carbinolicus DSM 238... 114 2e-36
(Q05174) RecName: Full=L-lysine-epsilon aminotransferase; ... 101 3e-36
(Q01767) RecName: Full=L-lysine-epsilon aminotransferase; ... 94 4e-33
AY596297_338(AY596297|pid:none) Haloarcula marismortui ATCC 4304... 102 2e-31
AE016958_3410(AE016958|pid:none) Mycobacterium avium subsp. para... 92 1e-30
AG2105(AG2105) 4-aminobutyrate aminotransferase [imported] - Nos... 109 9e-30
CP000820_2336(CP000820|pid:none) Frankia sp. EAN1pec, complete g... 92 2e-29
CP000511_1630(CP000511|pid:none) Mycobacterium vanbaalenii PYR-1... 78 4e-28
CP000249_2836(CP000249|pid:none) Frankia sp. CcI3, complete geno... 91 3e-27
CP000480_1713(CP000480|pid:none) Mycobacterium smegmatis str. MC... 80 7e-27
CT573213_4318(CT573213|pid:none) Frankia alni str. ACN14A chromo... 93 1e-26
BA000011_24(BA000011|pid:none) Thermoplasma volcanium GSS1 DNA, ... 97 1e-26
CP000580_1290(CP000580|pid:none) Mycobacterium sp. JLS, complete... 89 2e-25
(P63509) RecName: Full=Probable L-lysine-epsilon aminotransferas... 85 2e-25
CP001472_2115(CP001472|pid:none) Acidobacterium capsulatum ATCC ... 96 6e-25
AP008957_2110(AP008957|pid:none) Rhodococcus erythropolis PR4 DN... 92 8e-25
CP000854_1230(CP000854|pid:none) Mycobacterium marinum M, comple... 82 1e-24
CP000968_1401(CP000968|pid:none) Candidatus Korarchaeum cryptofi... 92 2e-24
CP000855_1612(CP000855|pid:none) Thermococcus onnurineus NA1, co... 91 2e-24
CU458896_3617(CU458896|pid:none) Mycobacterium abscessus chromos... 85 6e-24
CP001365_1039(CP001365|pid:none) Halorubrum lacusprofundi ATCC 4... 100 8e-24
CP000721_3815(CP000721|pid:none) Clostridium beijerinckii NCIMB ... 76 8e-24
AE017126_1372(AE017126|pid:none) Prochlorococcus marinus subsp. ... 84 1e-23
AE001825_27(AE001825|pid:none) Deinococcus radiodurans R1 chromo... 91 5e-23
AP009049_1808(AP009049|pid:none) Clostridium kluyveri NBRC 12016... 90 5e-23
AJ248285_96(AJ248285|pid:none) Pyrococcus abyssi complete genome... 111 9e-23
CP001114_984(CP001114|pid:none) Deinococcus deserti VCD115, comp... 84 9e-23
CU468135_2901(CU468135|pid:none) Erwinia tasmaniensis strain ET1... 74 9e-23
AK156736_1(AK156736|pid:none) Mus musculus activated spleen cDNA... 110 1e-22
(Q6C846) RecName: Full=Acetylornithine aminotransferase, mitocho... 84 1e-22
CT573074_114(CT573074|pid:none) Kuenenia stuttgartiensis genome ... 87 3e-22
AE017261_791(AE017261|pid:none) Picrophilus torridus DSM 9790, c... 79 4e-22
AP009389_1185(AP009389|pid:none) Pelotomaculum thermopropionicum... 108 4e-22
CP000511_3097(CP000511|pid:none) Mycobacterium vanbaalenii PYR-1... 76 9e-22
BX548174_1489(BX548174|pid:none) Prochlorococcus marinus MED4 co... 74 5e-21
(Q7V0G0) RecName: Full=Acetylornithine aminotransferase; ... 74 5e-21
CP000951_318(CP000951|pid:none) Synechococcus sp. PCC 7002, comp... 77 6e-21
CP000875_139(CP000875|pid:none) Herpetosiphon aurantiacus ATCC 2... 105 6e-21
CP001472_2849(CP001472|pid:none) Acidobacterium capsulatum ATCC ... 79 8e-21
CP000852_673(CP000852|pid:none) Caldivirga maquilingensis IC-167... 90 3e-20
CP000514_2181(CP000514|pid:none) Marinobacter aquaeolei VT8, com... 102 4e-20
CP001344_432(CP001344|pid:none) Cyanothece sp. PCC 7425, complet... 77 6e-20
CP001229_664(CP001229|pid:none) Sulfurihydrogenibium azorense Az... 79 6e-20
FM992691_447(FM992691|pid:none) Candida dubliniensis CD36 chromo... 75 2e-19
A96945(A96945) 4 animobutyrate aminotransferase [imported] - Clo... 84 2e-19
CR522870_541(CR522870|pid:none) Desulfotalea psychrophila LSv54 ... 75 2e-19
CP001147_659(CP001147|pid:none) Thermodesulfovibrio yellowstonii... 76 2e-19
CP000030_221(CP000030|pid:none) Anaplasma marginale str. St. Mar... 75 2e-19
AE017196_1158(AE017196|pid:none) Wolbachia endosymbiont of Droso... 71 2e-19
CP000110_844(CP000110|pid:none) Synechococcus sp. CC9605, comple... 74 3e-19
CP000447_2979(CP000447|pid:none) Shewanella frigidimarina NCIMB ... 75 3e-19
AP008226_862(AP008226|pid:none) Thermus thermophilus HB8 genomic... 99 3e-19
EU255906_6(EU255906|pid:none) Lactococcus lactis subsp. lactis c... 70 4e-19
CP001358_213(CP001358|pid:none) Desulfovibrio desulfuricans subs... 82 4e-19
AE016879_4002(AE016879|pid:none) Bacillus anthracis str. Ames, c... 99 6e-19
A84306(A84306) hypothetical protein Vng1524c [imported] - Haloba... 62 9e-19
CP000083_4526(CP000083|pid:none) Colwellia psychrerythraea 34H, ... 75 9e-19
CR522870_545(CR522870|pid:none) Desulfotalea psychrophila LSv54 ... 74 1e-18
CP000828_1398(CP000828|pid:none) Acaryochloris marina MBIC11017,... 71 1e-18
CP000758_393(CP000758|pid:none) Ochrobactrum anthropi ATCC 49188... 66 1e-18
AE017221_553(AE017221|pid:none) Thermus thermophilus HB27, compl... 74 1e-18
CP000095_1668(CP000095|pid:none) Prochlorococcus marinus str. NA... 74 1e-18
CP000001_3836(CP000001|pid:none) Bacillus cereus E33L, complete ... 97 2e-18
