| Contig-U10768-1 |
| Contig ID |
Contig-U10768-1 |
| Contig update |
2002.12.18 |
| Contig sequence |
 |
| Gap |
gap included |
| Contig length |
1503 |
| Chromosome number (1..6, M) |
1 |
| Chromosome length |
4919822 |
| Start point |
1564445 |
| End point |
1562941 |
| Strand (PLUS/MINUS) |
MINUS |
| Number of clones |
19 |
| Number of EST |
29 |
| Link to clone list |
U10768 |
| List of clone(s) |
est1=SSC318F,1,494
est2=AFN717F,5,574
est3=SFE393F,7,333
est4=AFJ471F,11,574
est5=AFD556F,13,149
est6=AFI655F,13,590
est7=AFJ723F,17,578
est8=AFJ440F,19,585
est9=AFK171F,19,624
est10=AFC579F,25,495
est11=CHK177F,46,538
est12=AFJ471Z,625,1399
est13=SSL893Z,632,1443
est14=AFN717Z,673,1367
est15=AFJ440Z,675,1375
est16=AFJ723Z,675,1365
est17=AFK171Z,676,1399
est18=AFI655Z,687,1419
est19=SSF821Z,705,1443
est20=SSK530Z,711,1437
est21=SFC695Z,740,1368
est22=SFE393Z,751,1403
est23=AFC579Z,757,1399
est24=SSG238F,805,1469
est25=SSC318Z,831,1506
est26=AFF179Z,836,1329
est27=CHK177Z,860,1367
est28=SSG330Z,860,1442
est29=SLD239Z,1008,1443
|
| Translated Amino Acid sequence |
|
| Translated Amino Acid sequence (All Frames) |
|
| own update |
2004. 6.10 |
| Homology vs CSM-cDNA |
|
| dna update |
2008.11.21 |
| Homology vs DNA |
Query= Contig-U10768-1 (Contig-U10768-1Q) /CSM_Contig/Contig-U10768-1Q.Seq.d
(1513 letters)
Database: ddbj_A
92,845,959 sequences; 95,242,211,685 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value N
(AY124377) Dictyostelium discoideum citrate synthase (cshA) ... 1068 0.0 3
(C84787) Dictyostelium discoideum slug cDNA, clone SSF821. 1068 0.0 3
(BJ347083) Dictyostelium discoideum cDNA clone:dda26f02, 3' ... 1068 0.0 3
(BJ344176) Dictyostelium discoideum cDNA clone:dda18m14, 3' ... 1068 0.0 3
(C94200) Dictyostelium discoideum slug cDNA, clone SSK530. 1061 0.0 3
(BJ400352) Dictyostelium discoideum cDNA clone:dds9j23, 3' e... 1053 0.0 3
(BJ341496) Dictyostelium discoideum cDNA clone:dda6m19, 3' e... 1053 0.0 3
(BJ345534) Dictyostelium discoideum cDNA clone:dda28b05, 3' ... 1035 0.0 3
(C93947) Dictyostelium discoideum slug cDNA, clone SSL893. 1007 0.0 3
(BJ344480) Dictyostelium discoideum cDNA clone:dda19p10, 3' ... 997 0.0 3
(BJ399667) Dictyostelium discoideum cDNA clone:dds6m24, 3' e... 975 0.0 4
(BJ344545) Dictyostelium discoideum cDNA clone:dda19n18, 3' ... 975 0.0 4
(BJ345118) Dictyostelium discoideum cDNA clone:dda21m17, 3' ... 967 0.0 4
(BJ344693) Dictyostelium discoideum cDNA clone:dda20n05, 3' ... 858 0.0 4
(C94049) Dictyostelium discoideum slug cDNA, clone SSG330. 533 0.0 2
(BJ381843) Dictyostelium discoideum cDNA clone:ddc42i19, 3' ... 1007 0.0 1
(BJ327763) Dictyostelium discoideum cDNA clone:dda21m17, 5' ... 872 0.0 2
(BJ340164) Dictyostelium discoideum cDNA clone:dda11m19, 3' ... 930 0.0 1
(BJ326961) Dictyostelium discoideum cDNA clone:dda18m14, 5' ... 807 0.0 2
(BJ327174) Dictyostelium discoideum cDNA clone:dda19p10, 5' ... 797 0.0 2
(BJ329722) Dictyostelium discoideum cDNA clone:dda26f02, 5' ... 785 0.0 2
(BJ328387) Dictyostelium discoideum cDNA clone:dda28b05, 5' ... 775 0.0 2
(BJ327232) Dictyostelium discoideum cDNA clone:dda19n18, 5' ... 775 0.0 2
(BJ327370) Dictyostelium discoideum cDNA clone:dda20n05, 5' ... 775 0.0 2
(BJ367471) Dictyostelium discoideum cDNA clone:ddc42i19, 5' ... 704 0.0 2
(BJ324562) Dictyostelium discoideum cDNA clone:dda6m19, 5' e... 618 0.0 2
(AU052390) Dictyostelium discoideum slug cDNA, clone SLD239. 626 0.0 2
(C84821) Dictyostelium discoideum slug cDNA, clone SSG238. 571 0.0 2
(AU051884) Dictyostelium discoideum slug cDNA, clone SSC318. 450 e-148 4
(BJ388501) Dictyostelium discoideum cDNA clone:dds9j23, 5' e... 268 e-102 2
(AU073138) Dictyostelium discoideum slug cDNA, clone SSG238. 317 7e-82 1
(AC115584) Dictyostelium discoideum chromosome 2 map complem... 82 6e-55 10
(AU071706) Dictyostelium discoideum slug cDNA, clone SSC318. 137 4e-46 2
(AB109907) Tetrahymena thermophila tgCS mRNA for putative ci... 101 3e-39 6
(EV832272) FTSCA64TF Tetrahymena thermophila SB210 cDNA libr... 101 9e-24 3
(EV834772) TT1D349TH Tetrahymena thermophila SB210 cDNA libr... 101 1e-23 3
(EV834773) TT1D349TV Tetrahymena thermophila SB210 cDNA libr... 101 1e-23 2
(AF310892) Dictyostelium discoideum citrate synthase (gltA) ... 76 1e-20 2
(C89713) Dictyostelium discoideum slug cDNA, clone SSG229. 76 1e-20 2
(C92167) Dictyostelium discoideum slug cDNA, clone SSD179. 76 1e-20 2
(AU062131) Dictyostelium discoideum slug cDNA, clone SLH712. 76 1e-20 2
(C91905) Dictyostelium discoideum slug cDNA, clone SSC167. 76 1e-20 2
(AL385088) Medicago truncatula EST MtBC26C06F1 : T3 end of c... 103 1e-20 2
(EJ033583) 1095454062200 Global-Ocean-Sampling_GS-26-01-01-1... 70 2e-19 3
(CT764936) Paramecium tetraurelia 5-PRIME EST from clone LK0... 66 1e-18 3
(CT793420) Paramecium tetraurelia 5-PRIME EST from clone LK0... 66 2e-18 3
(EL915550) INIT2_92_B10.g2_A006 G5 trophont cDNA (INIT2) Ich... 82 2e-18 2
(EJ569173) 1092960020257 Global-Ocean-Sampling_GS-29-01-01-1... 62 1e-17 4
(EC760729) PSE00002012 rw_mgpallid Polysphondylium pallidum ... 92 4e-17 2
(EK019047) 1092955262732 Global-Ocean-Sampling_GS-31-01-01-1... 66 3e-15 2
(EJ542721) 1092955404238 Global-Ocean-Sampling_GS-29-01-01-1... 62 8e-15 3
(CT775760) Paramecium tetraurelia 5-PRIME EST from clone LK0... 66 5e-13 2
(CT816870) Paramecium tetraurelia 5-PRIME EST from clone LK0... 66 5e-13 2
(BJ324918) Dictyostelium discoideum cDNA clone:dda8o13, 5' e... 88 1e-12 1
(EH687044) CCIM11828.b1_H06.ab1 CCI(LMS) chicory Cichorium i... 46 3e-12 4
(EK396006) 1095469521079 Global-Ocean-Sampling_GS-31-01-01-1... 56 1e-11 4
(EV231157) VV_PEa19b12.b1 Vitis vinifera cv. perlette LibA V... 70 2e-11 2
(DW068721) CLLY8509.b2_I15.ab1 CLL(XYZ) lettuce saligna Lact... 54 2e-11 3
(Z70012) Bartonella sp. gltA gene (strain N40). 52 2e-11 3
(EH680702) CCIL5550.b1_L19.ab1 CCI(LMS) chicory Cichorium in... 68 4e-11 2
(EH672389) CCIL10019.b1_E09.ab1 CCI(LMS) chicory Cichorium i... 68 5e-11 2
(EH673812) CCIL11809.b1_B02.ab1 CCI(LMS) chicory Cichorium i... 68 5e-11 2
(EG669794) RCRCE74TO Castor bean cDNA library from roots, 1.... 78 5e-11 2
(DW090773) CLPY2037.b1_J05.ab1 CLP(XYZ) lettuce perennis Lac... 68 5e-11 2
(EG672661) RCRCV15TO Castor bean cDNA library from roots, 1.... 78 5e-11 2
(EG671762) RCRA965TO Castor bean cDNA library from roots, 1.... 78 6e-11 2
(DW091163) CLPY2433.b1_B09.ab1 CLP(XYZ) lettuce perennis Lac... 68 6e-11 2
(DW093286) CLPY4538.b1_D08.ab1 CLP(XYZ) lettuce perennis Lac... 68 6e-11 2
(DW091360) CLPY2634.b1_D12.ab1 CLP(XYZ) lettuce perennis Lac... 68 6e-11 2
(DW090865) CLPY2129.b1_A06.ab1 CLP(XYZ) lettuce perennis Lac... 68 6e-11 2
(EL344317) CCEL12255.b1_N16.ab1 CCE(LMS) endive Cichorium en... 60 2e-10 3
(EJ898250) 1093018476593 Global-Ocean-Sampling_GS-30-02-01-1... 48 3e-10 3
(EJ905922) 1093018513457 Global-Ocean-Sampling_GS-30-02-01-1... 48 3e-10 3
(EL914278) INIT2_71_B07.g2_A006 G5 trophont cDNA (INIT2) Ich... 52 1e-09 3
(DT211863) N119_G12 Non embryogenic SSH library Cichorium in... 68 1e-09 2
