| Contig-U10744-1 |
| Contig ID |
Contig-U10744-1 |
| Contig update |
2002.12.18 |
| Contig sequence |
 |
| Gap |
gap included |
| Contig length |
1325 |
| Chromosome number (1..6, M) |
4 |
| Chromosome length |
5430582 |
| Start point |
1143887 |
| End point |
1145199 |
| Strand (PLUS/MINUS) |
PLUS |
| Number of clones |
12 |
| Number of EST |
22 |
| Link to clone list |
U10744 |
| List of clone(s) |
|
| Translated Amino Acid sequence |
|
| Translated Amino Acid sequence (All Frames) |
|
| own update |
2004. 6.10 |
| Homology vs CSM-cDNA |
|
| dna update |
2008.11.21 |
| Homology vs DNA |
Query= Contig-U10744-1 (Contig-U10744-1Q) /CSM_Contig/Contig-U10744-1Q.Seq.d
(1335 letters)
Database: ddbj_A
92,845,959 sequences; 95,242,211,685 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value N
(BJ446266) Dictyostelium discoideum cDNA clone:ddv62n04, 3' ... 1526 0.0 1
(AY185332) Dictyostelium discoideum Hsp70 subfamily B suppre... 1398 0.0 2
(BJ341330) Dictyostelium discoideum cDNA clone:dda6m06, 3' e... 1372 0.0 1
(BJ436611) Dictyostelium discoideum cDNA clone:ddv31o14, 3' ... 1362 0.0 1
(BJ385817) Dictyostelium discoideum cDNA clone:ddc56b10, 3' ... 1360 0.0 1
(BJ438076) Dictyostelium discoideum cDNA clone:ddv36e07, 3' ... 1289 0.0 1
(BJ379194) Dictyostelium discoideum cDNA clone:ddc34g01, 3' ... 1285 0.0 1
(BJ340886) Dictyostelium discoideum cDNA clone:dda4d07, 3' e... 1281 0.0 1
(BJ444034) Dictyostelium discoideum cDNA clone:ddv55b04, 3' ... 1233 0.0 3
(BJ381275) Dictyostelium discoideum cDNA clone:ddc41b02, 3' ... 1227 0.0 1
(BJ381061) Dictyostelium discoideum cDNA clone:ddc40p02, 3' ... 946 0.0 2
(BJ438077) Dictyostelium discoideum cDNA clone:ddv36e08, 3' ... 797 0.0 2
(AY185333) Dictyostelium discoideum Hsp70 subfamily B suppre... 729 0.0 2
(C91348) Dictyostelium discoideum slug cDNA, clone SSK108. 805 0.0 1
(BJ418116) Dictyostelium discoideum cDNA clone:ddv31o14, 5' ... 438 e-142 4
(BJ427365) Dictyostelium discoideum cDNA clone:ddv62n04, 5' ... 414 e-133 3
(BJ370995) Dictyostelium discoideum cDNA clone:ddc56b10, 5' ... 402 e-131 3
(BJ324412) Dictyostelium discoideum cDNA clone:dda6m06, 5' e... 420 e-129 3
(BJ425218) Dictyostelium discoideum cDNA clone:ddv55b04, 5' ... 408 e-127 3
(BJ323999) Dictyostelium discoideum cDNA clone:dda4d07, 5' e... 430 e-126 3
(BJ366777) Dictyostelium discoideum cDNA clone:ddc40p02, 5' ... 408 e-124 3
(BJ419496) Dictyostelium discoideum cDNA clone:ddv36e07, 5' ... 258 5e-80 3
(BJ366999) Dictyostelium discoideum cDNA clone:ddc41b02, 5' ... 244 7e-79 3
(BJ365077) Dictyostelium discoideum cDNA clone:ddc34g01, 5' ... 82 4e-13 2
(AC117072) Dictyostelium discoideum chromosome 2 map 3879572... 46 4e-04 8
(AC098221) Rattus norvegicus clone CH230-40A17, WORKING DRAF... 40 0.003 2
(AC117176) Dictyostelium discoideum chromosome 2 map 5018074... 44 0.10 9
(AC116984) Dictyostelium discoideum chromosome 2 map 2567470... 46 0.14 2
(AE014297) Drosophila melanogaster chromosome 3R, complete s... 50 0.22 1
(AC008213) Drosophila melanogaster, chromosome 3R, region 97... 50 0.22 1
(AC005813) Drosophila melanogaster, chromosome 3R, region 97... 50 0.22 1
(AL590072) Human DNA sequence from clone RP11-154J12 on chro... 50 0.22 1
(AC140731) Rattus norvegicus clone CH230-414F12, *** SEQUENC... 50 0.22 1
(AC097948) Rattus norvegicus clone CH230-128H21, *** SEQUENC... 50 0.22 1
(AC017292) Drosophila melanogaster, *** SEQUENCING IN PROGRE... 50 0.22 1
(DU071732) 63483 Tomato HindIII BAC Library Solanum lycopers... 50 0.22 1
(EG343987) SAAH-aad29e12.g1 Agen 0058 Schmidtea mediterranea... 50 0.22 1
(AA802862) GM06456.5prime GM Drosophila melanogaster ovary B... 50 0.22 1
(DY889569) CeleSEQ11476 Cunninghamella elegans pBluescript (... 38 0.28 2
(BX649330) Zebrafish DNA sequence from clone CH211-140F21 in... 46 0.31 3
(AC171134) Helobdella robusta clone CH306-1A5, complete sequ... 44 0.36 6
(CQ579119) Sequence 6877 from Patent WO0171042. 44 0.37 2
(CT030162) Mouse DNA sequence from clone RP23-92L7 on chromo... 42 0.40 3
(AF019236) Dictyostelium discoideum TipD (tipD) gene, comple... 36 0.42 3
(AC115683) Dictyostelium discoideum chromosome 2 map complem... 36 0.51 7