CP000485_3542(CP000485|pid:none) Bacillus thuringiensis str. Al ... 97 2e-18
AM181176_3949(AM181176|pid:none) Pseudomonas fluorescens SBW25 c... 75 2e-18
(O14433) RecName: Full=Acetylornithine aminotransferase, mitocho... 67 2e-18
T50923(T50923) acetylornithine transaminase (EC 2.6.1.11) [impor... 67 2e-18
(O66442) RecName: Full=Acetylornithine aminotransferase; ... 81 2e-18
CP001087_1402(CP001087|pid:none) Desulfobacterium autotrophicum ... 62 2e-18
AP009552_1571(AP009552|pid:none) Microcystis aeruginosa NIES-843... 66 2e-18
CP000738_127(CP000738|pid:none) Sinorhizobium medicae WSM419, co... 72 2e-18
CP000699_1400(CP000699|pid:none) Sphingomonas wittichii RW1, com... 69 2e-18
U31093_1(U31093|pid:none) Synthetic construct of S. cerevisiae a... 63 3e-18
(P18544) RecName: Full=Acetylornithine aminotransferase, mitocho... 63 3e-18
CU928170_816(CU928170|pid:none) Kluyveromyces thermotolerans str... 63 3e-18
AP007159_353(AP007159|pid:none) Aspergillus oryzae RIB40 genomic... 79 4e-18
AE008692_408(AE008692|pid:none) Zymomonas mobilis subsp. mobilis... 67 4e-18
CP001391_1114(CP001391|pid:none) Wolbachia sp. wRi, complete gen... 67 4e-18
CP001186_4141(CP001186|pid:none) Bacillus cereus G9842, complete... 96 5e-18
AE009441_1245(AE009441|pid:none) Pyrobaculum aerophilum str. IM2... 86 5e-18
CP000252_2447(CP000252|pid:none) Syntrophus aciditrophicus SB, c... 80 5e-18
CP001074_580(CP001074|pid:none) Rhizobium etli CIAT 652, complet... 69 5e-18
CP000504_1710(CP000504|pid:none) Pyrobaculum islandicum DSM 4184... 87 7e-18
CP000800_2803(CP000800|pid:none) Escherichia coli E24377A, compl... 75 7e-18
CP001230_177(CP001230|pid:none) Persephonella marina EX-H1, comp... 77 7e-18
AJ248287_45(AJ248287|pid:none) Pyrococcus abyssi complete genome... 95 8e-18
AY850387_2(AY850387|pid:none) Azospirillum brasilense disrupted ... 58 9e-18
CP000115_512(CP000115|pid:none) Nitrobacter winogradskyi Nb-255,... 74 9e-18
CP000111_1519(CP000111|pid:none) Prochlorococcus marinus str. MI... 68 9e-18
CR767821_221(CR767821|pid:none) Ehrlichia ruminantium strain Wel... 73 9e-18
BA000007_3523(BA000007|pid:none) Escherichia coli O157:H7 str. S... 75 1e-17
CP000554_1970(CP000554|pid:none) Prochlorococcus marinus str. MI... 67 1e-17
CP001138_2709(CP001138|pid:none) Salmonella enterica subsp. ente... 75 2e-17
CU928162_3039(CU928162|pid:none) Escherichia coli ED1a chromosom... 72 2e-17
CU928164_2831(CU928164|pid:none) Escherichia coli IAI39 chromoso... 72 2e-17
BX572608_127(BX572608|pid:none) Rhodopseudomonas palustris CGA00... 72 2e-17
CP000240_1382(CP000240|pid:none) Synechococcus sp. JA-2-3B'a(2-1... 69 2e-17
CP001096_5183(CP001096|pid:none) Rhodopseudomonas palustris TIE-... 72 2e-17
CP000360_3984(CP000360|pid:none) Acidobacteria bacterium Ellin34... 94 2e-17
CP000721_4850(CP000721|pid:none) Clostridium beijerinckii NCIMB ... 68 2e-17
(Q7U5R5) RecName: Full=Acetylornithine aminotransferase; ... 62 2e-17
BX897699_108(BX897699|pid:none) Bartonella henselae strain Houst... 67 2e-17
(P63566) RecName: Full=Acetylornithine aminotransferase; ... 65 2e-17
(Q5SHH5) RecName: Full=Acetylornithine/acetyl-lysine aminotransf... 93 2e-17
CP000855_486(CP000855|pid:none) Thermococcus onnurineus NA1, com... 75 3e-17
AM933172_2626(AM933172|pid:none) Salmonella enterica subsp. ente... 75 3e-17
CP000026_2474(CP000026|pid:none) Salmonella enterica subsp. ente... 74 3e-17
CP000266_2631(CP000266|pid:none) Shigella flexneri 5 str. 8401, ... 74 3e-17
CP000553_1714(CP000553|pid:none) Prochlorococcus marinus str. NA... 74 3e-17
CP000478_62(CP000478|pid:none) Syntrophobacter fumaroxidans MPOB... 74 3e-17
AM999887_782(AM999887|pid:none) Wolbachia endosymbiont of Culex ... 65 3e-17
CP000903_3849(CP000903|pid:none) Bacillus weihenstephanensis KBA... 93 3e-17
CP001127_2736(CP001127|pid:none) Salmonella enterica subsp. ente... 75 3e-17
AE006468_2713(AE006468|pid:none) Salmonella enterica subsp. ente... 75 3e-17
CP000886_3371(CP000886|pid:none) Salmonella enterica subsp. ente... 75 3e-17
CP001037_4500(CP001037|pid:none) Nostoc punctiforme PCC 73102, c... 69 3e-17
FP236842_450(FP236842|pid:none) Erwinia pyrifoliae strain Ep1/96... 70 4e-17
CU928145_2873(CU928145|pid:none) Escherichia coli 55989 chromoso... 73 4e-17
CP001337_1417(CP001337|pid:none) Chloroflexus aggregans DSM 9485... 92 5e-17
AP009049_2759(AP009049|pid:none) Clostridium kluyveri NBRC 12016... 84 6e-17
AE014613_2512(AE014613|pid:none) Salmonella enterica subsp. ente... 75 6e-17
AP009240_2915(AP009240|pid:none) Escherichia coli SE11 DNA, comp... 72 6e-17
CP000802_2645(CP000802|pid:none) Escherichia coli HS, complete g... 72 6e-17
CU928175_131(CU928175|pid:none) Zygosaccharomyces rouxii strain ... 64 6e-17
CR378663_273(CR378663|pid:none) Photobacterium profundum SS9; se... 66 6e-17