(CV049517) EST 14834 Ripe Apricot Fruit Lambda Zap II Librar... 62 2e-09 2
(DW350568) PU1_plate27_N05 PU1 Prunus persica cDNA clone PU1... 62 2e-09 2
(CV052502) EST 11950 Half-Ripe Apricot Fruit Lambda Zap II L... 62 2e-09 2
(BU044708) PP_LEa0020E04f Peach developing fruit mesocarp Pr... 62 2e-09 2
(DY651137) PU4_plate44_A23 PU4 Prunus persica cDNA similar t... 62 2e-09 2
(AM291342) Prunus persica EST, clone Skin80F06. 62 2e-09 2
(BU040616) PP_LEa0006L02f Peach developing fruit mesocarp Pr... 62 2e-09 2
(DW094999) CLPY6118.b1_L18.ab1 CLP(XYZ) lettuce perennis Lac... 68 3e-09 2
(EJ521379) 1092955143183 Global-Ocean-Sampling_GS-29-01-01-1... 52 3e-09 2
(AM288004) Prunus persica EST, clone Skin38B04. 62 3e-09 2
(DW155455) CLVX7480.b1_P21.ab1 CLV(XYZ) lettuce virosa Lactu... 62 3e-09 2
(AJ826857) Prunus persica EST, clone S39G11. 62 3e-09 2
(DW159222) CLVY11343.b1_M04.ab1 CLV(XYZ) lettuce virosa Lact... 62 3e-09 2
(EK200459) 1095460054579 Global-Ocean-Sampling_GS-31-01-01-1... 58 3e-09 2
(FE239956) CAPG5619.rev CAPG Naegleria gruberi amoeba stage ... 46 6e-09 4
(DQ865206) Rickettsia rhipicephali strain HJ5 citrate syntha... 50 6e-09 3
(AY472038) Rickettsia sp. R300 citrate synthase (gltA) gene,... 50 7e-09 3
(EL351757) CCEL8380.b1_H08.ab1 CCE(LMS) endive Cichorium end... 60 9e-09 2
(EL350182) CCEL6516.b1_H22.ab1 CCE(LMS) endive Cichorium end... 60 1e-08 2
(EL351051) CCEL7666.b1_D22.ab1 CCE(LMS) endive Cichorium end... 60 1e-08 2
(DW087574) CLPY11067.b1_F08.ab1 CLP(XYZ) lettuce perennis La... 60 1e-08 2
(DW094439) CLPY5601.b1_A10.ab1 CLP(XYZ) lettuce perennis Lac... 60 1e-08 2
(DY832921) CTOY8842.b1_C03.ab1 CTO(XYZ) dandelion Taraxacum ... 54 1e-08 3
(CD475400) nad03-20ms3-b04 Nad03 Nuphar advena cDNA clone na... 74 2e-08 1
(Z70011) Bartonella sp. gltA gene (strain R-phy2). 52 2e-08 3
>(AY124377) Dictyostelium discoideum citrate synthase (cshA) mRNA,
complete cds.
Length = 1600
Score = 1068 bits (539), Expect(3) = 0.0
Identities = 539/539 (100%)
Strand = Plus / Plus
Query: 859 ggccgtattggatatgttaattcatatcggttccaaagagaatattccacaattcatttc 918
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 996 ggccgtattggatatgttaattcatatcggttccaaagagaatattccacaattcatttc 1055
Query: 919 agatgtaaagagcaaaaagaagaaattaatgggtttcggtcatagaatctacaaaaacta 978
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1056 agatgtaaagagcaaaaagaagaaattaatgggtttcggtcatagaatctacaaaaacta 1115
Query: 979 tgatccaagagccaagatcattcgtagagtagcttatgaagttttcgaaagtttaggtaa 1038
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1116 tgatccaagagccaagatcattcgtagagtagcttatgaagttttcgaaagtttaggtaa 1175
Query: 1039 agaaccattgattgaagtagccactgagttggagaaacaagccttggaagatgaatactt 1098
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1176 agaaccattgattgaagtagccactgagttggagaaacaagccttggaagatgaatactt 1235
Query: 1099 tgtaagcagaaaactttatccaaatgttgatttctactctggtctcatctataaagcaat 1158
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1236 tgtaagcagaaaactttatccaaatgttgatttctactctggtctcatctataaagcaat 1295
Query: 1159 gggtttcccaactgatatgttcccagttttattcactattccacgtgccgttggttggtt 1218
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1296 gggtttcccaactgatatgttcccagttttattcactattccacgtgccgttggttggtt 1355
Query: 1219 agctcattgggtagaacatttagaagatccagaaactaaaatctatcgtccacgtcaagt 1278
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1356 agctcattgggtagaacatttagaagatccagaaactaaaatctatcgtccacgtcaagt 1415
Query: 1279 ttacaaaggtgaatggtttagaaactatgtcccaatcgatggtagaccaccagctaaagt 1338
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1416 ttacaaaggtgaatggtttagaaactatgtcccaatcgatggtagaccaccagctaaagt 1475
Query: 1339 tcgttctcaggatagttattcgtctgctaccactaaaagatattcaaaagttacttctc 1397
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1476 tcgttctcaggatagttattcgtctgctaccactaaaagatattcaaaagttacttctc 1534
Score = 872 bits (440), Expect(5) = 0.0
Identities = 440/440 (100%)
Strand = Plus / Plus
Query: 184 gagacagttacagttacagataatagaaatggtaaaagctatgatttcaaaattaaaaat 243
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 166 gagacagttacagttacagataatagaaatggtaaaagctatgatttcaaaattaaaaat 225
Query: 244 gacactattaatgctttaaactttaaagaattacaattagccaaaggtgatggtggttta 303
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 226 gacactattaatgctttaaactttaaagaattacaattagccaaaggtgatggtggttta 285
Query: 304 atgatttatgatccaggtttccaaaatacagcagttgtaacatcatacattacatatatt 363
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 286 atgatttatgatccaggtttccaaaatacagcagttgtaacatcatacattacatatatt 345
Query: 364 gatggtgataaaggaattttaagatacagaggttatccaattgaagaattagcagaaaga 423
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 346 gatggtgataaaggaattttaagatacagaggttatccaattgaagaattagcagaaaga 405
Query: 424 tcaaactttttagaggttgcttatcttttaatcaatggtaacttaccaaataaatcacaa 483
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 406 tcaaactttttagaggttgcttatcttttaatcaatggtaacttaccaaataaatcacaa 465
Query: 484 ttagatggttggagtaataaaattatgactcatacttttcttcatgaaaatttggttggt 543
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 466 ttagatggttggagtaataaaattatgactcatacttttcttcatgaaaatttggttggt 525
Query: 544 cttatgaaaacatttagatatgatgctcatccaatgggtatgttaattagtactgttgca 603
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 526 cttatgaaaacatttagatatgatgctcatccaatgggtatgttaattagtactgttgca 585
Query: 604 gctttaggtactttttatcc 623
||||||||||||||||||||
Sbjct: 586 gctttaggtactttttatcc 605
Score = 137 bits (69), Expect(5) = 0.0
Identities = 69/69 (100%)
Strand = Plus / Plus
Query: 106 cttgccaatcatctttcaaaggaagaagaagaagaaaatgaattattaacttcaccagtt 165
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 88 cttgccaatcatctttcaaaggaagaagaagaagaaaatgaattattaacttcaccagtt 147
Query: 166 tctgctgat 174
|||||||||
Sbjct: 148 tctgctgat 156
Score = 123 bits (62), Expect(5) = 0.0
Identities = 62/62 (100%)
Strand = Plus / Plus
Query: 684 ccagttttatgtcgtgcattggaaattttattcattcttcatgcagatcatgaattaaat 743
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 826 ccagttttatgtcgtgcattggaaattttattcattcttcatgcagatcatgaattaaat 885
Query: 744 tg 745
||
Sbjct: 886 tg 887
Score = 115 bits (58), Expect(3) = 0.0
Identities = 58/58 (100%)
Strand = Plus / Plus
Query: 787 ccgatccatacacaagtgttgctggtgccgctggtgcattatatggtccatctcatgg 844
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 926 ccgatccatacacaagtgttgctggtgccgctggtgcattatatggtccatctcatgg 983
Score = 71.9 bits (36), Expect(5) = 0.0
Identities = 36/36 (100%)
Strand = Plus / Plus
Query: 634 ttcttgtatatgttggataaattatcagaaccagac 669
||||||||||||||||||||||||||||||||||||
Sbjct: 778 ttcttgtatatgttggataaattatcagaaccagac 813
Score = 32.2 bits (16), Expect(3) = 0.0
Identities = 16/16 (100%)
Strand = Plus / Plus
Query: 844 ggtggtgccaatgagg 859
||||||||||||||||
Sbjct: 982 ggtggtgccaatgagg 997
Score = 30.2 bits (15), Expect(5) = 0.0
Identities = 15/15 (100%)
Strand = Plus / Plus
Query: 670 ctataaaccaaatcc 684
|||||||||||||||
Sbjct: 813 ctataaaccaaatcc 827
Lambda K H
1.37 0.711 1.31
Matrix: blastn matrix:1 -3
Number of Sequences: 92845959
Number of Hits to DB: 1,597,281,804