(BV653832) S215P60827FB1.T0 Clara Pan troglodytes troglodyte... 44 0.83 2
(AB140152) Homo sapiens DNA, STS on chromosome 8, D8S0239i, ... 48 0.86 1
(AC120788) Mus musculus chromosome 14, clone RP23-279B13, co... 48 0.86 1
(AC101821) Mus musculus chromosome 17, clone RP24-392L10, co... 48 0.86 1
(AC098726) Mus musculus BAC clone RP23-3E20 from 17, complet... 48 0.86 1
(AC093477) Mus musculus chromosome 1, clone RP23-58B6, compl... 48 0.86 1
(DJ461340) Method for analysing genome using microsatellite ... 48 0.86 1
(AC116979) Dictyostelium discoideum chromosome 2 map 6445720... 48 0.86 1
(AP006252) Homo sapiens genomic DNA, chromosome 8, clone:RP1... 48 0.86 1
(AP000082) Homo sapiens genomic DNA, chromosome 8p11.2, sene... 48 0.86 1
(AF252832) Homo sapiens chromosome 8 clone CTD-2017E4 map ce... 48 0.86 1
(AC124290) Homo sapiens chromosome 8, clone RP11-89M20, comp... 48 0.86 1
(AC124265) Homo sapiens chromosome 8, clone CTD-2017E4, comp... 48 0.86 1
(AC091045) Homo sapiens chromosome 15 clone RP11-111A22 map ... 48 0.86 1
(AC162556) Bos taurus clone CH240-121K11, WORKING DRAFT SEQU... 48 0.86 1
(AC151252) Bos taurus clone CH240-334I10, WORKING DRAFT SEQU... 48 0.86 1
(AC136990) Homo sapiens chromosome 8 clone CTD-2573F2 map 8,... 48 0.86 1
(AC135286) Rattus norvegicus clone CH230-318O11, *** SEQUENC... 48 0.86 1
(AC129941) Mus musculus clone RP24-302A8, *** SEQUENCING IN ... 48 0.86 1
(AC124077) Homo sapiens chromosome 8 clone RP11-1127N23 map ... 48 0.86 1
(AC117036) Rattus norvegicus clone CH230-188J14, WORKING DRA... 48 0.86 1
(AC114520) Rattus norvegicus clone CH230-249N20, WORKING DRA... 48 0.86 1
(AC114384) Rattus norvegicus clone CH230-293J22, *** SEQUENC... 48 0.86 1
(AC111021) Mus musculus clone RP23-89C23, WORKING DRAFT SEQU... 48 0.86 1
(AC103176) Rattus norvegicus clone CH230-98N18, WORKING DRAF... 48 0.86 1
(AC097773) Rattus norvegicus clone CH230-41C1, *** SEQUENCIN... 48 0.86 1
(CR855272) Zebrafish DNA sequence *** SEQUENCING IN PROGRESS... 48 0.86 1
(AC230403) Bos taurus clone CH240-510E2, WORKING DRAFT SEQUE... 48 0.86 1
(AC182498) Bos taurus clone CH240-135H8, *** SEQUENCING IN P... 48 0.86 1
(AC019054) Homo sapiens chromosome 15 clone RP11-111A22, WOR... 48 0.86 1
(AL225067) Tetraodon nigroviridis genome survey sequence PUC... 48 0.86 1
(AL186966) Tetraodon nigroviridis genome survey sequence PUC... 48 0.86 1
(EH672290) EW2_R1P11_A04 Earthworm SSH cDNA library Eisenia ... 48 0.86 1
(BI503918) BB170027A20G05.5 Bee Brain Normalized/Subtracted ... 48 0.86 1
(AW453437) SWOv3MCAM41D06SK Onchocerca volvulus molting L3 l... 48 0.86 1
(EY440558) CBAY4173.fwd CBAY Tubifex tubifex Embryos and juv... 48 0.86 1
(AA294024) SWOv3MCA1386SK Onchocerca volvulus molting L3 lar... 48 0.86 1
(CP000471) Magnetococcus sp. MC-1, complete genome. 48 0.86 1
(DY889443) CeleSEQ10996 Cunninghamella elegans pBluescript (... 42 0.89 2
(AR438439) Sequence 11 from patent US 6664053. 42 0.93 2
(AF033210) Pneumocystis carinii f. sp. hominis clone HuMSG33... 42 0.93 2
(EB456161) 1099341381882 12-DrosW-std-1P6Kb Drosophila willi... 46 1.1 2
(DY892778) CeleSEQ11785 Cunninghamella elegans pBluescript (... 42 1.2 2
(DQ386470) Mycoplasma hyopneumoniae strain 7422 VNTAR-contai... 36 1.3 2
(DQ386469) Mycoplasma hyopneumoniae strain PMS VNTAR-contain... 36 1.3 2
(AR547844) Sequence 2975 from patent US 6747137. 44 1.6 2
(G73273) csnpwrn-pcr31-1 Human Homo sapiens STS genomic, seq... 42 1.7 2
(AC152178) Medicago truncatula clone mth2-14b12, complete se... 32 1.8 2
(AC156260) Medicago truncatula clone mth2-124n5, complete se... 32 1.8 2
(AC202378) Medicago truncatula clone mth2-52a10, WORKING DRA... 38 1.9 4
(AC177510) Strongylocentrotus purpuratus clone R3-9I13, WORK... 44 2.2 5
(EY309965) CAWX21886.fwd CAWX Helobdella robusta Primary Ear... 32 2.3 2
(BJ342272) Dictyostelium discoideum cDNA clone:dda13p04, 3' ... 44 2.6 2
(AL844491) Mouse DNA sequence from clone RP23-173A8 on chrom... 46 2.7 2
(AC117075) Dictyostelium discoideum chromosome 2 map 5201047... 40 2.9 10
>(BJ446266) Dictyostelium discoideum cDNA clone:ddv62n04, 3' end,
single read.