CP000494_718(CP000494|pid:none) Bradyrhizobium sp. BTAi1, comple... 70 6e-17
(Q58131) RecName: Full=Acetylornithine aminotransferase; ... 77 6e-17
CP000923_644(CP000923|pid:none) Thermoanaerobacter sp. X514, com... 76 6e-17
CP000107_212(CP000107|pid:none) Ehrlichia canis str. Jake, compl... 65 6e-17
AP007255_812(AP007255|pid:none) Magnetospirillum magneticum AMB-... 64 6e-17
(Q53196) RecName: Full=Uncharacterized aminotransferase y4uB; ... 80 8e-17
(P22256) RecName: Full=4-aminobutyrate aminotransferase; ... 72 8e-17
CP000568_1845(CP000568|pid:none) Clostridium thermocellum ATCC 2... 73 8e-17
CP000507_3596(CP000507|pid:none) Shewanella amazonensis SB2B, co... 91 9e-17
CP000099_2313(CP000099|pid:none) Methanosarcina barkeri str. Fus... 69 1e-16
CP000243_2963(CP000243|pid:none) Escherichia coli UTI89, complet... 75 1e-16
CP000880_174(CP000880|pid:none) Salmonella enterica subsp. arizo... 77 1e-16
CU928161_2802(CU928161|pid:none) Escherichia coli S88 chromosome... 75 1e-16
CU928158_385(CU928158|pid:none) Escherichia fergusonii ATCC 3546... 75 1e-16
CP001113_2806(CP001113|pid:none) Salmonella enterica subsp. ente... 75 1e-16
AM933173_2598(AM933173|pid:none) Salmonella enterica subsp. ente... 75 1e-16
CU928163_2931(CU928163|pid:none) Escherichia coli UMN026 chromos... 75 1e-16
CU651637_2529(CU651637|pid:none) Escherichia coli LF82 chromosom... 75 1e-16
(Q92SA0) RecName: Full=Acetylornithine aminotransferase; ... 67 1e-16
CP001389_149(CP001389|pid:none) Rhizobium sp. NGR234, complete g... 68 2e-16
CP000927_1223(CP000927|pid:none) Caulobacter sp. K31, complete g... 73 2e-16
(Q89VE9) RecName: Full=Acetylornithine aminotransferase 1; ... 70 2e-16
CP001275_1403(CP001275|pid:none) Thermomicrobium roseum DSM 5159... 90 2e-16
CP000036_2715(CP000036|pid:none) Shigella boydii Sb227, complete... 69 3e-16
(Q31WW1) RecName: Full=Putrescine aminotransferase; EC=... 69 3e-16
CP000480_6470(CP000480|pid:none) Mycobacterium smegmatis str. MC... 72 3e-16
CP000740_281(CP000740|pid:none) Sinorhizobium medicae WSM419 pla... 69 3e-16
CU234118_3584(CU234118|pid:none) Bradyrhizobium sp. ORS278,compl... 72 3e-16
CP000943_6205(CP000943|pid:none) Methylobacterium sp. 4-46, comp... 72 3e-16
AP009152_2328(AP009152|pid:none) Kocuria rhizophila DC2201 DNA, ... 89 4e-16
AE009950_1232(AE009950|pid:none) Pyrococcus furiosus DSM 3638, c... 76 4e-16
(P54752) RecName: Full=Acetylornithine aminotransferase; ... 65 4e-16
CP000724_3265(CP000724|pid:none) Alkaliphilus metalliredigens QY... 77 4e-16
CP001089_3117(CP001089|pid:none) Geobacter lovleyi SZ, complete ... 75 4e-16
(Q8FTN2) RecName: Full=Acetylornithine aminotransferase; ... 89 5e-16
FN392322_672(FN392322|pid:none) Pichia pastoris GS115 chromosome... 66 5e-16
CP000076_180(CP000076|pid:none) Pseudomonas fluorescens Pf-5, co... 70 5e-16
CP000789_78(CP000789|pid:none) Vibrio harveyi ATCC BAA-1116 chro... 69 5e-16
CP000969_1025(CP000969|pid:none) Thermotoga sp. RQ2, complete ge... 72 5e-16
CU459003_3380(CU459003|pid:none) Magnetospirillum gryphiswaldens... 61 5e-16
AE007895_2(AE007895|pid:none) Agrobacterium tumefaciens str. C58... 60 6e-16
BA000028_1261(BA000028|pid:none) Oceanobacillus iheyensis HTE831... 75 6e-16
CP001098_1708(CP001098|pid:none) Halothermothrix orenii H 168, c... 79 8e-16
CP000552_1461(CP000552|pid:none) Prochlorococcus marinus str. MI... 62 8e-16
BX950229_1101(BX950229|pid:none) Methanococcus maripaludis strai... 69 8e-16
CP001124_3595(CP001124|pid:none) Geobacter bemidjiensis Bem, com... 68 8e-16
CU651637_2974(CU651637|pid:none) Escherichia coli LF82 chromosom... 69 1e-15
CP000750_3130(CP000750|pid:none) Kineococcus radiotolerans SRS30... 67 1e-15
CP000463_4842(CP000463|pid:none) Rhodopseudomonas palustris BisA... 74 1e-15
CU928158_2926(CU928158|pid:none) Escherichia fergusonii ATCC 354... 69 1e-15
AP009389_1726(AP009389|pid:none) Pelotomaculum thermopropionicum... 75 1e-15
JC1497(JC1497)alpha-amino-epsilon-caprolactam racemase (EC 5.1.-... 66 1e-15
AJ248285_28(AJ248285|pid:none) Pyrococcus abyssi complete genome... 79 1e-15
AE017321_128(AE017321|pid:none) Wolbachia endosymbiont strain TR... 62 1e-15
CP000471_3700(CP000471|pid:none) Magnetococcus sp. MC-1, complet... 69 1e-15
CP000822_4362(CP000822|pid:none) Citrobacter koseri ATCC BAA-895... 67 2e-15
AE005174_3972(AE005174|pid:none) Escherichia coli O157:H7 EDL933... 69 2e-15
CP000247_3133(CP000247|pid:none) Escherichia coli 536, complete ... 69 2e-15
CP000243_3447(CP000243|pid:none) Escherichia coli UTI89, complet... 69 2e-15
U28379_18(U28379|pid:none) Escherichia coli K-12 genome; approxi... 69 2e-15
CU928164_3549(CU928164|pid:none) Escherichia coli IAI39 chromoso... 69 2e-15
AP009048_3038(AP009048|pid:none) Escherichia coli str. K12 subst... 69 2e-15