Number of extensions: 104473177
Number of successful extensions: 11214012
Number of sequences better than 10.0: 1789
Length of query: 1513
Length of database: 95,242,211,685
Length adjustment: 24
Effective length of query: 1489
Effective length of database: 97,308,875,965
Effective search space: 144892916311885
Effective search space used: 144892916311885
X1: 11 (21.8 bits)
S2: 22 (44.1 bits)
|
| protein update |
2009. 6.28 |
| Homology vs Protein |
Query= Contig-U10768-1 (Contig-U10768-1Q) /CSM_Contig/Contig-U10768-1Q.Seq.d
(1513 letters)
Database: nrp_A
3,204,285 sequences; 1,040,966,779 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AB109907_1(AB109907|pid:none) Tetrahymena thermophila tgCS mRNA ... 239 3e-72
AK120755_1(AK120755|pid:none) Oryza sativa Japonica Group cDNA c... 238 6e-72
(P49299) RecName: Full=Citrate synthase, glyoxysomal; E... 229 1e-69
CP000096_332(CP000096|pid:none) Pelodictyon luteolum DSM 273, co... 223 3e-69
CP000607_394(CP000607|pid:none) Chlorobium phaeovibrioides DSM 2... 223 4e-69
AB334779_1(AB334779|pid:none) Glycine max mRNA for peroxisomal c... 222 1e-68
CP001110_2246(CP001110|pid:none) Pelodictyon phaeoclathratiforme... 224 2e-68
(Q9SJH7) RecName: Full=Citrate synthase 3, peroxisomal; ... 221 3e-68
AB167269_1(AB167269|pid:none) Chlorobium limicola cit gene for c... 227 7e-68
CP001099_363(CP001099|pid:none) Chlorobaculum parvum NCIB 8327, ... 227 7e-68
CR954217_232(CR954217|pid:none) Ostreococcus tauri strain OTTH05... 224 2e-67
CP000108_311(CP000108|pid:none) Chlorobium chlorochromatii CaD3,... 221 2e-67
CP000909_3729(CP000909|pid:none) Chloroflexus aurantiacus J-10-f... 217 7e-67
CP001364_4025(CP001364|pid:none) Chloroflexus sp. Y-400-fl, comp... 217 7e-67
CP000686_3403(CP000686|pid:none) Roseiflexus sp. RS-1, complete ... 216 1e-66
CP001337_3621(CP001337|pid:none) Chloroflexus aggregans DSM 9485... 216 2e-66
CP000804_571(CP000804|pid:none) Roseiflexus castenholzii DSM 139... 213 2e-65
AF310892_1(AF310892|pid:none) Dictyostelium discoideum citrate s... 234 2e-64
CP000596_228(CP000596|pid:none) Ostreococcus lucimarinus CCE9901... 214 3e-64
CP001101_1989(CP001101|pid:none) Chlorobium phaeobacteroides BS1... 216 6e-64
CP000113_3427(CP000113|pid:none) Myxococcus xanthus DK 1622, com... 210 3e-63
CP000249_82(CP000249|pid:none) Frankia sp. CcI3, complete genome. 214 1e-62
CT573213_108(CT573213|pid:none) Frankia alni str. ACN14A chromos... 214 1e-62
CP000820_7077(CP000820|pid:none) Frankia sp. EAN1pec, complete g... 212 5e-62
CP000386_1656(CP000386|pid:none) Rubrobacter xylanophilus DSM 99... 202 4e-60
AF304149_1(AF304149|pid:none) Neorickettsia helminthoeca citrate... 149 5e-60
AB190318_2(AB190318|pid:none) Uncultured bacterium bzo32-1, bzo3... 191 1e-58
CP000613_1158(CP000613|pid:none) Rhodospirillum centenum SW, com... 197 5e-57
CP000510_2465(CP000510|pid:none) Psychromonas ingrahamii 37, com... 196 5e-57
CP000697_1706(CP000697|pid:none) Acidiphilium cryptum JF-5, comp... 194 2e-56
(Q9LXS7) RecName: Full=Citrate synthase 1, peroxisomal; ... 187 2e-56
CP000453_2733(CP000453|pid:none) Alkalilimnicola ehrlichii MLHE-... 193 1e-55
AE005673_1893(AE005673|pid:none) Caulobacter crescentus CB15, co... 191 1e-55
AP009153_571(AP009153|pid:none) Gemmatimonas aurantiaca T-27 DNA... 185 2e-55
AY157738_1(AY157738|pid:none) Sinorhizobium fredii citrate synth... 191 2e-55
CP000738_1135(CP000738|pid:none) Sinorhizobium medicae WSM419, c... 190 3e-55
CP000283_2831(CP000283|pid:none) Rhodopseudomonas palustris BisB... 193 4e-55
CP001191_1583(CP001191|pid:none) Rhizobium leguminosarum bv. tri... 189 4e-55
(P20901) RecName: Full=Citrate synthase; EC=2.3.3.1; Al... 190 5e-55
DQ631551_1(DQ631551|pid:none) Acetobacter aceti strain 1023 citr... 190 5e-55
CP000133_1891(CP000133|pid:none) Rhizobium etli CFN 42, complete... 189 7e-55
AE008917_835(AE008917|pid:none) Brucella melitensis 16M chromoso... 188 9e-55
AE017223_1070(AE017223|pid:none) Brucella abortus biovar 1 str. ... 188 9e-55
AE007869_1367(AE007869|pid:none) Agrobacterium tumefaciens str. ... 188 9e-55
AM260525_822(AM260525|pid:none) Bartonella tribocorum CIP 105476... 188 1e-54
CP000544_2220(CP000544|pid:none) Halorhodospira halophila SL1, c... 186 2e-54
CP000911_1136(CP000911|pid:none) Brucella suis ATCC 23445 chromo... 187 2e-54
CP001389_1323(CP001389|pid:none) Rhizobium sp. NGR234, complete ... 187 2e-54
AP008229_1051(AP008229|pid:none) Xanthomonas oryzae pv. oryzae M... 180 2e-54
CP000250_2803(CP000250|pid:none) Rhodopseudomonas palustris HaA2... 192 2e-54
CP000633_1875(CP000633|pid:none) Agrobacterium vitis S4 chromoso... 187 2e-54
AE008922_3186(AE008922|pid:none) Xanthomonas campestris pv. camp... 178 3e-54
CP000908_4619(CP000908|pid:none) Methylobacterium extorquens PA1... 187 6e-54
CP000524_568(CP000524|pid:none) Bartonella bacilliformis KC583, ... 188 6e-54
CP000503_1718(CP000503|pid:none) Shewanella sp. W3-18-1, complet... 188 6e-54
(P51037) RecName: Full=Citrate synthase, chromosomal; E... 186 6e-54
AE009442_711(AE009442|pid:none) Xylella fastidiosa Temecula1, co... 177 6e-54
AE008923_3339(AE008923|pid:none) Xanthomonas axonopodis pv. citr... 177 6e-54
CP000085_662(CP000085|pid:none) Burkholderia thailandensis E264 ... 189 1e-53
CP000941_806(CP000941|pid:none) Xylella fastidiosa M12, complete... 177 1e-53
CP001504_745(CP001504|pid:none) Burkholderia glumae BGR1 chromos... 189 1e-53
CP001026_722(CP001026|pid:none) Burkholderia ambifaria MC40-6 ch... 189 1e-53
CP000469_1693(CP000469|pid:none) Shewanella sp. ANA-3, complete ... 187 1e-53
CP000444_1692(CP000444|pid:none) Shewanella sp. MR-7, complete g... 187 1e-53
CP001029_5120(CP001029|pid:none) Methylobacterium populi BJ001, ... 186 1e-53
(P51038) RecName: Full=Citrate synthase, plasmid; EC=2.... 184 1e-53
CP000230_1595(CP000230|pid:none) Rhodospirillum rubrum ATCC 1117... 186 2e-53
AP009386_673(AP009386|pid:none) Burkholderia multivorans ATCC 17... 188 2e-53
CP000615_1079(CP000615|pid:none) Burkholderia vietnamiensis G4 c... 188 2e-53
CP000943_619(CP000943|pid:none) Methylobacterium sp. 4-46, compl... 184 2e-53
CP000447_2331(CP000447|pid:none) Shewanella frigidimarina NCIMB ... 187 2e-53
CT005232_15(CT005232|pid:none) upland soil cluster alpha (USCalp... 182 3e-53
CP000394_896(CP000394|pid:none) Granulibacter bethesdensis CGDNI... 189 3e-53
CP000494_4229(CP000494|pid:none) Bradyrhizobium sp. BTAi1, compl... 186 3e-53
CP000472_2831(CP000472|pid:none) Shewanella piezotolerans WP3, c... 186 3e-53
AM889285_1830(AM889285|pid:none) Gluconacetobacter diazotrophicu... 184 4e-53
CP001349_1464(CP001349|pid:none) Methylobacterium nodulans ORS 2... 182 4e-53
CP001016_1390(CP001016|pid:none) Beijerinckia indica subsp. indi... 184 4e-53
CP000302_2173(CP000302|pid:none) Shewanella denitrificans OS217,... 184 6e-53
(P51034) RecName: Full=Citrate synthase; EC=2.3.3.1; &... 184 6e-53
(P94325) RecName: Full=Citrate synthase; EC=2.3.3.1; &... 185 6e-53
CP000606_1644(CP000606|pid:none) Shewanella loihica PV-4, comple... 184 6e-53
CU234118_3905(CU234118|pid:none) Bradyrhizobium sp. ORS278,compl... 184 8e-53