Length = 803
Score = 1526 bits (770), Expect = 0.0
Identities = 773/773 (100%)
Strand = Plus / Minus
Query: 420 tcacaggtgagaatttaatcgatcgtcaagaatcaaaacttttgaaatggtatgatagca 479
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 803 tcacaggtgagaatttaatcgatcgtcaagaatcaaaacttttgaaatggtatgatagca 744
Query: 480 aacaaccntacccttatagagtgtatcgactcatttagtgttggtgaacgtttattgaat 539
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 743 aacaaccntacccttatagagtgtatcgactcatttagtgttggtgaacgtttattgaat 684
Query: 540 aaaccattcagaatgaacattagtgacgtatataaatcatcaagtaaaggttacgttgca 599
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 683 aaaccattcagaatgaacattagtgacgtatataaatcatcaagtaaaggttacgttgca 624
Query: 600 gttggtggaaagattgaagctggtttattgggtaatggtgataagattttaatttcacct 659
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 623 gttggtggaaagattgaagctggtttattgggtaatggtgataagattttaatttcacct 564
Query: 660 ggtaatgatatttgtacaattaaatccattcgtagaaataatctcgagtctgaatgggca 719
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 563 ggtaatgatatttgtacaattaaatccattcgtagaaataatctcgagtctgaatgggca 504
Query: 720 gtcggtggtgataatgttgatttatcattggtcgtagagaatccttcaattttacgtgtt 779
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 503 gtcggtggtgataatgttgatttatcattggtcgtagagaatccttcaattttacgtgtt 444
Query: 780 ggttgtatccttagtgatccagaaaaaccaatacctctatcaaaacgtttcatcgctcaa 839
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 443 ggttgtatccttagtgatccagaaaaaccaatacctctatcaaaacgtttcatcgctcaa 384
Query: 840 atcgtcactttcactctaccaatcccaatgaccaatggttatcaagtggttttccatgct 899
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 383 atcgtcactttcactctaccaatcccaatgaccaatggttatcaagtggttttccatgct 324
Query: 900 cactcaatggaagaacctgcaaccattacacgtttaattagtttattggattcaaatggt 959
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 323 cactcaatggaagaacctgcaaccattacacgtttaattagtttattggattcaaatggt 264
Query: 960 gccgtttcaaaaaagaatccaagatgtatttctgatacttgtactgctttagtagaaatt 1019
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 263 gccgtttcaaaaaagaatccaagatgtatttctgatacttgtactgctttagtagaaatt 204
Query: 1020 acattgggtagattatcttgtttagaactctatagttcctatagacaattaggtagattc 1079
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 203 acattgggtagattatcttgtttagaactctatagttcctatagacaattaggtagattc 144
Query: 1080 actttaagaaatggtggtgttacaattgctgctggtttaatcactgaattttatgataat 1139
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 143 actttaagaaatggtggtgttacaattgctgctggtttaatcactgaattttatgataat 84
Query: 1140 ccacctaaaaaatcttcttcatcacctttaacaactacaacaacaacaacatc 1192
|||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 83 ccacctaaaaaatcttcttcatcacctttaacaactacaacaacaacaacatc 31
Lambda K H
1.37 0.711 1.31
Matrix: blastn matrix:1 -3
Number of Sequences: 92845959
Number of Hits to DB: 1,259,139,695
Number of extensions: 76711409
Number of successful extensions: 8273818
Number of sequences better than 10.0: 278
Length of query: 1335
Length of database: 95,242,211,685
Length adjustment: 24
Effective length of query: 1311
Effective length of database: 97,308,875,965
Effective search space: 127571936390115
Effective search space used: 127571936390115
X1: 11 (21.8 bits)
S2: 22 (44.1 bits)
|
| protein update |
2009. 6.28 |
| Homology vs Protein |
Query= Contig-U10744-1 (Contig-U10744-1Q) /CSM_Contig/Contig-U10744-1Q.Seq.d
(1335 letters)
Database: nrp_A
3,204,285 sequences; 1,040,966,779 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AY185332_1(AY185332|pid:none) Dictyostelium discoideum Hsp70 sub... 429 e-127
AK166140_1(AK166140|pid:none) Mus musculus lung RCB-0558 LLC cDN... 182 2e-44
AK173091_1(AK173091|pid:none) Mus musculus mRNA for mKIAA1038 pr... 182 2e-44
AF087672_1(AF087672|pid:none) Mus musculus eRFS mRNA, complete c... 182 2e-44
(Q5R6Y0) RecName: Full=HBS1-like protein; &CR860346_1(CR860346|... 182 2e-44
BC010251_1(BC010251|pid:none) Mus musculus Hbs1-like (S. cerevis... 182 2e-44
AK292656_1(AK292656|pid:none) Homo sapiens cDNA FLJ77957 complet... 182 2e-44
AK024258_1(AK024258|pid:none) Homo sapiens cDNA FLJ14196 fis, cl... 182 2e-44
AB028961_1(AB028961|pid:none) Homo sapiens mRNA for KIAA1038 pro... 182 2e-44
AK295545_1(AK295545|pid:none) Homo sapiens cDNA FLJ50159 complet... 182 2e-44
(Q9Y450) RecName: Full=HBS1-like protein; AltName: Full=ERFS; &... 182 2e-44
AK298336_1(AK298336|pid:none) Homo sapiens cDNA FLJ52343 complet... 182 2e-44
AK293573_1(AK293573|pid:none) Homo sapiens cDNA FLJ59477 complet... 182 2e-44