CU928145_3412(CU928145|pid:none) Escherichia coli 55989 chromoso... 69 2e-15
CU928163_3484(CU928163|pid:none) Escherichia coli UMN026 chromos... 69 2e-15
(P42588) RecName: Full=Putrescine aminotransferase; EC=... 69 2e-15
(B5YRB3) RecName: Full=Putrescine aminotransferase; EC=... 69 2e-15
CP000802_3082(CP000802|pid:none) Escherichia coli HS, complete g... 69 2e-15
CP000946_615(CP000946|pid:none) Escherichia coli ATCC 8739, comp... 69 2e-15
AP009240_3354(AP009240|pid:none) Escherichia coli SE11 DNA, comp... 69 2e-15
AP006627_2988(AP006627|pid:none) Bacillus clausii KSM-K16 DNA, c... 68 2e-15
AE015451_212(AE015451|pid:none) Pseudomonas putida KT2440 comple... 67 2e-15
CP000076_4448(CP000076|pid:none) Pseudomonas fluorescens Pf-5, c... 65 2e-15
AJ965256_986(AJ965256|pid:none) Dehalococcoides sp. CBDB1 comple... 61 2e-15
CP000885_1928(CP000885|pid:none) Clostridium phytofermentans ISD... 59 2e-15
(Q3YXH0) RecName: Full=Putrescine aminotransferase; EC=... 69 2e-15
AE005674_3116(AE005674|pid:none) Shigella flexneri 2a str. 301, ... 68 2e-15
CP000075_90(CP000075|pid:none) Pseudomonas syringae pv. syringae... 72 2e-15
CT573073_846(CT573073|pid:none) Kuenenia stuttgartiensis genome ... 71 2e-15
CP000494_3899(CP000494|pid:none) Bradyrhizobium sp. BTAi1, compl... 72 3e-15
AP011115_4459(AP011115|pid:none) Rhodococcus opacus B4 DNA, comp... 86 3e-15
AJ248283_136(AJ248283|pid:none) Pyrococcus abyssi complete genom... 86 3e-15
AF196567_13(AF196567|pid:none) Pseudomonas stutzeri pdt locus, p... 74 4e-15
CP001013_1993(CP001013|pid:none) Leptothrix cholodnii SP-6, comp... 73 4e-15
CP000878_1350(CP000878|pid:none) Prochlorococcus marinus str. MI... 72 4e-15
CT971583_1747(CT971583|pid:none) Synechococcus WH7803 complete g... 62 4e-15
CP000449_484(CP000449|pid:none) Maricaulis maris MCS10, complete... 64 4e-15
CP000724_679(CP000724|pid:none) Alkaliphilus metalliredigens QYM... 86 4e-15
BA000030_7167(BA000030|pid:none) Streptomyces avermitilis MA-468... 86 4e-15
CT573326_3397(CT573326|pid:none) Pseudomonas entomophila str. L4... 73 5e-15
CP000926_235(CP000926|pid:none) Pseudomonas putida GB-1, complet... 67 5e-15
AE004969_600(AE004969|pid:none) Neisseria gonorrhoeae FA 1090, c... 69 5e-15
BX897700_100(BX897700|pid:none) Bartonella quintana str. Toulous... 62 5e-15
AM260480_966(AM260480|pid:none) Ralstonia eutropha H16 chromosom... 86 5e-15
CP000394_2274(CP000394|pid:none) Granulibacter bethesdensis CGDN... 66 7e-15
CP001280_817(CP001280|pid:none) Methylocella silvestris BL2, com... 63 7e-15
CP000431_4494(CP000431|pid:none) Rhodococcus jostii RHA1, comple... 85 7e-15
CP000813_604(CP000813|pid:none) Bacillus pumilus SAFR-032, compl... 65 8e-15
CP000760_33(CP000760|pid:none) Ochrobactrum anthropi ATCC 49188 ... 63 8e-15
CP000949_4968(CP000949|pid:none) Pseudomonas putida W619, comple... 67 8e-15
CP000117_3709(CP000117|pid:none) Anabaena variabilis ATCC 29413,... 65 8e-15
CP000285_1279(CP000285|pid:none) Chromohalobacter salexigens DSM... 85 9e-15
CP000432_784(CP000432|pid:none) Rhodococcus jostii RHA1 plasmid ... 85 9e-15
CP001140_124(CP001140|pid:none) Desulfurococcus kamchatkensis 12... 85 9e-15
CP000653_3829(CP000653|pid:none) Enterobacter sp. 638, complete ... 85 9e-15
AM181176_4286(AM181176|pid:none) Pseudomonas fluorescens SBW25 c... 78 1e-14
(Q55DT8) RecName: Full=Probable acetylornithine aminotransferase... 71 1e-14
AL939130_44(AL939130|pid:none) Streptomyces coelicolor A3(2) com... 84 1e-14
CP000503_3028(CP000503|pid:none) Shewanella sp. W3-18-1, complet... 72 1e-14
CP000607_1356(CP000607|pid:none) Chlorobium phaeovibrioides DSM ... 69 1e-14
AM490503_1(AM490503|pid:none) Herbaspirillum seropedicae argM ge... 69 1e-14
CP001074_4074(CP001074|pid:none) Rhizobium etli CIAT 652, comple... 66 1e-14
CP000745_349(CP000745|pid:none) Methanococcus maripaludis C7, co... 67 2e-14
AL111168_201(AL111168|pid:none) Campylobacter jejuni subsp. jeju... 63 2e-14
(Q9PIR7) RecName: Full=Acetylornithine aminotransferase; ... 63 2e-14
CP000678_1368(CP000678|pid:none) Methanobrevibacter smithii ATCC... 65 2e-14
CP000148_1562(CP000148|pid:none) Geobacter metallireducens GS-15... 84 2e-14
(Q94AL9) RecName: Full=Alanine--glyoxylate aminotransferase 2 ho... 59 2e-14
AY045941_1(AY045941|pid:none) Arabidopsis thaliana putative beta... 59 2e-14
FM209186_2883(FM209186|pid:none) Pseudomonas aeruginosa LESB58 c... 70 2e-14
CU928158_3217(CU928158|pid:none) Escherichia fergusonii ATCC 354... 75 2e-14
CP000814_203(CP000814|pid:none) Campylobacter jejuni subsp. jeju... 62 2e-14
CP000097_1518(CP000097|pid:none) Synechococcus sp. CC9902, compl... 63 2e-14
AP007255_316(AP007255|pid:none) Magnetospirillum magneticum AMB-... 62 2e-14
CP000454_1748(CP000454|pid:none) Arthrobacter sp. FB24, complete... 83 3e-14