CP000931_2475(CP000931|pid:none) Shewanella halifaxensis HAW-EB4... 184 8e-53
CP001053_2769(CP001053|pid:none) Burkholderia phytofirmans PsJN ... 186 1e-52
CP000271_137(CP000271|pid:none) Burkholderia xenovorans LB400 ch... 186 1e-52
CP000319_1622(CP000319|pid:none) Nitrobacter hamburgensis X14, c... 183 1e-52
(P51040) RecName: Full=Citrate synthase; EC=2.3.3.1; &... 187 1e-52
U76375_1(U76375|pid:none) Bradyrhizobium japonicum citrate synth... 184 1e-52
CP000490_867(CP000490|pid:none) Paracoccus denitrificans PD1222 ... 184 1e-52
CP000851_1777(CP000851|pid:none) Shewanella pealeana ATCC 700345... 183 2e-52
AB082520_1(AB082520|pid:none) Corynebacterium efficiens gltA2 ge... 184 3e-52
CP000774_3164(CP000774|pid:none) Parvibaculum lavamentivorans DS... 180 3e-52
(Q1RGV8) RecName: Full=Citrate synthase; EC=2.3.3.1; &... 186 3e-52
CS431060_1(CS431060|pid:none) Sequence 89 from Patent EP1710313.... 184 3e-52
AM743169_3623(AM743169|pid:none) Stenotrophomonas maltophilia K2... 176 3e-52
CP000821_2813(CP000821|pid:none) Shewanella sediminis HAW-EB3, c... 182 5e-52
CU459003_710(CU459003|pid:none) Magnetospirillum gryphiswaldense... 182 7e-52
CP000644_2194(CP000644|pid:none) Aeromonas salmonicida subsp. sa... 183 7e-52
CP001154_2403(CP001154|pid:none) Laribacter hongkongensis HLHK9,... 177 7e-52
CP000890_1348(CP000890|pid:none) Coxiella burnetii RSA 331, comp... 179 1e-51
(P18789) RecName: Full=Citrate synthase; EC=2.3.3.1; &... 179 1e-51
CP001020_1319(CP001020|pid:none) Coxiella burnetii CbuK_Q154, co... 179 1e-51
CU207211_1676(CU207211|pid:none) Herminiimonas arsenicoxydans ch... 182 2e-51
CP000449_1391(CP000449|pid:none) Maricaulis maris MCS10, complet... 181 2e-51
CP000699_3186(CP000699|pid:none) Sphingomonas wittichii RW1, com... 181 2e-51
CP001612_981(CP001612|pid:none) Rickettsia africae ESF-5, comple... 184 2e-51
CP000352_2472(CP000352|pid:none) Ralstonia metallidurans CH34, c... 176 2e-51
CP000766_1320(CP000766|pid:none) Rickettsia rickettsii str. Iowa... 183 3e-51
CP000781_4387(CP000781|pid:none) Xanthobacter autotrophicus Py2,... 178 3e-51
CP000090_2300(CP000090|pid:none) Ralstonia eutropha JMP134 chrom... 176 3e-51
CP001339_1282(CP001339|pid:none) Thioalkalivibrio sp. HL-EbGR7, ... 182 4e-51
CP000510_2127(CP000510|pid:none) Psychromonas ingrahamii 37, com... 177 6e-51
CP000020_811(CP000020|pid:none) Vibrio fischeri ES114 chromosome... 178 6e-51
AB297808_1(AB297808|pid:none) Rickettsia asiatica gltA gene for ... 182 6e-51
AB297810_1(AB297810|pid:none) Rickettsia asiatica gltA gene for ... 182 6e-51
AE002098_921(AE002098|pid:none) Neisseria meningitidis MC58, com... 176 8e-51
(P51042) RecName: Full=Citrate synthase; EC=2.3.3.1; &... 181 1e-50
CP001100_611(CP001100|pid:none) Chloroherpeton thalassium ATCC 3... 182 1e-50
CU633749_2072(CU633749|pid:none) Cupriavidus taiwanensis str. LM... 174 1e-50
CP000431_4943(CP000431|pid:none) Rhodococcus jostii RHA1, comple... 178 1e-50
CP000661_3063(CP000661|pid:none) Rhodobacter sphaeroides ATCC 17... 179 1e-50
AY743327_1(AY743327|pid:none) Rickettsia japonica GltA (gltA) ge... 181 1e-50
(P20902) RecName: Full=Citrate synthase; EC=2.3.3.1; &... 174 1e-50
AB444098_1(AB444098|pid:none) Rickettsia sp. GRA-1 gltA gene for... 181 1e-50
AB359458_1(AB359458|pid:none) Rickettsia sp. TCM1 gltA gene for ... 181 1e-50
AF178035_1(AF178035|pid:none) Rickettsia sp. BJ-90 citrate synth... 181 1e-50
DQ365803_1(DQ365803|pid:none) Rickettsia raoultii strain Marne c... 181 2e-50
AY578115_1(AY578115|pid:none) Candidatus Rickettsia principis fr... 181 2e-50
AF503167_1(AF503167|pid:none) Candidatus Rickettsia tarasevichia... 180 2e-50
CP000083_2157(CP000083|pid:none) Colwellia psychrerythraea 34H, ... 178 2e-50
AF191033_1(AF191033|pid:none) Mycobacterium smegmatis citrate sy... 176 3e-50
CP000031_2111(CP000031|pid:none) Ruegeria pomeroyi DSS-3, comple... 175 3e-50
DQ365806_1(DQ365806|pid:none) Candidatus Rickettsia kulagini str... 180 3e-50
BA000030_5337(BA000030|pid:none) Streptomyces avermitilis MA-468... 182 4e-50
AE016827_2371(AE016827|pid:none) Mannheimia succiniciproducens M... 173 4e-50
CP000854_4572(CP000854|pid:none) Mycobacterium marinum M, comple... 173 5e-50
CP000713_255(CP000713|pid:none) Psychrobacter sp. PRwf-1, comple... 173 5e-50
AL646052_1990(AL646052|pid:none) Ralstonia solanacearum GMI1000 ... 174 6e-50
CP000667_2102(CP000667|pid:none) Salinispora tropica CNB-440, co... 174 6e-50
AP009044_956(AP009044|pid:none) Corynebacterium glutamicum R DNA... 176 8e-50
CP000462_1871(CP000462|pid:none) Aeromonas hydrophila subsp. hyd... 176 8e-50
CP001103_1854(CP001103|pid:none) Alteromonas macleodii 'Deep eco... 176 8e-50
CR543861_2608(CR543861|pid:none) Acinetobacter sp. ADP1 complete... 172 8e-50
DQ168981_1(DQ168981|pid:none) Rickettsia tarasevichiae strain Us... 178 8e-50
CP000362_2989(CP000362|pid:none) Roseobacter denitrificans OCh 1... 173 1e-49
CP000514_1132(CP000514|pid:none) Marinobacter aquaeolei VT8, com... 170 1e-49
AF210692_1(AF210692|pid:none) Rickettsia sp. California 2 citrat... 177 1e-49
CP000436_967(CP000436|pid:none) Haemophilus somnus 129PT, comple... 174 2e-49
(P51041) RecName: Full=Citrate synthase; EC=2.3.3.1; Fl... 177 2e-49
DQ402514_1(DQ402514|pid:none) Candidatus Rickettsia uilenbergi c... 177 2e-49
CP000655_759(CP000655|pid:none) Polynucleobacter necessarius sub... 172 2e-49
FM954972_2130(FM954972|pid:none) Vibrio splendidus LGP32 chromos... 173 2e-49
AE016825_1070(AE016825|pid:none) Chromobacterium violaceum ATCC ... 170 3e-49
(Q10530) RecName: Full=Citrate synthase 1; EC=2.3.3.1; ... 171 3e-49
AE016958_829(AE016958|pid:none) Mycobacterium avium subsp. parat... 172 4e-49
AM408590_950(AM408590|pid:none) Mycobacterium bovis BCG Pasteur ... 170 4e-49
CP000850_2206(CP000850|pid:none) Salinispora arenicola CNS-205, ... 172 4e-49
CP000474_2673(CP000474|pid:none) Arthrobacter aurescens TC1, com... 173 5e-49
CP000325_213(CP000325|pid:none) Mycobacterium ulcerans Agy99, co... 169 5e-49
AF394896_1(AF394896|pid:none) Rickettsia tamurae strain AT-1 cit... 175 7e-49
CP000947_1400(CP000947|pid:none) Haemophilus somnus 2336, comple... 172 9e-49
U59714_1(U59714|pid:none) Rickettsia typhi Wilmington citrate sy... 175 9e-49
AY375163_1(AY375163|pid:none) Rickettsia amblyommii citrate synt... 175 9e-49
CP001577_287(CP001577|pid:none) Micromonas sp. RCC299 chromosome... 165 9e-49
(P42457) RecName: Full=Citrate synthase; EC=2.3.3.1; &... 172 1e-48
AX065419_1(AX065419|pid:none) Sequence 545 from Patent WO0100844... 172 1e-48
CR931997_426(CR931997|pid:none) Corynebacterium jeikeium K411 co... 174 1e-48
AE016822_1303(AE016822|pid:none) Leifsonia xyli subsp. xyli str.... 172 1e-48
AE017340_1502(AE017340|pid:none) Idiomarina loihiensis L2TR, com... 170 1e-48
(Q59136) RecName: Full=Citrate synthase; EC=2.3.3.1; Fl... 174 1e-48
AY375161_1(AY375161|pid:none) Rickettsia bellii citrate synthase... 174 1e-48
AM286690_1501(AM286690|pid:none) Alcanivorax borkumensis SK2, co... 169 2e-48
(Q59742) RecName: Full=Citrate synthase; EC=2.3.3.1; Fl... 174 2e-48