BT045574_1(BT045574|pid:none) Salmo salar clone ssal-rgf-525-146... 177 6e-43
BC073427_1(BC073427|pid:none) Xenopus laevis MGC80911 protein, m... 176 2e-42
AE014296_397(AE014296|pid:none) Drosophila melanogaster chromoso... 172 2e-41
AK073254_1(AK073254|pid:none) Oryza sativa Japonica Group cDNA c... 156 1e-36
AP008207_113(AP008207|pid:none) Oryza sativa (japonica cultivar-... 156 1e-36
AY060736_1(AY060736|pid:none) Drosophila melanogaster GH18819 fu... 154 7e-36
AK100658_1(AK100658|pid:none) Oryza sativa Japonica Group cDNA c... 150 8e-35
BC044162_1(BC044162|pid:none) Danio rerio HBS1-like (S. cerevisi... 149 3e-34
AP008210_2281(AP008210|pid:none) Oryza sativa (japonica cultivar... 137 1e-30
AK222144_1(AK222144|pid:none) Arabidopsis thaliana mRNA for puta... 135 3e-30
(A0RUM4) RecName: Full=Elongation factor 1-alpha; Short... 132 3e-29
EU686642_15(EU686642|pid:none) Uncultured marine crenarchaeote S... 132 4e-29
EU686623_4(EU686623|pid:none) Uncultured marine crenarchaeote AD... 129 2e-28
EU686625_2(EU686625|pid:none) Uncultured marine crenarchaeote KM... 128 4e-28
AE017342_477(AE017342|pid:none) Cryptococcus neoformans var. neo... 128 5e-28
AL732349_12(AL732349|pid:none) Oryza sativa genomic DNA, chromos... 127 1e-27
FN357318_33(FN357318|pid:none) Schistosoma mansoni genome sequen... 125 3e-27
AF393466_34(AF393466|pid:none) Uncultured crenarchaeote 74A4 par... 124 8e-27
(Q57770) RecName: Full=Elongation factor 1-alpha; Short... 120 8e-26
AJ312397_1(AJ312397|pid:none) Sulfolobus solfataricus tef1 gene ... 119 2e-25
CR954204_557(CR954204|pid:none) Ostreococcus tauri strain OTTH05... 119 3e-25
Z81098_7(Z81098|pid:none) Caenorhabditis elegans Cosmid K07A12, ... 112 6e-25
(O93729) RecName: Full=Elongation factor 1-alpha; Short... 117 9e-25
(A1RXW9) RecName: Full=Elongation factor 1-alpha; Short... 115 3e-24
D79214_1(D79214|pid:none) Schizosaccharomyces pombe DNA for omni... 112 5e-24
(O29325) RecName: Full=Elongation factor 1-alpha; Short... 114 6e-24
(A0B7D6) RecName: Full=Elongation factor 1-alpha; Short... 114 8e-24
(A2STF0) RecName: Full=Elongation factor 1-alpha; Short... 114 8e-24
(A1RRJ3) RecName: Full=Elongation factor 1-alpha; Short... 114 8e-24
(A3MV69) RecName: Full=Elongation factor 1-alpha; Short... 114 8e-24
CP000968_1482(CP000968|pid:none) Candidatus Korarchaeum cryptofi... 113 1e-23
(P41203) RecName: Full=Elongation factor 1-alpha; Short... 112 3e-23
S54734(S54734;S38464)translation elongation factor aEF-1 alpha c... 112 3e-23
(Q6L202) RecName: Full=Elongation factor 1-alpha; Short... 111 5e-23
(Q9V0V7) RecName: Full=Elongation factor 1-alpha; Short... 111 7e-23
(A6VGV6) RecName: Full=Elongation factor 1-alpha; Short... 111 7e-23
(A4FWE9) RecName: Full=Elongation factor 1-alpha; Short... 111 7e-23
(A3CTG3) RecName: Full=Elongation factor 1-alpha; Short... 110 1e-22
S12090(S12090) translation elongation factor aEF-1 alpha chain -... 109 2e-22
(Q6LXI1) RecName: Full=Elongation factor 1-alpha; Short... 109 3e-22
AL353596_4(AL353596|pid:none) Human DNA sequence from clone CTA-... 109 3e-22
(A4YCR6) RecName: Full=Elongation factor 1-alpha; Short... 109 3e-22
CP001140_1365(CP001140|pid:none) Desulfurococcus kamchatkensis 1... 108 3e-22
(Q464Z4) RecName: Full=Elongation factor 1-alpha; Short... 108 3e-22
(P07810) RecName: Full=Elongation factor 1-alpha; Short... 108 3e-22
(A7I656) RecName: Full=Elongation factor 1-alpha; Short... 108 4e-22
(Q979T1) RecName: Full=Elongation factor 1-alpha; Short... 108 6e-22
BA000011_1079(BA000011|pid:none) Thermoplasma volcanium GSS1 DNA... 108 6e-22
T23393(T23393)hypothetical protein K07A12.4 - Caenorhabditis ele... 102 7e-22
(A6UQ14) RecName: Full=Elongation factor 1-alpha; Short... 107 7e-22
AM270233_7(AM270233|pid:none) Aspergillus niger contig An11c0160... 106 2e-21
(O59153) RecName: Full=Elongation factor 1-alpha; Short... 105 3e-21
(O27132) RecName: Full=Elongation factor 1-alpha; Short... 105 4e-21
(Q8PUR8) RecName: Full=Elongation factor 1-alpha; Short... 104 6e-21
AY542532_1(AY542532|pid:none) Cladonema radiatum translation elo... 104 6e-21
AJ581004_1(AJ581004|pid:none) Axinella verrucosa mRNA for elonga... 104 6e-21
(A8MAJ1) RecName: Full=Elongation factor 1-alpha; Short... 104 8e-21
(Q8U152) RecName: Full=Elongation factor 1-alpha; Short... 104 8e-21
(A5ULM5) RecName: Full=Elongation factor 1-alpha; Short... 104 8e-21
EF474125_1(EF474125|pid:none) Monocercomonoides sp. PA clone 1/2... 103 2e-20