AM238663_961(AM238663|pid:none) Streptomyces ambofaciens ATCC 23... 83 3e-14
CP000647_3788(CP000647|pid:none) Klebsiella pneumoniae subsp. pn... 83 3e-14
AE004091_2414(AE004091|pid:none) Pseudomonas aeruginosa PAO1, co... 70 3e-14
(Q9A652) RecName: Full=Acetylornithine aminotransferase; ... 67 3e-14
AP009384_4028(AP009384|pid:none) Azorhizobium caulinodans ORS 57... 65 3e-14
AF093219_4(AF093219|pid:none) Campylobacter jejuni N-acetyl-glut... 62 3e-14
CP000094_188(CP000094|pid:none) Pseudomonas fluorescens Pf0-1, c... 68 4e-14
CP001133_862(CP001133|pid:none) Vibrio fischeri MJ11 chromosome ... 65 4e-14
CP000316_411(CP000316|pid:none) Polaromonas sp. JS666, complete ... 60 4e-14
BA000045_547(BA000045|pid:none) Gloeobacter violaceus PCC 7421 D... 66 4e-14
(Q7NN66) RecName: Full=Acetylornithine aminotransferase; ... 66 4e-14
CP000453_1095(CP000453|pid:none) Alkalilimnicola ehrlichii MLHE-... 69 4e-14
CP000359_1403(CP000359|pid:none) Deinococcus geothermalis DSM 11... 82 4e-14
CP000957_25(CP000957|pid:none) Synechococcus sp. PCC 7002 plasmi... 82 4e-14
CP000285_1153(CP000285|pid:none) Chromohalobacter salexigens DSM... 82 4e-14
FB903865_1(FB903865|pid:none) Sequence 123138 from Patent WO2008... 56 5e-14
FB903845_1(FB903845|pid:none) Sequence 123118 from Patent WO2008... 56 5e-14
CP000744_2810(CP000744|pid:none) Pseudomonas aeruginosa PA7, com... 72 5e-14
AY085912_1(AY085912|pid:none) Arabidopsis thaliana clone 19586 m... 71 5e-14
CP000021_754(CP000021|pid:none) Vibrio fischeri ES114 chromosome... 64 5e-14
CP000025_271(CP000025|pid:none) Campylobacter jejuni RM1221, com... 62 5e-14
AE017196_497(AE017196|pid:none) Wolbachia endosymbiont of Drosop... 57 5e-14
BA000004_782(BA000004|pid:none) Bacillus halodurans C-125 DNA, c... 82 6e-14
CP001390_2975(CP001390|pid:none) Geobacter sp. FRC-32, complete ... 78 7e-14
AE009951_1578(AE009951|pid:none) Fusobacterium nucleatum subsp. ... 74 7e-14
CP000474_1567(CP000474|pid:none) Arthrobacter aurescens TC1, com... 59 7e-14
CP001287_1917(CP001287|pid:none) Cyanothece sp. PCC 8801, comple... 61 7e-14
CP001157_2476(CP001157|pid:none) Azotobacter vinelandii DJ, comp... 70 9e-14
CU928162_3918(CU928162|pid:none) Escherichia coli ED1a chromosom... 73 9e-14
CP000964_285(CP000964|pid:none) Klebsiella pneumoniae 342, compl... 81 1e-13
CP000453_486(CP000453|pid:none) Alkalilimnicola ehrlichii MLHE-1... 81 1e-13
CP000682_169(CP000682|pid:none) Metallosphaera sedula DSM 5348, ... 81 1e-13
CP000781_1208(CP000781|pid:none) Xanthobacter autotrophicus Py2,... 62 1e-13
CP001191_3592(CP001191|pid:none) Rhizobium leguminosarum bv. tri... 63 1e-13
CP000230_3267(CP000230|pid:none) Rhodospirillum rubrum ATCC 1117... 74 1e-13
CP000448_2220(CP000448|pid:none) Syntrophomonas wolfei subsp. wo... 67 1e-13
CP000612_271(CP000612|pid:none) Desulfotomaculum reducens MI-1, ... 64 1e-13
AB088066_2(AB088066|pid:none) Bacillus subtilis biotin operon (b... 81 1e-13
AE001437_1343(AE001437|pid:none) Clostridium acetobutylicum ATCC... 81 1e-13
CP000743_631(CP000743|pid:none) Methanococcus aeolicus Nankai-3,... 81 1e-13
CP000509_2425(CP000509|pid:none) Nocardioides sp. JS614, complet... 55 2e-13
CP000826_2835(CP000826|pid:none) Serratia proteamaculans 568, co... 68 2e-13
CT978603_611(CT978603|pid:none) Synechococcus sp. RCC307 genomic... 52 2e-13
CU458896_4384(CU458896|pid:none) Mycobacterium abscessus chromos... 80 2e-13
CP000141_1396(CP000141|pid:none) Carboxydothermus hydrogenoforma... 80 2e-13
CP000077_955(CP000077|pid:none) Sulfolobus acidocaldarius DSM 63... 80 2e-13
(Q8K9P0) RecName: Full=Adenosylmethionine-8-amino-7-oxononanoate... 80 2e-13
AJ833002_6(AJ833002|pid:none) Serratia marcescens prodigiosin bi... 59 2e-13
BC043680_1(BC043680|pid:none) Mus musculus alanine-glyoxylate am... 52 2e-13
(Q8BWU8) RecName: Full=Alanine--glyoxylate aminotransferase 2-li... 52 2e-13
CP000453_1181(CP000453|pid:none) Alkalilimnicola ehrlichii MLHE-... 65 2e-13
CP000699_4321(CP000699|pid:none) Sphingomonas wittichii RW1, com... 56 2e-13
(Q976K0) RecName: Full=Acetylornithine/acetyl-lysine aminotransf... 70 2e-13
CR543861_3097(CR543861|pid:none) Acinetobacter sp. ADP1 complete... 80 2e-13
AE017333_711(AE017333|pid:none) Bacillus licheniformis DSM 13, c... 80 2e-13
AM260480_1671(AM260480|pid:none) Ralstonia eutropha H16 chromoso... 80 2e-13
CP000527_688(CP000527|pid:none) Desulfovibrio vulgaris subsp. vu... 80 2e-13
(B5XTY7) RecName: Full=Putrescine aminotransferase; EC=... 63 3e-13
CP000647_3472(CP000647|pid:none) Klebsiella pneumoniae subsp. pn... 63 3e-13
CP000968_81(CP000968|pid:none) Candidatus Korarchaeum cryptofilu... 69 3e-13
CP001192_66(CP001192|pid:none) Rhizobium leguminosarum bv. trifo... 58 3e-13
AP006840_2879(AP006840|pid:none) Symbiobacterium thermophilum IA... 56 3e-13