(Q59759) RecName: Full=Citrate synthase; EC=2.3.3.1; Fl... 174 2e-48
U59735_1(U59735|pid:none) Rickettsia sp. Strain S citrate syntha... 174 2e-48
EF219460_1(EF219460|pid:none) Rickettsia sp. IG-1 citrate syntha... 174 2e-48
(Q59732) RecName: Full=Citrate synthase; EC=2.3.3.1; Fl... 174 2e-48
AM942444_1557(AM942444|pid:none) Corynebacterium urealyticum DSM... 172 2e-48
CP000454_2789(CP000454|pid:none) Arthrobacter sp. FB24, complete... 171 2e-48
U59712_1(U59712|pid:none) Rickettsia sp. AB bacterium citrate sy... 173 2e-48
AF140706_1(AF140706|pid:none) Rickettsia sp. IRS3 citrate syntha... 173 3e-48
CP000284_61(CP000284|pid:none) Methylobacillus flagellatus KT, c... 169 3e-48
CR954246_1612(CR954246|pid:none) Pseudoalteromonas haloplanktis ... 169 3e-48
(P51039) RecName: Full=Citrate synthase; EC=2.3.3.1; Fl... 176 3e-48
EF219463_1(EF219463|pid:none) Rickettsia sp. TwKM01 citrate synt... 173 3e-48
CS431062_1(CS431062|pid:none) Sequence 91 from Patent EP1710313.... 171 4e-48
AF394897_1(AF394897|pid:none) Rickettsia sp. DT1 citrate synthas... 172 4e-48
AY362703_1(AY362703|pid:none) Rickettsia bellii citrate synthase... 172 4e-48
CP001010_902(CP001010|pid:none) Polynucleobacter necessarius sub... 167 6e-48
BX248356_64(BX248356|pid:none) Corynebacterium diphtheriae gravi... 170 6e-48
CR628336_1373(CR628336|pid:none) Legionella pneumophila str. Par... 162 6e-48
AE017354_1389(AE017354|pid:none) Legionella pneumophila subsp. p... 162 6e-48
AF120027_1(AF120027|pid:none) Rickettsia sp. DnS28 strain DnS28 ... 172 6e-48
CP000471_887(CP000471|pid:none) Magnetococcus sp. MC-1, complete... 172 7e-48
CP001616_2198(CP001616|pid:none) Tolumonas auensis DSM 9187, com... 164 8e-48
(Q59730) RecName: Full=Citrate synthase; EC=2.3.3.1; Fl... 175 8e-48
U59730_1(U59730|pid:none) Rickettsia conorii Seven citrate synth... 172 8e-48
AM711867_2196(AM711867|pid:none) Clavibacter michiganensis subsp... 169 1e-47
FM211057_109(FM211057|pid:none) Photorhabdus asymbiotica subsp. ... 167 1e-47
CP001321_2001(CP001321|pid:none) Haemophilus parasuis SH0165, co... 166 1e-47
(P14165) RecName: Full=Citrate synthase; EC=2.3.3.1; &... 162 1e-47
M29728_1(M29728|pid:none) P.aeruginosa NADH-sensitive citrate sy... 162 1e-47
CP001601_765(CP001601|pid:none) Corynebacterium aurimucosum ATCC... 172 2e-47
U59729_1(U59729|pid:none) Rickettsia rickettsii R (Bitterroot) c... 171 2e-47
BX571863_215(BX571863|pid:none) Photorhabdus luminescens subsp. ... 166 3e-47
EU359285_1(EU359285|pid:none) Rickettsia helvetica isolate 20-2 ... 169 4e-47
CP000656_1713(CP000656|pid:none) Mycobacterium gilvum PYR-GCK, c... 163 5e-47
CP001157_2880(CP001157|pid:none) Azotobacter vinelandii DJ, comp... 162 5e-47
AP008957_4612(AP008957|pid:none) Rhodococcus erythropolis PR4 DN... 169 6e-47
CP000749_2774(CP000749|pid:none) Marinomonas sp. MWYL1, complete... 164 8e-47
CP000712_1639(CP000712|pid:none) Pseudomonas putida F1, complete... 161 8e-47
AE015451_4141(AE015451|pid:none) Pseudomonas putida KT2440 compl... 161 8e-47
EU359286_1(EU359286|pid:none) Rickettsia helvetica isolate 21-2 ... 168 8e-47
CP000155_4527(CP000155|pid:none) Hahella chejuensis KCTC 2396, c... 162 1e-46
EU359287_1(EU359287|pid:none) Rickettsia helvetica isolate 41-2 ... 168 1e-46
CP000822_2377(CP000822|pid:none) Citrobacter koseri ATCC BAA-895... 165 2e-46
CP000949_3494(CP000949|pid:none) Pseudomonas putida W619, comple... 159 2e-46
DQ513391_1(DQ513391|pid:none) Ehrlichia ruminantium strain Mara8... 164 2e-46
DQ513394_1(DQ513394|pid:none) Ehrlichia ruminantium strain Sanka... 164 2e-46
DQ513396_1(DQ513396|pid:none) Ehrlichia ruminantium strain Seneg... 164 2e-46
DQ513395_1(DQ513395|pid:none) Ehrlichia ruminantium strain Pokoa... 164 2e-46
AF304146_1(AF304146|pid:none) Cowdria ruminantium citrate syntha... 164 2e-46
CP000964_3770(CP000964|pid:none) Klebsiella pneumoniae 342, comp... 164 3e-46
DQ513393_1(DQ513393|pid:none) Ehrlichia ruminantium strain Blaau... 163 4e-46
CP000680_2489(CP000680|pid:none) Pseudomonas mendocina ymp, comp... 158 5e-46
AM181176_1774(AM181176|pid:none) Pseudomonas fluorescens SBW25 c... 158 5e-46
CP000076_1687(CP000076|pid:none) Pseudomonas fluorescens Pf-5, c... 158 5e-46
CP000094_1608(CP000094|pid:none) Pseudomonas fluorescens Pf0-1, ... 158 5e-46
AM398681_1272(AM398681|pid:none) Flavobacterium psychrophilum JI... 165 7e-46
CP000783_2558(CP000783|pid:none) Enterobacter sakazakii ATCC BAA... 163 7e-46
CP000653_1212(CP000653|pid:none) Enterobacter sp. 638, complete ... 163 7e-46
(P0ABH7) RecName: Full=Citrate synthase; EC=2.3.3.1; &... 163 9e-46
CU928162_669(CU928162|pid:none) Escherichia coli ED1a chromosome... 163 9e-46
A99722(A99722) citrate synthase [imported] - Escherichia coli (s... 163 9e-46
AE005174_744(AE005174|pid:none) Escherichia coli O157:H7 EDL933,... 163 9e-46
DQ513397_1(DQ513397|pid:none) Ehrlichia ruminantium strain Kumm1... 162 9e-46
CP000542_1370(CP000542|pid:none) Verminephrobacter eiseniae EF01... 173 1e-45
CP001079_821(CP001079|pid:none) Anaplasma marginale str. Florida... 161 1e-45
AM942759_557(AM942759|pid:none) Proteus mirabilis strain HI4320,... 160 1e-45
AE016853_2155(AE016853|pid:none) Pseudomonas syringae pv. tomato... 158 1e-45
AF304139_1(AF304139|pid:none) Anaplasma marginale South Idaho ci... 161 1e-45
DQ513392_1(DQ513392|pid:none) Ehrlichia ruminantium strain Ball3... 162 1e-45
CP000267_1763(CP000267|pid:none) Rhodoferax ferrireducens T118, ... 159 1e-45
CP000511_4943(CP000511|pid:none) Mycobacterium vanbaalenii PYR-1... 158 1e-45
AE017283_2213(AE017283|pid:none) Propionibacterium acnes KPA1712... 163 2e-45
CP000880_2135(CP000880|pid:none) Salmonella enterica subsp. ariz... 162 2e-45
CP000266_578(CP000266|pid:none) Shigella flexneri 5 str. 8401, c... 162 2e-45
AE017220_736(AE017220|pid:none) Salmonella enterica subsp. enter... 161 3e-45
CU928158_2304(CU928158|pid:none) Escherichia fergusonii ATCC 354... 161 3e-45
AL954747_2375(AL954747|pid:none) Nitrosomonas europaea ATCC 1971... 161 3e-45
CP000685_365(CP000685|pid:none) Flavobacterium johnsoniae UW101,... 162 3e-45
CP000439_1587(CP000439|pid:none) Francisella tularensis subsp. n... 163 4e-45
EU839565_1(EU839565|pid:none) Mycobacterium lepromatosis citrate... 157 4e-45
CP000884_2413(CP000884|pid:none) Delftia acidovorans SPH-1, comp... 157 6e-45
DQ092215_1(DQ092215|pid:none) Rickettsia sp. IM32a citrate synth... 184 7e-45
CP000304_1836(CP000304|pid:none) Pseudomonas stutzeri A1501, com... 154 1e-44
AF304143_1(AF304143|pid:none) Ehrlichia canis Oklahoma citrate s... 162 1e-44
AF304145_1(AF304145|pid:none) Ehrlichia sp. Yamaguchi citrate sy... 160 1e-44
AM286415_2806(AM286415|pid:none) Yersinia enterocolitica subsp. ... 157 1e-44
AE014613_2015(AE014613|pid:none) Salmonella enterica subsp. ente... 159 2e-44
AF304136_1(AF304136|pid:none) Ehrlichia sp. 'HGE agent' Webster ... 166 2e-44
AF304138_1(AF304138|pid:none) Ehrlichia phagocytophila 1602 citr... 166 2e-44
AM233362_1788(AM233362|pid:none) Francisella tularensis subsp. h... 160 4e-44