AB122066_1(AB122066|pid:none) Crassostrea gigas EF1-alpha mRNA f... 102 2e-20
(Q8TRC4) RecName: Full=Elongation factor 1-alpha; Short... 102 2e-20
AM494954_9(AM494954|pid:none) Leishmania braziliensis chromosome... 102 2e-20
L37045_1(L37045|pid:none) Xenopus laevis (clone XLSUP35) SUP35 m... 101 5e-20
CU928178_621(CU928178|pid:none) Zygosaccharomyces rouxii strain ... 101 5e-20
AF056098_1(AF056098|pid:none) Colpoda inflata translation elonga... 101 7e-20
AJ549292_1(AJ549292|pid:none) Podocoryne carnea mRNA for elongat... 101 7e-20
FJ539142_1(FJ539142|pid:none) Caulerpa cf. racemosa GG-2009 elon... 101 7e-20
AF416379_1(AF416379|pid:none) Leishmania donovani elongation fac... 100 9e-20
(P23637) RecName: Full=Eukaryotic peptide chain release factor G... 100 9e-20
CT005256_10(CT005256|pid:none) Leishmania major strain Friedlin,... 100 9e-20
BT043569_1(BT043569|pid:none) Salmo salar clone HM4_2380 elongat... 100 9e-20
FN392319_1522(FN392319|pid:none) Pichia pastoris GS115 chromosom... 100 9e-20
AY582824_1(AY582824|pid:none) Monosiga ovata ef1a mRNA, partial ... 100 9e-20
FN392321_412(FN392321|pid:none) Pichia pastoris GS115 chromosome... 100 9e-20
(O13354) RecName: Full=Eukaryotic peptide chain release factor G... 100 9e-20
(Q9HGI4) RecName: Full=Eukaryotic peptide chain release factor G... 100 1e-19
(Q9YAV0) RecName: Full=Elongation factor 1-alpha; Short... 100 1e-19
AF198109_1(AF198109|pid:none) Trichomonas vaginalis eukaryotic r... 100 1e-19
(Q01765) RecName: Full=Elongation factor 1-alpha; Short... 100 1e-19
(Q92005) RecName: Full=Elongation factor 1-alpha; Short... 100 2e-19
CP000498_474(CP000498|pid:none) Pichia stipitis CBS 6054 chromos... 100 2e-19
AM270408_32(AM270408|pid:none) Aspergillus niger contig An18c016... 100 2e-19
DQ083545_1(DQ083545|pid:none) Danio rerio eukaryotic translation... 100 2e-19
FM992689_881(FM992689|pid:none) Candida dubliniensis CD36 chromo... 100 2e-19
AY643400_1(AY643400|pid:none) Pimephales promelas elongation fac... 100 2e-19
EF014948_1(EF014948|pid:none) Pichia pastoris translation elonga... 100 2e-19
AY264257_1(AY264257|pid:none) Henonemus punctatus elongation fac... 100 2e-19
EU369017_1(EU369017|pid:none) Gibellula sp. NHJ 12014 translatio... 100 2e-19
(P90519) RecName: Full=Elongation factor 1-alpha; Short... 100 2e-19
(Q2NEL1) RecName: Full=Elongation factor 1-alpha; Short... 100 2e-19
DQ028590_1(DQ028590|pid:none) Cintractia sorghi-vulgaris isolate... 99 3e-19
CR380951_24(CR380951|pid:none) Candida glabrata strain CBS138 ch... 99 3e-19
Y09023_1(Y09023|pid:none) G.cydonium mRNA for elongation factor ... 99 3e-19
AF157282_1(AF157282|pid:none) Rhizomucor miehei translation elon... 99 3e-19
AF157299_1(AF157299|pid:none) Thermomucor indicae-seudaticae tra... 99 3e-19
AY264216_1(AY264216|pid:none) Pterodoras granulosus elongation f... 99 4e-19
AY785728_1(AY785728|pid:none) Trypanosoma rangeli strain San Agu... 99 4e-19
(Q9HGI6) RecName: Full=Eukaryotic peptide chain release factor G... 99 4e-19
(P51554) RecName: Full=Elongation factor 1-alpha; Short... 99 4e-19
AF498320_1(AF498320|pid:none) Oncorhynchus mykiss elongation fac... 99 4e-19
FJ890356_1(FJ890356|pid:none) Oncorhynchus tshawytscha elongatio... 99 4e-19
AY785668_1(AY785668|pid:none) Trypanosoma cruzi strain Silvio X1... 99 4e-19
(B6YVG2) RecName: Full=Elongation factor 1-alpha; Short... 98 6e-19
AY785665_1(AY785665|pid:none) Trypanosoma cruzi strain M6241 cl6... 98 6e-19
AY785676_1(AY785676|pid:none) Trypanosoma cruzi strain NR cl3 cl... 98 6e-19
AY785684_1(AY785684|pid:none) Trypanosoma cruzi strain MT4167 cl... 98 6e-19
AK298868_1(AK298868|pid:none) Homo sapiens cDNA FLJ55563 complet... 98 6e-19
(P17508) RecName: Full=Elongation factor 1-alpha, oocyte form; A... 98 6e-19
BC054279_1(BC054279|pid:none) Xenopus laevis eukaryotic translat... 98 6e-19
AY973258_1(AY973258|pid:none) Leishmania major elongation factor... 98 6e-19
AY785660_1(AY785660|pid:none) Trypanosoma cruzi strain Dm 28 c c... 98 6e-19
BC060907_1(BC060907|pid:none) Danio rerio zgc:73138, mRNA (cDNA ... 98 6e-19
JC5117(JC5117) translation elongation factor eEF-1 alpha - Trypa... 98 6e-19
BC064177_1(BC064177|pid:none) Xenopus tropicalis eukaryotic tran... 98 6e-19
X52977_1(X52977|pid:none) X.laevis mRNA for elongation factor 1-... 98 6e-19
AY785657_1(AY785657|pid:none) Trypanosoma cruzi strain Colombian... 98 6e-19
AF157243_1(AF157243|pid:none) Cunninghamella bertholletiae trans... 98 8e-19