EU016592_3(EU016592|pid:none) Uncultured Group I marine crenarch... 64 3e-13
AP008213_910(AP008213|pid:none) Oryza sativa (japonica cultivar-... 80 3e-13
CP000384_346(CP000384|pid:none) Mycobacterium sp. MCS, complete ... 80 3e-13
DQ224372_1(DQ224372|pid:none) Glycine max ornithine aminotransfe... 59 3e-13
CP000682_275(CP000682|pid:none) Metallosphaera sedula DSM 5348, ... 79 4e-13
AE015451_4170(AE015451|pid:none) Pseudomonas putida KT2440 compl... 65 4e-13
CP000529_2605(CP000529|pid:none) Polaromonas naphthalenivorans C... 69 4e-13
CP000857_3184(CP000857|pid:none) Salmonella enterica subsp. ente... 62 4e-13
CP000438_4226(CP000438|pid:none) Pseudomonas aeruginosa UCBPP-PA... 64 4e-13
(Q8Z1Z3) RecName: Full=Acetylornithine/succinyldiaminopimelate a... 79 5e-13
CP000480_2855(CP000480|pid:none) Mycobacterium smegmatis str. MC... 79 5e-13
(Q6DEB1) RecName: Full=Alanine--glyoxylate aminotransferase 2-li... 52 6e-13
CP000613_2422(CP000613|pid:none) Rhodospirillum centenum SW, com... 50 6e-13
CP001127_3402(CP001127|pid:none) Salmonella enterica subsp. ente... 79 6e-13
CP000822_4749(CP000822|pid:none) Citrobacter koseri ATCC BAA-895... 79 6e-13
(B5FHV3) RecName: Full=Putrescine aminotransferase; EC=... 61 7e-13
CP000903_1255(CP000903|pid:none) Bacillus weihenstephanensis KBA... 63 7e-13
AF006665_17(AF006665|pid:none) Bacillus subtilis 168 region at 1... 67 7e-13
CP001145_629(CP001145|pid:none) Coprothermobacter proteolyticus ... 61 7e-13
(Q8PH31) RecName: Full=Acetylornithine aminotransferase; ... 67 7e-13
CP001001_2286(CP001001|pid:none) Methylobacterium radiotolerans ... 58 7e-13
(Q6BUP9) RecName: Full=Acetylornithine aminotransferase, mitocho... 78 8e-13
CP000058_2377(CP000058|pid:none) Pseudomonas syringae pv. phaseo... 78 8e-13
CP000094_4631(CP000094|pid:none) Pseudomonas fluorescens Pf0-1, ... 78 8e-13
AE017349_82(AE017349|pid:none) Cryptococcus neoformans var. neof... 69 9e-13
(B4TIU6) RecName: Full=Putrescine aminotransferase; EC=... 61 9e-13
(A9N5Z8) RecName: Full=Putrescine aminotransferase; EC=... 61 9e-13
AE017333_2188(AE017333|pid:none) Bacillus licheniformis DSM 13, ... 68 9e-13
AE014613_2935(AE014613|pid:none) Salmonella enterica subsp. ente... 61 9e-13
FP312985_8(FP312985|pid:none) uncultured bacterial clone mtbm116... 60 9e-13
(P53555) RecName: Full=Adenosylmethionine-8-amino-7-oxononanoate... 78 1e-12
BX950851_4038(BX950851|pid:none) Erwinia carotovora subsp. atros... 78 1e-12
CP000822_3902(CP000822|pid:none) Citrobacter koseri ATCC BAA-895... 78 1e-12
AY316747_334(AY316747|pid:none) Rhizobium sp. NGR234 megaplasmid... 50 1e-12
CP000880_4233(CP000880|pid:none) Salmonella enterica subsp. ariz... 60 1e-12
CP000393_2313(CP000393|pid:none) Trichodesmium erythraeum IMS101... 62 1e-12
FM178379_2732(FM178379|pid:none) Aliivibrio salmonicida LFI1238 ... 57 1e-12
AE006641_2489(AE006641|pid:none) Sulfolobus solfataricus P2, com... 77 1e-12
CP000489_2312(CP000489|pid:none) Paracoccus denitrificans PD1222... 77 1e-12
CP000964_4391(CP000964|pid:none) Klebsiella pneumoniae 342, comp... 77 1e-12
CP001087_3811(CP001087|pid:none) Desulfobacterium autotrophicum ... 77 1e-12
AM286690_509(AM286690|pid:none) Alcanivorax borkumensis SK2, com... 77 1e-12
AE017285_2546(AE017285|pid:none) Desulfovibrio vulgaris subsp. v... 77 1e-12
FM992689_485(FM992689|pid:none) Candida dubliniensis CD36 chromo... 64 2e-12
(A4WEQ6) RecName: Full=Putrescine aminotransferase; EC=... 59 2e-12
CP000032_350(CP000032|pid:none) Ruegeria pomeroyi DSS-3 plasmid ... 54 2e-12
CP000378_695(CP000378|pid:none) Burkholderia cenocepacia AU 1054... 64 2e-12
CP000458_1178(CP000458|pid:none) Burkholderia cenocepacia HI2424... 64 2e-12
CP001025_1049(CP001025|pid:none) Burkholderia ambifaria MC40-6 c... 63 2e-12
CP000157_2783(CP000157|pid:none) Erythrobacter litoralis HTCC259... 61 2e-12
EF146987_1(EF146987|pid:none) Populus trichocarpa clone WS01225_... 77 2e-12
CP000886_4187(CP000886|pid:none) Salmonella enterica subsp. ente... 77 2e-12
CP000826_4290(CP000826|pid:none) Serratia proteamaculans 568, co... 77 2e-12
(P40732) RecName: Full=Acetylornithine/succinyldiaminopimelate a... 77 2e-12
CP001138_3408(CP001138|pid:none) Salmonella enterica subsp. ente... 77 2e-12
CP000124_2808(CP000124|pid:none) Burkholderia pseudomallei 1710b... 65 2e-12
CP000086_1747(CP000086|pid:none) Burkholderia thailandensis E264... 65 2e-12
CP001408_2867(CP001408|pid:none) Burkholderia pseudomallei MSHR3... 65 2e-12
AM260479_2948(AM260479|pid:none) Ralstonia eutropha H16 chromoso... 67 2e-12
CP000880_3982(CP000880|pid:none) Salmonella enterica subsp. ariz... 77 2e-12
BX950851_2031(BX950851|pid:none) Erwinia carotovora subsp. atros... 77 2e-12
CP000874_1977(CP000874|pid:none) Rhizobium sp. NGR234 plasmid pN... 58 3e-12
CP000614_1082(CP000614|pid:none) Burkholderia vietnamiensis G4 c... 62 3e-12