CP000285_1202(CP000285|pid:none) Chromohalobacter salexigens DSM... 157 5e-44
CU458896_933(CU458896|pid:none) Mycobacterium abscessus chromoso... 155 5e-44
CP000768_1687(CP000768|pid:none) Campylobacter jejuni subsp. doy... 155 6e-44
AF311966_1(AF311966|pid:none) Ehrlichia sp. EHt224 citrate synth... 156 8e-44
AJ269521_1(AJ269521|pid:none) Male-killing Rickettsia from Adali... 158 8e-44
EF077650_1(EF077650|pid:none) Israeli tick typhus rickettsia str... 158 8e-44
DQ836220_1(DQ836220|pid:none) Uncultured Rickettsia sp. clone Tu... 181 8e-44
CP000608_116(CP000608|pid:none) Francisella tularensis subsp. tu... 158 1e-43
CP000915_114(CP000915|pid:none) Francisella tularensis subsp. me... 158 1e-43
AJ269522_1(AJ269522|pid:none) Male-killing Rickettsia from Adali... 157 1e-43
U76908_1(U76908|pid:none) Rickettsia sp. citrate synthase (gltA)... 157 1e-43
AJ269520_1(AJ269520|pid:none) Male-killing Rickettsia from Adali... 157 1e-43
EF177484_1(EF177484|pid:none) Israeli tick typhus rickettsia str... 157 2e-43
CR522870_1088(CR522870|pid:none) Desulfotalea psychrophila LSv54... 161 2e-43
AE017282_803(AE017282|pid:none) Methylococcus capsulatus str. Ba... 162 2e-43
AF311965_1(AF311965|pid:none) Ehrlichia sp. ERm58 citrate syntha... 154 5e-43
CP001087_3785(CP001087|pid:none) Desulfobacterium autotrophicum ... 160 7e-43
BX294144_201(BX294144|pid:none) Rhodopirellula baltica SH 1 comp... 155 9e-43
DQ836217_1(DQ836217|pid:none) Uncultured Rickettsia sp. clone Tu... 177 1e-42
DQ363995_1(DQ363995|pid:none) Ehrlichia sp. P-Mtn citrate syntha... 149 2e-42
CP001322_4936(CP001322|pid:none) Desulfatibacillum alkenivorans ... 154 6e-42
CP000777_989(CP000777|pid:none) Leptospira biflexa serovar Patoc... 158 7e-42
AF332584_1(AF332584|pid:none) Wolbachia pipientis citrate syntha... 155 1e-41
EF451001_1(EF451001|pid:none) Rickettsia sp. 'Argentina' citrate... 150 1e-41
EU567181_1(EU567181|pid:none) Rickettsia bellii strain Pontal ci... 150 1e-41
AY189819_1(AY189819|pid:none) Rickettsia rickettsii strain Hlp#2... 173 1e-41
AB204438_1(AB204438|pid:none) Uncultured Rickettsia sp. gene for... 173 1e-41
AB204450_1(AB204450|pid:none) Uncultured Rickettsia sp. gene for... 173 1e-41
AM999887_982(AM999887|pid:none) Wolbachia endosymbiont of Culex ... 155 2e-41
EF102236_1(EF102236|pid:none) Rickettsia parkeri strain At24 cit... 150 2e-41
AF478130_1(AF478130|pid:none) Anaplasma platys RDC citrate synth... 155 2e-41
DQ525688_1(DQ525688|pid:none) Anaplasma platys strain Dog 9 Sici... 155 2e-41
AB058782_1(AB058782|pid:none) Anaplasma platys gltA gene for cit... 155 2e-41
AY077620_1(AY077620|pid:none) Anaplasma platys isolate Okinawa c... 155 2e-41
EU516387_1(EU516387|pid:none) Anaplasma platys strain RP citrate... 155 2e-41
EU543436_1(EU543436|pid:none) Uncultured Rickettsia sp. isolate ... 172 2e-41
CP000153_2092(CP000153|pid:none) Sulfurimonas denitrificans DSM ... 149 3e-41
DQ365879_1(DQ365879|pid:none) Ehrlichia ewingii citrate synthase... 150 4e-41
FJ851108_1(FJ851108|pid:none) Uncultured Bartonella sp. clone Pd... 142 4e-41
AE017283_1408(AE017283|pid:none) Propionibacterium acnes KPA1712... 152 5e-41
CP000792_1780(CP000792|pid:none) Campylobacter concisus 13826, c... 152 6e-41
AB204497_1(AB204497|pid:none) Uncultured Rickettsia sp. gene for... 171 6e-41
EU543437_1(EU543437|pid:none) Uncultured Rickettsia sp. isolate ... 171 8e-41
AE008692_1963(AE008692|pid:none) Zymomonas mobilis subsp. mobili... 170 1e-40
FJ269035_1(FJ269035|pid:none) Rickettsia sp. Intervales citrate ... 147 2e-40
EU359299_1(EU359299|pid:none) Rickettsia helvetica isolate 73-3-... 169 2e-40
CU207366_2770(CU207366|pid:none) Gramella forsetii KT0803 comple... 156 2e-40
CP001391_822(CP001391|pid:none) Wolbachia sp. wRi, complete geno... 151 2e-40
DQ517288_1(DQ517288|pid:none) Rickettsia bellii strain An4 citra... 146 2e-40
FJ851111_1(FJ851111|pid:none) Uncultured Bartonella sp. clone Ld... 140 3e-40
AE017196_1032(AE017196|pid:none) Wolbachia endosymbiont of Droso... 150 4e-40
BX950851_4094(BX950851|pid:none) Erwinia carotovora subsp. atros... 151 5e-40
AF214557_1(AF214557|pid:none) Bartonella vinsonii subsp. arupens... 139 5e-40
EU810300_1(EU810300|pid:none) Gymnochlora stellata citrate synth... 168 5e-40
EU359293_1(EU359293|pid:none) Rickettsia helvetica isolate 41-3 ... 168 5e-40
DQ865206_1(DQ865206|pid:none) Rickettsia rhipicephali strain HJ5... 145 6e-40
FJ851112_1(FJ851112|pid:none) Uncultured Bartonella sp. clone Gs... 138 7e-40
FJ851114_1(FJ851114|pid:none) Uncultured Bartonella sp. clone Pd... 138 7e-40
CP000776_1457(CP000776|pid:none) Campylobacter hominis ATCC BAA-... 149 8e-40
AY515124_1(AY515124|pid:none) Bartonella rattimassiliensis strai... 138 8e-40
AE017321_731(AE017321|pid:none) Wolbachia endosymbiont strain TR... 153 1e-39
AF1834(AF1834) citrate synthase [imported] - Nostoc sp. (strain ... 151 1e-39
AJ012408_2(AJ012408|pid:none) Anabaena sp. PCC 7120 gltA gene an... 151 1e-39
AJ278186_1(AJ278186|pid:none) Bartonella schoenbuchii partial gl... 139 1e-39
AJ564633_1(AJ564633|pid:none) Bartonella schoenbuchensis partial... 139 1e-39
AP008231_912(AP008231|pid:none) Synechococcus elongatus PCC 6301... 145 2e-39
CP000100_612(CP000100|pid:none) Synechococcus elongatus PCC 7942... 145 2e-39
FJ851119_1(FJ851119|pid:none) Uncultured Bartonella sp. clone Pd... 137 2e-39
FJ851107_1(FJ851107|pid:none) Uncultured Bartonella sp. clone Mm... 137 2e-39
CP001213_1053(CP001213|pid:none) Bifidobacterium animalis subsp.... 151 3e-39
FJ851103_1(FJ851103|pid:none) Uncultured Bartonella sp. clone Lf... 136 3e-39
CP000859_26(CP000859|pid:none) Desulfococcus oleovorans Hxd3, co... 150 4e-39
FJ851110_1(FJ851110|pid:none) Uncultured Bartonella sp. clone Pd... 135 4e-39
AF304147_1(AF304147|pid:none) Ehrlichia risticii citrate synthas... 152 5e-39
AB204453_1(AB204453|pid:none) Uncultured Rickettsia sp. gene for... 164 6e-39
AF497584_1(AF497584|pid:none) Rickettsia sp. RDa420 citrate synt... 141 7e-39
DQ865204_1(DQ865204|pid:none) Rickettsia bellii strain HJ7 citra... 141 7e-39
AJ278184_1(AJ278184|pid:none) Bartonella schoenbuchii partial gl... 137 7e-39
AJ278183_1(AJ278183|pid:none) Bartonella schoenbuchii partial gl... 137 7e-39
CP000240_1860(CP000240|pid:none) Synechococcus sp. JA-2-3B'a(2-1... 149 9e-39
DQ269435_1(DQ269435|pid:none) Candidatus Rickettsia gravesii cit... 141 9e-39
EU968842_1(EU968842|pid:none) Zea mays clone 324487 unknown mRNA. 164 1e-38
AY737684_1(AY737684|pid:none) Rickettsia marmionii strain KB cit... 141 1e-38
FJ851121_1(FJ851121|pid:none) Uncultured Bartonella sp. clone Ld... 134 1e-38
FJ851122_1(FJ851122|pid:none) Uncultured Bartonella sp. clone Ld... 134 1e-38
AF516333_1(AF516333|pid:none) Rickettsia sp. RF2125 citrate synt... 140 2e-38
DQ115890_1(DQ115890|pid:none) Rickettsia rickettsii strain Taiac... 140 2e-38
FJ851117_1(FJ851117|pid:none) Uncultured Bartonella sp. clone Ld... 133 3e-38
AY259084_1(AY259084|pid:none) Rickettsia aeschlimannii citrate s... 139 3e-38
AY129301_1(AY129301|pid:none) Rickettsia slovaca citrate synthas... 139 3e-38