AY264201_1(AY264201|pid:none) Amblydoras cf. monitor elongation ... 98 8e-19
AB326305_1(AB326305|pid:none) Solea senegalensis SseEF1A4 mRNA f... 98 8e-19
BC080263_1(BC080263|pid:none) Danio rerio zgc:91975, mRNA (cDNA ... 98 8e-19
AY264197_1(AY264197|pid:none) Sorubim lima elongation factor-1 a... 98 8e-19
AY785685_1(AY785685|pid:none) Trypanosoma cruzi strain Basileu c... 98 8e-19
(P17197) RecName: Full=Elongation factor 1-alpha; Short... 98 8e-19
AY264247_1(AY264247|pid:none) Acanthodoras spinosissimus elongat... 98 8e-19
AF543784_1(AF543784|pid:none) Hypomyces polyporinus strain ATCC ... 98 8e-19
AY264215_1(AY264215|pid:none) Agamyxis albomaculatus elongation ... 98 8e-19
AK001303_1(AK001303|pid:none) Homo sapiens cDNA FLJ10441 fis, cl... 97 1e-18
FJ539138_1(FJ539138|pid:none) Ignatius tetrasporus strain UTEX B... 97 1e-18
FN323397_1(FN323397|pid:none) Schistosoma japonicum isolate Anhu... 97 1e-18
AF157300_1(AF157300|pid:none) Umbelopsis isabellina translation ... 97 1e-18
FJ807244_1(FJ807244|pid:none) Reclinomonas americana elongation ... 97 1e-18
AM920427_1018(AM920427|pid:none) Penicillium chrysogenum Wiscons... 97 1e-18
(P29520) RecName: Full=Elongation factor 1-alpha; Short... 97 1e-18
AB199910_1(AB199910|pid:none) Hyla japonica ef 1a mRNA for elong... 97 1e-18
(Q5R4B3) RecName: Full=Eukaryotic peptide chain release factor G... 97 1e-18
AK315267_1(AK315267|pid:none) Homo sapiens cDNA, FLJ96276, highl... 97 1e-18
AL031853_1(AL031853|pid:none) S.pombe chromosome II cosmid c25B2. 94 1e-18
(Q9HGI7) RecName: Full=Eukaryotic peptide chain release factor G... 97 1e-18
EU016386_1(EU016386|pid:none) Trichoplusia ni clone L608 elongat... 97 1e-18
EU369009_1(EU369009|pid:none) Akanthomyces cinereus strain NHJ 3... 97 1e-18
AB003503_1(AB003503|pid:none) Mus musculus mRNA for Guanine Nucl... 97 1e-18
AY739895_1(AY739895|pid:none) Rhodomonas salina elongation facto... 97 2e-18
BC088010_1(BC088010|pid:none) Xenopus tropicalis eukaryotic tran... 97 2e-18
AY089522_1(AY089522|pid:none) Drosophila melanogaster GM14559 fu... 97 2e-18
U88868_1(U88868|pid:none) Drosophila melanogaster elongation fac... 97 2e-18
(P08736) RecName: Full=Elongation factor 1-alpha 1; Sho... 97 2e-18
AY264218_1(AY264218|pid:none) Doras carinatus elongation factor-... 97 2e-18
DQ403163_1(DQ403163|pid:none) Capsaspora owczarzaki translation ... 97 2e-18
DQ028594_1(DQ028594|pid:none) Malassezia pachydermatis isolate A... 97 2e-18
AB293568_1(AB293568|pid:none) Mordacia mordax MmoEF1a mRNA for e... 97 2e-18
CR382136_102(CR382136|pid:none) Debaryomyces hansenii strain CBS... 97 2e-18
AY264210_1(AY264210|pid:none) Rhinodoras cf. boehlkei elongation... 96 2e-18
AM055942_137(AM055942|pid:none) Toxoplasma gondii RH, genomic DN... 96 2e-18
BC009503_1(BC009503|pid:none) Homo sapiens G1 to S phase transit... 96 2e-18
AY264246_1(AY264246|pid:none) Doras punctatus elongation factor-... 96 2e-18
AY892650_1(AY892650|pid:none) Synthetic construct Homo sapiens c... 96 2e-18
X56698_1(X56698|pid:none) X. laevis mRNA for 42Sp48. 96 2e-18
AY890166_1(AY890166|pid:none) Synthetic construct Homo sapiens c... 96 2e-18
AY264249_1(AY264249|pid:none) Parauchenipterus cf. galeatus elon... 96 2e-18
AY891103_1(AY891103|pid:none) Synthetic construct Homo sapiens c... 96 2e-18
AY264254_1(AY264254|pid:none) Liosomadoras morrowi elongation fa... 96 2e-18
D32120_1(D32120|pid:none) Halobacterium halobium genes for elong... 96 2e-18
(P34825) RecName: Full=Elongation factor 1-alpha; Short... 96 2e-18
AY115575_1(AY115575|pid:none) Trichophyton rubrum elongation fac... 96 2e-18
D49926_1(D49926|pid:none) Eugymnanthea japonica mRNA for elongat... 96 2e-18
AF157244_1(AF157244|pid:none) Cunninghamella echinulata translat... 96 2e-18
CP000496_913(CP000496|pid:none) Pichia stipitis CBS 6054 chromos... 96 2e-18
DQ250681_1(DQ250681|pid:none) Ancylostoma ceylanicum translation... 96 2e-18
A54760(A54760;C49394)translation elongation factor eEF-1 alpha c... 96 3e-18
AY264203_1(AY264203|pid:none) Physopyxis lyra elongation factor-... 96 3e-18
AY028647_1(AY028647|pid:none) Saccharomyces cerevisiae strain SC... 96 3e-18
EU057543_1(EU057543|pid:none) Saccharomycopsis microspora strain... 96 3e-18
BC134651_1(BC134651|pid:none) Bos taurus G1 to S phase transitio... 96 3e-18
EF468762_1(EF468762|pid:none) Cordyceps cf. pruinosa EFCC 5693 t... 96 3e-18
(P62631) RecName: Full=Elongation factor 1-alpha 2; Sho... 96 3e-18
AL450341_18(AL450341|pid:none) Mouse DNA sequence from clone RP2... 96 3e-18