CP000891_3858(CP000891|pid:none) Shewanella baltica OS195, compl... 62 3e-12
CP000563_563(CP000563|pid:none) Shewanella baltica OS155, comple... 62 3e-12
CP000503_3488(CP000503|pid:none) Shewanella sp. W3-18-1, complet... 61 3e-12
CP000628_3226(CP000628|pid:none) Agrobacterium radiobacter K84 c... 55 3e-12
CP001401_1895(CP001401|pid:none) Sulfolobus islandicus M.16.27, ... 76 3e-12
AP008955_2093(AP008955|pid:none) Brevibacillus brevis NBRC 10059... 76 3e-12
CP000038_3253(CP000038|pid:none) Shigella sonnei Ss046, complete... 76 3e-12
(Q9RW75) RecName: Full=Acetylornithine/acetyl-lysine aminotransf... 76 3e-12
CP000789_1714(CP000789|pid:none) Vibrio harveyi ATCC BAA-1116 ch... 76 3e-12
AE000513_779(AE000513|pid:none) Deinococcus radiodurans R1 chrom... 76 3e-12
AE014292_814(AE014292|pid:none) Brucella suis 1330 chromosome II... 76 3e-12
AE017220_3402(AE017220|pid:none) Salmonella enterica subsp. ente... 76 3e-12
CP000712_1619(CP000712|pid:none) Pseudomonas putida F1, complete... 65 3e-12
CP000386_2833(CP000386|pid:none) Rubrobacter xylanophilus DSM 99... 60 3e-12
CP000382_1481(CP000382|pid:none) Clostridium novyi NT, complete ... 58 4e-12
CP001185_178(CP001185|pid:none) Thermosipho africanus TCF52B, co... 54 4e-12
(Q89LG2) RecName: Full=Acetylornithine aminotransferase 2; ... 76 4e-12
CP000822_4646(CP000822|pid:none) Citrobacter koseri ATCC BAA-895... 76 4e-12
CP001229_1447(CP001229|pid:none) Sulfurihydrogenibium azorense A... 76 4e-12
AE017224_357(AE017224|pid:none) Brucella abortus biovar 1 str. 9... 76 4e-12
AM711867_2902(AM711867|pid:none) Clavibacter michiganensis subsp... 76 4e-12
CP000860_331(CP000860|pid:none) Candidatus Desulforudis audaxvia... 76 4e-12
(Q5PC95) RecName: Full=Putrescine aminotransferase; EC=... 61 5e-12
AM902716_42(AM902716|pid:none) Bordetella petrii strain DSM 1280... 75 5e-12
CP001402_2534(CP001402|pid:none) Sulfolobus islandicus M.16.4, c... 75 5e-12
CP000946_343(CP000946|pid:none) Escherichia coli ATCC 8739, comp... 75 5e-12
AP009240_3621(AP009240|pid:none) Escherichia coli SE11 DNA, comp... 75 5e-12
CP001401_2455(CP001401|pid:none) Sulfolobus islandicus M.16.27, ... 75 5e-12
CP001400_2410(CP001400|pid:none) Sulfolobus islandicus M.14.25, ... 75 5e-12
CP001120_3522(CP001120|pid:none) Salmonella enterica subsp. ente... 75 5e-12
(P18335) RecName: Full=Acetylornithine/succinyldiaminopimelate a... 75 5e-12
EU016564_18(EU016564|pid:none) Uncultured marine microorganism H... 57 6e-12
CP000931_1000(CP000931|pid:none) Shewanella halifaxensis HAW-EB4... 75 7e-12
AE004969_282(AE004969|pid:none) Neisseria gonorrhoeae FA 1090, c... 75 7e-12
CP000802_1346(CP000802|pid:none) Escherichia coli HS, complete g... 75 7e-12
CP001050_457(CP001050|pid:none) Neisseria gonorrhoeae NCCP11945,... 75 7e-12
CP000507_2626(CP000507|pid:none) Shewanella amazonensis SB2B, co... 75 7e-12
FB903847_1(FB903847|pid:none) Sequence 123120 from Patent WO2008... 49 8e-12
CP000362_775(CP000362|pid:none) Roseobacter denitrificans OCh 11... 66 8e-12
CP000653_1685(CP000653|pid:none) Enterobacter sp. 638, complete ... 68 8e-12
AE002098_704(AE002098|pid:none) Neisseria meningitidis MC58, com... 75 9e-12
CP001404_742(CP001404|pid:none) Sulfolobus islandicus Y.N.15.51,... 75 9e-12
CP001402_1953(CP001402|pid:none) Sulfolobus islandicus M.16.4, c... 75 9e-12
CP001400_1829(CP001400|pid:none) Sulfolobus islandicus M.14.25, ... 75 9e-12
CP000381_657(CP000381|pid:none) Neisseria meningitidis 053442, c... 75 9e-12
CP001399_1978(CP001399|pid:none) Sulfolobus islandicus L.S.2.15,... 75 9e-12
CU928160_1292(CU928160|pid:none) Escherichia coli IAI1 chromosom... 75 9e-12
CP000561_280(CP000561|pid:none) Pyrobaculum calidifontis JCM 115... 75 9e-12
CU928145_1434(CU928145|pid:none) Escherichia coli 55989 chromoso... 75 9e-12
AP009493_3382(AP009493|pid:none) Streptomyces griseus subsp. gri... 75 9e-12
CP000958_1151(CP000958|pid:none) Burkholderia cenocepacia MC0-3 ... 61 1e-11
(Q8P5Q4) RecName: Full=Acetylornithine aminotransferase; ... 66 1e-11
AM920689_919(AM920689|pid:none) Xanthomonas campestris pv. campe... 66 1e-11
CP000851_3500(CP000851|pid:none) Shewanella pealeana ATCC 700345... 56 1e-11
CP000970_1757(CP000970|pid:none) Escherichia coli SMS-3-5, compl... 74 1e-11
(O66557) RecName: Full=Adenosylmethionine-8-amino-7-oxononanoate... 74 1e-11
AM167904_2195(AM167904|pid:none) Bordetella avium 197N complete ... 74 1e-11
CP000759_213(CP000759|pid:none) Ochrobactrum anthropi ATCC 49188... 74 1e-11
CP000912_771(CP000912|pid:none) Brucella suis ATCC 23445 chromos... 74 1e-11
CP000319_2553(CP000319|pid:none) Nitrobacter hamburgensis X14, c... 65 1e-11
CP001197_511(CP001197|pid:none) Desulfovibrio vulgaris str. 'Miy... 67 1e-11
CT573213_6267(CT573213|pid:none) Frankia alni str. ACN14A chromo... 74 2e-11