DQ423370_1(DQ423370|pid:none) Rickettsia mongolotimonae strain P... 139 3e-38
CP001287_1330(CP001287|pid:none) Cyanothece sp. PCC 8801, comple... 144 4e-38
AY515125_1(AY515125|pid:none) Bartonella rattimassiliensis strai... 132 6e-38
FJ851104_1(FJ851104|pid:none) Uncultured Bartonella sp. clone Mm... 132 6e-38
AF304148_1(AF304148|pid:none) Ehrlichia sennetsu Miyayama citrat... 148 8e-38
CP001291_3988(CP001291|pid:none) Cyanothece sp. PCC 7424, comple... 147 8e-38
DQ423369_1(DQ423369|pid:none) Rickettsia sp. PoTiRb169 citrate s... 138 8e-38
AE017125_1493(AE017125|pid:none) Helicobacter hepaticus ATCC 514... 145 1e-37
AJ564632_1(AJ564632|pid:none) Bartonella schoenbuchensis partial... 133 1e-37
EU111796_1(EU111796|pid:none) Bartonella rattiaustraliensis stra... 130 1e-37
Z70016_1(Z70016|pid:none) B.grahamii gltA gene (strain V2). 130 1e-37
EU111802_1(EU111802|pid:none) Bartonella queenslandensis strain ... 130 1e-37
EU111795_1(EU111795|pid:none) Bartonella rattiaustraliensis stra... 130 1e-37
AJ583120_1(AJ583120|pid:none) Bartonella sp. RP-io111 partial gl... 130 1e-37
FJ851109_1(FJ851109|pid:none) Uncultured Bartonella sp. clone Ld... 133 2e-37
AJ583112_1(AJ583112|pid:none) Bartonella sp. AN-nh1 partial gltA... 130 2e-37
AJ583114_1(AJ583114|pid:none) Bartonella sp. AN-nh3 partial gltA... 130 2e-37
AB204457_1(AB204457|pid:none) Uncultured Rickettsia sp. gene for... 159 2e-37
AY584852_1(AY584852|pid:none) Bartonella taylorii strain Far Eas... 130 2e-37
AY584853_1(AY584853|pid:none) Bartonella taylorii strain Far Eas... 130 2e-37
AY584857_1(AY584857|pid:none) Bartonella grahamii strain Far Eas... 130 2e-37
EU014272_1(EU014272|pid:none) Bartonella sp. Af1 citrate synthas... 130 2e-37
AJ583133_1(AJ583133|pid:none) Bartonella sp. TL-sv2 partial gltA... 130 2e-37
EU111793_1(EU111793|pid:none) Bartonella rattiaustraliensis stra... 130 3e-37
(P51036) RecName: Full=Citrate synthase; EC=2.3.3.1; Fl... 130 3e-37
EU111794_1(EU111794|pid:none) Bartonella rattiaustraliensis stra... 129 3e-37
AJ583122_1(AJ583122|pid:none) Bartonella sp. MN-tr1 partial gltA... 129 4e-37
AJ583116_1(AJ583116|pid:none) Bartonella sp. AN-tr2 partial gltA... 129 4e-37
AJ583118_1(AJ583118|pid:none) Bartonella sp. AN-tr103 partial gl... 129 4e-37
AK221264_1(AK221264|pid:none) Arabidopsis thaliana mRNA for puta... 158 4e-37
EU979534_1(EU979534|pid:none) Bartonella sp. Cr28649 citrate syn... 129 5e-37
EU283829_1(EU283829|pid:none) Rickettsia sp. 801a GltA (gltA) ge... 135 5e-37
AJ583129_1(AJ583129|pid:none) Bartonella sp. TL-sv1 partial gltA... 129 5e-37
AB204449_1(AB204449|pid:none) Uncultured Rickettsia sp. gene for... 158 6e-37
BA000045_3012(BA000045|pid:none) Gloeobacter violaceus PCC 7421 ... 138 6e-37
EU014274_1(EU014274|pid:none) Bartonella sp. Mo3 citrate synthas... 131 6e-37
EU111798_1(EU111798|pid:none) Bartonella queenslandensis strain ... 128 6e-37
AJ583124_1(AJ583124|pid:none) Bartonella sp. MN-ko1 partial gltA... 128 6e-37
AF191502_1(AF191502|pid:none) Bartonella taylorii citrate syntha... 131 6e-37
BX569695_84(BX569695|pid:none) Synechococcus sp. WH8102 complete... 139 8e-37
AJ583132_1(AJ583132|pid:none) Bartonella sp. SC-tr1 partial gltA... 128 8e-37
DQ788563_1(DQ788563|pid:none) Candidatus Nicolleia massiliensis ... 132 1e-36
(P51031) RecName: Full=Citrate synthase; EC=2.3.3.1; Fl... 128 2e-36
AJ583131_1(AJ583131|pid:none) Bartonella sp. TL-sv6 partial gltA... 127 2e-36
AJ583127_1(AJ583127|pid:none) Bartonella sp. MN-ga18 partial glt... 127 2e-36
AJ583119_1(AJ583119|pid:none) Bartonella sp. RP-tr109 partial gl... 127 2e-36
AY584856_1(AY584856|pid:none) Bartonella grahamii strain Far Eas... 128 2e-36
AY584855_1(AY584855|pid:none) Bartonella grahamii strain Far Eas... 128 2e-36
Z70012_1(Z70012|pid:none) Bartonella sp. gltA gene (strain N40). 128 2e-36
AJ583128_1(AJ583128|pid:none) Bartonella sp. MN-ga8 partial gltA... 127 2e-36
CT978603_2276(CT978603|pid:none) Synechococcus sp. RCC307 genomi... 135 3e-36
EU111803_1(EU111803|pid:none) Bartonella coopersplainensis strai... 126 3e-36
EU430260_1(EU430260|pid:none) Rickettsia sp. 60a3 citrate syntha... 132 3e-36
AF176091_1(AF176091|pid:none) Bartonella koehlerae citrate synth... 128 4e-36
EU567177_1(EU567177|pid:none) Rickettsia sp. NOD citrate synthas... 132 5e-36
(Q59258) RecName: Full=Citrate synthase; EC=2.3.3.1; Fl... 130 5e-36
EU014269_1(EU014269|pid:none) Bartonella sp. Mo2 citrate synthas... 126 5e-36
CP000361_300(CP000361|pid:none) Arcobacter butzleri RM4018, comp... 139 7e-36
DQ191466_1(DQ191466|pid:none) Rickettsia tarasevichiae isolate D... 131 9e-36
EU665235_1(EU665235|pid:none) Rickettsia monacensis citrate synt... 131 9e-36
BX548175_2598(BX548175|pid:none) Prochlorococcus marinus MIT9313... 131 1e-35
AY584854_1(AY584854|pid:none) Bartonella grahamii strain Far Eas... 125 2e-35
AM449368_1(AM449368|pid:none) Vitis vinifera contig VV78X115537.... 153 2e-35
FM955315_1(FM955315|pid:none) Rickettsia endosymbiont of Deronec... 153 2e-35
AM260522_34(AM260522|pid:none) Helicobacter acinonychis str. She... 143 2e-35
CP000393_1330(CP000393|pid:none) Trichodesmium erythraeum IMS101... 135 2e-35
DQ124930_1(DQ124930|pid:none) Rickettsia sibirica citrate syntha... 130 2e-35
EU665236_1(EU665236|pid:none) Rickettsia monacensis citrate synt... 130 2e-35
BX548174_168(BX548174|pid:none) Prochlorococcus marinus MED4 com... 132 3e-35
CP001072_24(CP001072|pid:none) Helicobacter pylori Shi470, compl... 142 3e-35
CP001173_23(CP001173|pid:none) Helicobacter pylori G27, complete... 142 3e-35
(P56062) RecName: Full=Citrate synthase; EC=2.3.3.1; &... 142 3e-35
CP001217_22(CP001217|pid:none) Helicobacter pylori P12, complete... 143 4e-35
AM778914_28(AM778914|pid:none) Microcystis aeruginosa PCC 7806 g... 137 4e-35
CP000552_191(CP000552|pid:none) Prochlorococcus marinus str. MIT... 131 4e-35
CP000435_2575(CP000435|pid:none) Synechococcus sp. CC9311, compl... 132 6e-35
DQ150692_1(DQ150692|pid:none) Rickettsia rickettsii strain 1995H... 129 6e-35
CP000241_25(CP000241|pid:none) Helicobacter pylori HPAG1, comple... 142 7e-35
AY902183_1(AY902183|pid:none) Bartonella sp. RR0048-2G citrate s... 122 7e-35
AE017126_185(AE017126|pid:none) Prochlorococcus marinus subsp. m... 130 1e-34
DQ372954_1(DQ372954|pid:none) Candidatus Rickettsia antechini ci... 128 1e-34
CP000576_182(CP000576|pid:none) Prochlorococcus marinus str. MIT... 130 1e-34
CP000878_179(CP000878|pid:none) Prochlorococcus marinus str. MIT... 129 1e-34
Z70019_1(Z70019|pid:none) Bartonella sp. gltA gene (strain C4phy). 121 1e-34
AY094144_1(AY094144|pid:none) Rhizobium rhizogenes strain K-Ag-3... 121 1e-34
CP000825_180(CP000825|pid:none) Prochlorococcus marinus str. MIT... 129 2e-34
EF031549_1(EF031549|pid:none) Bartonella sp. F citrate synthase ... 120 2e-34
AY094149_1(AY094149|pid:none) Rhizobium galegae citrate synthase... 120 3e-34
EF689743_1(EF689743|pid:none) Francisella sp. TX119 GltA gene, p... 144 3e-34
FM955313_1(FM955313|pid:none) Rickettsia endosymbiont of Deronec... 149 3e-34