(P27592) RecName: Full=Elongation factor 1-alpha; Short... 96 3e-18
AF157294_1(AF157294|pid:none) Syncephalastrum monosporum var. pl... 96 3e-18
(P53013) RecName: Full=Elongation factor 1-alpha; Short... 96 3e-18
Y08487_1(Y08487|pid:none) S.mansoni mRNA for elongation factor 1... 96 3e-18
EF469067_1(EF469067|pid:none) Lecanicillium psalliotae strain CB... 96 3e-18
(Q5JFZ4) RecName: Full=Elongation factor 1-alpha; Short... 96 3e-18
AB124568_1(AB124568|pid:none) Pelodiscus sinensis PsEF1a mRNA fo... 96 3e-18
BC140515_1(BC140515|pid:none) Bos taurus G1 to S phase transitio... 96 3e-18
AY531943_1(AY531943|pid:none) Beauveria bassiana isolate 6721 tr... 96 3e-18
(A8ABM5) RecName: Full=Elongation factor 1-alpha; Short... 96 3e-18
EF468784_1(EF468784|pid:none) Lecanicillium psalliotae strain CB... 96 3e-18
EU718261_1(EU718261|pid:none) Aschersonia sp. WYSD-14 translatio... 96 4e-18
AY264200_1(AY264200|pid:none) Amblydoras nauticus elongation fac... 96 4e-18
AY785691_1(AY785691|pid:none) Trypanosoma cruzi strain Esmeraldo... 96 4e-18
BC075885_1(BC075885|pid:none) Danio rerio zgc:92085, mRNA (cDNA ... 96 4e-18
DQ059051_1(DQ059051|pid:none) Trechispora sp. PBM418 isolate AFT... 96 4e-18
AF157291_1(AF157291|pid:none) Saksenaea vasiformis translation e... 96 4e-18
EU057531_1(EU057531|pid:none) Saccharomycopsis javanensis strain... 96 4e-18
(Q2HJN6) RecName: Full=Elongation factor 1-alpha 3; Sho... 96 4e-18
AY500140_1(AY500140|pid:none) Homalodisca coagulata putative elo... 96 4e-18
BC092884_1(BC092884|pid:none) Danio rerio zgc:110335, mRNA (cDNA... 96 4e-18
AB179145_1(AB179145|pid:none) Macaca fascicularis testis cDNA cl... 96 4e-18
AY028646_1(AY028646|pid:none) Saccharomyces cerevisiae strain SC... 96 4e-18
AB005588_1(AB005588|pid:none) Cynops pyrrhogaster mRNA for newt ... 96 4e-18
AF423849_1(AF423849|pid:none) Nannochorista dipteroides elongati... 96 4e-18
AK222519_1(AK222519|pid:none) Homo sapiens mRNA for eukaryotic t... 95 5e-18
FN323396_1(FN323396|pid:none) Schistosoma japonicum isolate Anhu... 95 5e-18
AB070233_1(AB070233|pid:none) Branchiostoma floridae EF-1a gene ... 95 5e-18
DQ862130_1(DQ862130|pid:none) Beauveria bassiana isolate IBL0318... 95 5e-18
AF157231_1(AF157231|pid:none) Apophysomyces elegans translation ... 95 5e-18
AY336495_1(AY336495|pid:none) Schistosoma japonicum elongation f... 95 5e-18
(P40911) RecName: Full=Elongation factor 1-alpha; Short... 95 5e-18
AY264212_1(AY264212|pid:none) Orinocodoras eigenmanni elongation... 95 5e-18
U81804_1(U81804|pid:none) Filobasidiella neoformans translation ... 95 5e-18
DQ059760_1(DQ059760|pid:none) Bourdotia sp. GEL5065 translation ... 95 5e-18
AY785666_1(AY785666|pid:none) Trypanosoma cruzi strain M6241 cl6... 95 5e-18
AY264208_1(AY264208|pid:none) Platydoras costatus elongation fac... 95 5e-18
(P54959) RecName: Full=Elongation factor 1-alpha; Short... 95 5e-18
AY785688_1(AY785688|pid:none) Trypanosoma cruzi strain CA1 clone... 95 5e-18
AE017346_159(AE017346|pid:none) Cryptococcus neoformans var. neo... 91 5e-18
BC053244_1(BC053244|pid:none) Danio rerio G1 to S phase transiti... 95 6e-18
AB126336_1(AB126336|pid:none) Nematostella vectensis EF1alpha mR... 95 6e-18
AY264226_1(AY264226|pid:none) Hemidoras stenopeltis haplotype I ... 95 6e-18
AY264238_1(AY264238|pid:none) Leptodoras cf. praelongus elongati... 95 6e-18
AY682093_1(AY682093|pid:none) Scleronephthya gracillimum transla... 95 6e-18
AK300922_1(AK300922|pid:none) Homo sapiens cDNA FLJ56859 complet... 95 6e-18
AK133725_1(AK133725|pid:none) Mus musculus 6 days neonate head c... 95 6e-18
EU336320_1(EU336320|pid:none) Tunga libis isolate F166 elongatio... 95 6e-18
AY264251_1(AY264251|pid:none) Auchenipterus demerarae elongation... 95 6e-18
AY582829_1(AY582829|pid:none) Acanthamoeba culbertsoni ef1a gene... 95 6e-18
AY264221_1(AY264221|pid:none) Nemadoras hemipeltis elongation fa... 95 6e-18
AJ250733_1(AJ250733|pid:none) Dreissena polymorpha mRNA for tran... 95 6e-18
EF468747_1(EF468747|pid:none) Cordyceps bifusispora strain EFCC ... 95 6e-18
CP000500_535(CP000500|pid:none) Pichia stipitis CBS 6054 chromos... 94 8e-18
AY729874_1(AY729874|pid:none) Plectospira myriandra elongation f... 94 8e-18
BC080974_1(BC080974|pid:none) Xenopus tropicalis hypothetical LO... 94 8e-18
AY489615_1(AY489615|pid:none) Cordyceps capitata translation elo... 94 8e-18
FN316460_1(FN316460|pid:none) Schistosoma japonicum isolate Anhu... 94 8e-18