EF414520_1(EF414520|pid:none) Uncultured Geobacter sp. clone Rif... 74 2e-11
CP000504_1886(CP000504|pid:none) Pyrobaculum islandicum DSM 4184... 74 2e-11
CP001399_2535(CP001399|pid:none) Sulfolobus islandicus L.S.2.15,... 74 2e-11
BX640417_316(BX640417|pid:none) Bordetella pertussis strain Toha... 74 2e-11
BX640430_142(BX640430|pid:none) Bordetella parapertussis strain ... 74 2e-11
CU928163_1587(CU928163|pid:none) Escherichia coli UMN026 chromos... 74 2e-11
CP000267_581(CP000267|pid:none) Rhodoferax ferrireducens T118, c... 74 2e-11
CP000480_2367(CP000480|pid:none) Mycobacterium smegmatis str. MC... 74 2e-11
CP000712_1415(CP000712|pid:none) Pseudomonas putida F1, complete... 62 2e-11
CP000447_3273(CP000447|pid:none) Shewanella frigidimarina NCIMB ... 56 2e-11
CP000821_807(CP000821|pid:none) Shewanella sediminis HAW-EB3, co... 55 2e-11
AP009240_1354(AP009240|pid:none) Escherichia coli SE11 DNA, comp... 74 2e-11
CP000249_4009(CP000249|pid:none) Frankia sp. CcI3, complete geno... 74 2e-11
CP000681_1076(CP000681|pid:none) Shewanella putrefaciens CN-32, ... 74 2e-11
AE005174_2202(AE005174|pid:none) Escherichia coli O157:H7 EDL933... 74 2e-11
AE016853_2098(AE016853|pid:none) Pseudomonas syringae pv. tomato... 74 2e-11
CP000852_748(CP000852|pid:none) Caldivirga maquilingensis IC-167... 74 2e-11
(Q8ZV07) RecName: Full=Acetylornithine/acetyl-lysine aminotransf... 74 2e-11
CP000266_1231(CP000266|pid:none) Shigella flexneri 5 str. 8401, ... 74 2e-11
AP006627_2424(AP006627|pid:none) Bacillus clausii KSM-K16 DNA, c... 74 2e-11
CP000469_3070(CP000469|pid:none) Shewanella sp. ANA-3, complete ... 74 2e-11
CP000444_2972(CP000444|pid:none) Shewanella sp. MR-7, complete g... 74 2e-11
CP000709_701(CP000709|pid:none) Brucella ovis ATCC 25840 chromos... 74 2e-11
CP000230_1143(CP000230|pid:none) Rhodospirillum rubrum ATCC 1117... 54 2e-11
>AM270386_4(AM270386|pid:none) Aspergillus niger contig An17c0040,
complete genome. &AY955283_1(AY955283|pid:none)
Length = 498
Score = 369 bits (946), Expect(2) = e-125
Identities = 188/352 (53%), Positives = 238/352 (67%), Gaps = 39/352 (11%)
Frame = +3
Query: 117 SIPTTP------TPDFPGEYKEPIVKTQIPGPQSKALIERLNKLQDPRAAHFFADYANSR 278
++ TTP P FP E P + T IPGP +KA +L+K+ D R+ + ADY S
Sbjct: 22 TLTTTPHMRAAEKPYFPDEPSAPKLATAIPGPNNKAAAAKLDKVFDVRSLNMLADYYKSN 81
Query: 279 GNYISDVDGNILLDLYCQIASIPIGYNNPELIKAAKSDRWVSAIINRPSLGVLPPKDWPA 458
GNYI+D+DGN+LLD+Y QIASIP+GYNNP L K A+S V+A+INRP+LG P DW
Sbjct: 82 GNYIADLDGNVLLDVYAQIASIPVGYNNPHLRKVAESPEMVNALINRPALGNFPSHDWAD 141
Query: 459 LIENSFMQVSPKGLNQVFTAMCGSCANECAYKAVFMHYQHVKRGG--KPFTPEELSSCMK 632
+++ ++ +PKGLNQVFTA+ GS ANE AYKA FM+Y+ +RGG FT EEL + MK
Sbjct: 142 ILDTGILKAAPKGLNQVFTALAGSDANETAYKAAFMYYRQRERGGAETEFTEEELETTMK 201
Query: 633 NQEPGSPSLSILSFK------------------------------KGXXXXLKYPLAEHA 722
NQ PGSP LSI+SFK + LKYPL EHA
Sbjct: 202 NQSPGSPQLSIMSFKSAFHGRLFGSLSTTRSKPIHKLDIPAFDWPQAPFPSLKYPLEEHA 261
Query: 723 KENREIEDRCLQEVEQLIKTWHIPVAGIIVEPIQAEGGDNYATPYFFQGLRDITKKHGVS 902
+EN + E RCLQE E+LIK WH PVA ++VEPIQ+EGGDN+A+P FF+GLR+ITK++ V
Sbjct: 262 QENAQEEQRCLQETERLIKEWHNPVAAVVVEPIQSEGGDNHASPAFFRGLREITKRNNVL 321
Query: 903 MIVDEVQTGMGATGKFWAHEHWNLTSPPDIVTFSKKMQAAGFYH-NLDYRPS 1055
IVDEVQTG+GATGKFWAH+HWNL +PPD+VTFSKK Q AG+Y+ N RP+
Sbjct: 322 FIVDEVQTGVGATGKFWAHDHWNLETPPDMVTFSKKAQTAGYYYGNPALRPN 373
Score = 105 bits (263), Expect(2) = e-125
Identities = 55/126 (43%), Positives = 81/126 (64%), Gaps = 2/126 (1%)
Frame = +1
Query: 1063 YRNFNTWMGDPVRALELEVVIGEIKKNHLLDNVVITGNYLKDGLFDIAARYPGLIQNIR- 1239
YR FNTWMGDP RAL +I EI++ +L++N TG+YL GL +A +YP +QN+R
Sbjct: 376 YRQFNTWMGDPARALIFRGIIEEIERLNLVENTAATGDYLFSGLERLAKQYPEHLQNLRG 435
Query: 1240 -GEGTFLAIDFPTPAERDRVISHIRLLGVEMGGCGERSIRFRPMLVCQPSHINQFLNRFD 1416
G+GTF+A D P +RD + + +GV +GG G+ ++R RPMLV Q H + L +
Sbjct: 436 KGQGTFIAWDTP---KRDEFLVKAKGVGVNIGGSGQSAVRLRPMLVFQKHHADILLESVE 492
Query: 1417 QTMKEL 1434
+ +K+L
Sbjct: 493 KIIKQL 498
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3204285
Number of Hits to DB: 2,648,322,881
Number of extensions: 57701951
Number of successful extensions: 154139
Number of sequences better than 10.0: 2561
Number of HSP's gapped: 153526
Number of HSP's successfully gapped: 3363
Length of query: 547
Length of database: 1,040,966,779
Length adjustment: 134
Effective length of query: 413
Effective length of database: 611,592,589
Effective search space: 252587739257
Effective search space used: 252587739257
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 32 (16.9 bits)
|
| PSORT |
|
| VS (DIR, S) |
3 |
| VH (FL, L) |
0 |
| VF (FL, S) |
13 |
| AH (FL, L) |
0 |
| AF (FL, S) |
5 |
| SL (DIR, L) |
2 |
| SS (DIR, S) |
0 |
| SH (FL, L) |
0 |
| SF (FL, S) |
1 |
| CH (FL, L) |
1 |
| CF (FL, S) |
2 |
| FCL (DIR, L) |
0 |
| FC (DIR, S) |
0 |
| FC-IC (SUB) |
0 |