CP000111_172(CP000111|pid:none) Prochlorococcus marinus str. MIT... 128 5e-34
BA000023_641(BA000023|pid:none) Sulfolobus tokodaii str. 7 DNA, ... 132 5e-34
AY454538_1(AY454538|pid:none) Bartonella sp. sa192up GltA (gltA)... 119 5e-34
AY902182_1(AY902182|pid:none) Bartonella sp. RR0051-2G citrate s... 119 5e-34
AY094151_1(AY094151|pid:none) Rhizobium etli strain CFN234 citra... 117 5e-34
AY094148_1(AY094148|pid:none) Mesorhizobium mediterraneum citrat... 119 1e-33
EF031547_1(EF031547|pid:none) Bartonella sp. WHF018 citrate synt... 118 1e-33
CP000097_277(CP000097|pid:none) Synechococcus sp. CC9902, comple... 130 1e-33
CT971583_2292(CT971583|pid:none) Synechococcus WH7803 complete g... 127 1e-33
AJ564635_1(AJ564635|pid:none) Bartonella schoenbuchensis partial... 119 1e-33
EU014266_1(EU014266|pid:none) Bartonella grahamii citrate syntha... 117 1e-33
AY902180_1(AY902180|pid:none) Bartonella sp. RR0067-2G citrate s... 117 1e-33
AY094147_1(AY094147|pid:none) Mesorhizobium huakuii citrate synt... 116 1e-33
CP000127_2527(CP000127|pid:none) Nitrosococcus oceani ATCC 19707... 128 2e-33
BX571856_1737(BX571856|pid:none) Staphylococcus aureus subsp. au... 131 2e-33
AJ938182_1554(AJ938182|pid:none) Staphylococcus aureus RF122 com... 131 2e-33
AF022817_1(AF022817|pid:none) Rickettsia honei citrate synthase ... 125 2e-33
EU488797_1(EU488797|pid:none) Rhizobium tropici strain 233 GltA ... 117 2e-33
CP000828_3898(CP000828|pid:none) Acaryochloris marina MBIC11017,... 134 3e-33
AY454540_1(AY454540|pid:none) Bartonella sp. ma106up GltA (gltA)... 116 4e-33
AY902181_1(AY902181|pid:none) Bartonella sp. RR0060-2G citrate s... 116 4e-33
AY902184_1(AY902184|pid:none) Bartonella sp. RR0042-1G citrate s... 115 4e-33
CP000029_1231(CP000029|pid:none) Staphylococcus epidermidis RP62... 130 5e-33
EU488794_1(EU488794|pid:none) Sinorhizobium sp. 206 GltA gene, p... 116 5e-33
EU488801_1(EU488801|pid:none) Rhizobium tropici strain PRF 35 Gl... 115 5e-33
EU488795_1(EU488795|pid:none) Rhizobium tropici strain 77 GltA g... 115 7e-33
CP000094_1764(CP000094|pid:none) Pseudomonas fluorescens Pf0-1, ... 96 9e-33
AM270183_52(AM270183|pid:none) Aspergillus niger contig An08c028... 128 1e-32
BT042957_1(BT042957|pid:none) Zea mays full-length cDNA clone ZM... 127 1e-32
AE015929_1371(AE015929|pid:none) Staphylococcus epidermidis ATCC... 128 1e-32
U41752_1(U41752|pid:none) Rickettsia akari citrate synthase gene... 143 2e-32
EF531339_249(EF531339|pid:none) Candidatus Chloracidobacterium t... 122 2e-32
DQ105664_1(DQ105664|pid:none) Rickettsia helvetica citrate synth... 142 2e-32
AY445820_1(AY445820|pid:none) Rickettsia sp. TwKM02 citrate synt... 142 3e-32
DQ192515_1(DQ192515|pid:none) Bartonella sp. Q52SHD citrate synt... 141 5e-32
EF682090_1(EF682090|pid:none) Candidatus Bartonella rudakovii is... 114 5e-32
FJ464163_1(FJ464163|pid:none) Bartonella sp. Q80SHD citrate synt... 141 7e-32
DQ909073_1(DQ909073|pid:none) Rickettsia japonica citrate syntha... 141 7e-32
DQ821857_1(DQ821857|pid:none) Rickettsia helvetica strain PoTiR4... 141 7e-32
AJ439406_1(AJ439406|pid:none) Bartonella henselae partial gltA g... 113 9e-32
FJ666762_1(FJ666762|pid:none) Rickettsia endosymbiont of Subcocc... 117 9e-32
FJ655397_1(FJ655397|pid:none) Bartonella sp. Tg18773 citrate syn... 140 9e-32
DQ910783_1(DQ910783|pid:none) Rickettsia sp. PoTiR1dt citrate sy... 140 9e-32
FJ667570_1(FJ667570|pid:none) Bartonella sp. KM2563 citrate synt... 140 9e-32
EF605279_1(EF605279|pid:none) Bartonella tamiae strain Th307 cit... 140 9e-32
FJ666758_1(FJ666758|pid:none) Rickettsia endosymbiont of Brachys... 117 1e-31
FJ666759_1(FJ666759|pid:none) Rickettsia endosymbiont of Chrysop... 117 1e-31
CP000561_550(CP000561|pid:none) Pyrobaculum calidifontis JCM 115... 119 2e-31
FJ666755_1(FJ666755|pid:none) Rickettsia endosymbiont of Bombyli... 117 2e-31
FJ589059_1(FJ589059|pid:none) Bartonella sp. RT246YN citrate syn... 140 2e-31
DQ821854_1(DQ821854|pid:none) Israeli tick typhus rickettsia str... 140 2e-31
AY902188_1(AY902188|pid:none) Bartonella sp. RR002-1E citrate sy... 140 2e-31
AY445819_1(AY445819|pid:none) Rickettsia sp. TwKM01 citrate synt... 140 2e-31
DQ821852_1(DQ821852|pid:none) Rickettsia slovaca strain PotiR30 ... 140 2e-31
CP001400_2538(CP001400|pid:none) Sulfolobus islandicus M.14.25, ... 130 2e-31
AY548828_1(AY548828|pid:none) Rickettsia sp. D025 citrate syntha... 139 2e-31
>AB109907_1(AB109907|pid:none) Tetrahymena thermophila tgCS mRNA for
putative citrate synthase, complete cds.
Length = 480
Score = 239 bits (610), Expect(2) = 3e-72
Identities = 115/173 (66%), Positives = 135/173 (78%)
Frame = +2
Query: 860 AVLDMLIHIGSKENIPQFISDVKSKKKKLMGFGHRIYKNYDPRAKIIRRVAYEVFESLGK 1039
AVL ML IG +NIP FI VK++K L GFGHR+YKNYDPRAKI+++ AYEVFE GK
Sbjct: 300 AVLRMLEQIGDVKNIPSFIDKVKNRKALLFGFGHRVYKNYDPRAKIVKKTAYEVFEICGK 359
Query: 1040 EPLIEVATELEKQALEDEYFVSRKLYPNVDFYSGLIYKAMGFPTDMFPVLFTIPRAVGWL 1219
EPLIE+A ELEK ALEDE+F+ RKLYPNVDFYSG+IY+AMGFPTDMFPVLFTIPR GWL
Sbjct: 360 EPLIEIAIELEKIALEDEFFIKRKLYPNVDFYSGVIYRAMGFPTDMFPVLFTIPRVAGWL 419
Query: 1220 AHWVEHLEDPETKIYRPRQVYKGEWFRNYVPIDGRPPAKVRSQDSYSSATTKR 1378
AHWVE+L+D E I RPRQ Y G R+YVP++ R AK + S SS + +R
Sbjct: 420 AHWVEYLDDKENNIVRPRQNYVGYAKRDYVPMEQRQEAKFNLESSKSSTSKRR 472
Score = 58.2 bits (139), Expect(2) = 3e-72
Identities = 30/54 (55%), Positives = 37/54 (68%)
Frame = +3
Query: 684 PVLCRALEILFILHADHELNWSTRCNGALFHQPGPDPYTSVAGAAGALYGPSHG 845
P L +AL+ILFILHA+HE+N ST L G D Y+ +AG+A ALYGP HG
Sbjct: 243 PKLAKALDILFILHAEHEMNCSTAFVRHL-ASSGVDVYSCIAGSAAALYGPKHG 295
Score = 170 bits (431), Expect = 1e-40
Identities = 88/153 (57%), Positives = 113/153 (73%), Gaps = 4/153 (2%)
Frame = +1
Query: 178 KKETVTVTDNRNGKSYDFKIKNDT----INALNFKELQLAKGDGGLMIYDPGFQNTAVVT 345
+KE TVTDNRNGK+Y+ I+N I A + +++ A+G+ L +YDPG+ NT V T
Sbjct: 18 EKEYYTVTDNRNGKTYEVPIRNSREGRYIMAKDIGKIKDAEGNV-LRVYDPGYMNTIVNT 76
Query: 346 SYITYIDGDKGILRYRGYPIEELAERSNFLEVAYLLINGNLPNKSQLDGWSNKIMTHTFL 525
S I YIDGD G+L YRG PIE+LAE+S FLEVAYLLI G LP K+Q + ++ +I HTFL
Sbjct: 77 SRICYIDGDLGVLEYRGIPIEQLAEKSTFLEVAYLLIYGELPTKTQFEEFNQRISGHTFL 136
Query: 526 HENLVGLMKTFRYDAHPMGMLISTVAALGTFYP 624
H +++ +MK FRYDAHPMGMLIST+AAL TF P
Sbjct: 137 HTDVLQMMKHFRYDAHPMGMLISTIAALSTFRP 169
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3204285
Number of Hits to DB: 2,306,203,424
Number of extensions: 49175939
Number of successful extensions: 120152
Number of sequences better than 10.0: 1429
Number of HSP's gapped: 117502
Number of HSP's successfully gapped: 2970
Length of query: 504
Length of database: 1,040,966,779
Length adjustment: 133
Effective length of query: 371
Effective length of database: 614,796,874
Effective search space: 228089640254
Effective search space used: 228089640254
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 32 (16.9 bits)
|
| PSORT |
|
| VS (DIR, S) |
0 |
| VH (FL, L) |
0 |
| VF (FL, S) |
0 |
| AH (FL, L) |
0 |
| AF (FL, S) |
9 |
| SL (DIR, L) |
1 |
| SS (DIR, S) |
6 |
| SH (FL, L) |
0 |
| SF (FL, S) |
2 |
| CH (FL, L) |
1 |
| CF (FL, S) |
0 |
| FCL (DIR, L) |
0 |
| FC (DIR, S) |
0 |
| FC-IC (SUB) |
0 |