FN357919_5(FN357919|pid:none) Schistosoma mansoni genome sequenc... 94 8e-18
AY264220_1(AY264220|pid:none) Nemadoras trimaculatus elongation ... 94 8e-18
FN316452_1(FN316452|pid:none) Schistosoma japonicum isolate Anhu... 94 8e-18
FN316451_1(FN316451|pid:none) Schistosoma japonicum isolate Anhu... 94 8e-18
AY813247_1(AY813247|pid:none) Schistosoma japonicum clone SJCHGC... 94 8e-18
AY891104_1(AY891104|pid:none) Synthetic construct Homo sapiens c... 94 8e-18
EU336249_1(EU336249|pid:none) Tunga monositus isolate F021 elong... 94 1e-17
AK167843_1(AK167843|pid:none) Mus musculus TIB-55 BB88 cDNA, RIK... 94 1e-17
EU334877_1(EU334877|pid:none) Andalucia godoyi isolate AND28 tra... 94 1e-17
AJ970312_1(AJ970312|pid:none) Hebeloma cylindrosporum mRNA for e... 94 1e-17
EF676249_1(EF676249|pid:none) Picea sitchensis clone WS02724_D06... 94 1e-17
AY264239_1(AY264239|pid:none) Leptodoras praelongus elongation f... 94 1e-17
AF172083_1(AF172083|pid:none) Paramecium tetraurelia translation... 94 1e-17
AF128815_1(AF128815|pid:none) Oryzias latipes 42Sp50 mRNA, compl... 94 1e-17
DQ440206_1(DQ440206|pid:none) Aedes aegypti clone AET-205 transl... 94 1e-17
EU520324_1(EU520324|pid:none) Apodemia mormo elongation factor 1... 94 1e-17
D45837_1(D45837|pid:none) Neurospora crassa DNA for elongation f... 94 1e-17
AY885160_1(AY885160|pid:none) Ustilago maydis isolate AFTOL-ID 5... 94 1e-17
AY264243_1(AY264243|pid:none) Trachydoras steindachneri elongati... 94 1e-17
(Q9YIC0) RecName: Full=Elongation factor 1-alpha; Short... 94 1e-17
DQ522349_1(DQ522349|pid:none) Isaria tenuipes strain OSC 111007 ... 94 1e-17
EU074286_1(EU074286|pid:none) Sagitta setosa elongation factor 1... 94 1e-17
BC014377_1(BC014377|pid:none) Homo sapiens, clone IMAGE:4041545,... 94 1e-17
AY849694_1(AY849694|pid:none) Magnaporthe grisea elongation fact... 94 1e-17
EF588667_1(EF588667|pid:none) Loricera pilicornis elongation fac... 94 1e-17
AY445082_1(AY445082|pid:none) Metarhizium anisopliae strain E6 t... 94 1e-17
(P10126) RecName: Full=Elongation factor 1-alpha 1; Sho... 94 1e-17
M22432_1(M22432|pid:none) Mus musculus protein synthesis elongat... 94 1e-17
BC065761_1(BC065761|pid:none) Homo sapiens eukaryotic translatio... 94 1e-17
BC071619_1(BC071619|pid:none) Homo sapiens eukaryotic translatio... 94 1e-17
AF397403_1(AF397403|pid:none) Homo sapiens translation elongatio... 94 1e-17
FJ807238_1(FJ807238|pid:none) Euglena gracilis elongation factor... 94 1e-17
AB171290_1(AB171290|pid:none) Macaca fascicularis brain cDNA clo... 94 1e-17
M29548_1(M29548|pid:none) Human elongation factor 1-alpha (EF1A)... 94 1e-17
AY893896_1(AY893896|pid:none) Synthetic construct Homo sapiens c... 94 1e-17
EU369019_1(EU369019|pid:none) Gibellula sp. NHJ 10788 translatio... 94 1e-17
AL844509_554(AL844509|pid:none) Plasmodium falciparum 3D7 chromo... 94 1e-17
AF322220_1(AF322220|pid:none) Homo sapiens cervical cancer suppr... 94 1e-17
AF157287_1(AF157287|pid:none) Rhizopus microsporus var. rhizopod... 94 1e-17
AF091355_1(AF091355|pid:none) Blastocystis hominis isolate C elo... 94 1e-17
BC071727_1(BC071727|pid:none) Homo sapiens eukaryotic translatio... 94 1e-17
AK222551_1(AK222551|pid:none) Homo sapiens mRNA for eukaryotic t... 94 1e-17
AF198111_1(AF198111|pid:none) Euplotes aediculatus eukaryotic re... 94 1e-17
AK223046_1(AK223046|pid:none) Homo sapiens mRNA for eukaryotic t... 94 1e-17
AB490338_1(AB490338|pid:none) Polypedilum vanderplanki PvEf1-alp... 94 1e-17
L10340_1(L10340|pid:none) Human elongation factor-1 alpha (ef-1)... 94 1e-17
AF157260_1(AF157260|pid:none) Mortierella multidivaricata transl... 94 1e-17
FJ807246_1(FJ807246|pid:none) Stachyamoeba lipophora elongation ... 94 1e-17
DQ443294_1(DQ443294|pid:none) Bombyx mori GTP binding translatio... 94 1e-17
AK032914_1(AK032914|pid:none) Mus musculus 12 days embryo male w... 94 1e-17
AK292639_1(AK292639|pid:none) Homo sapiens cDNA FLJ76726 complet... 94 1e-17
AM270234_8(AM270234|pid:none) Aspergillus niger contig An11c0170... 94 1e-17
CR861176_1(CR861176|pid:none) Pongo abelii mRNA; cDNA DKFZp459L0... 94 1e-17
BC014892_1(BC014892|pid:none) Homo sapiens, clone IMAGE:3909122,... 94 1e-17
(P68103) RecName: Full=Elongation factor 1-alpha 1; Sho... 94 1e-17
(Q90835) RecName: Full=Elongation factor 1-alpha 1; Sho... 93 2e-17
AY643816_1(AY643816|pid:none) Lycogala epidendrum elongation fac... 93 2e-17
DQ352830_1(DQ352830|pid:none) Ustilago maydis isolate B-PBi-4-1-... 93 2e-17
CQ840947_1(CQ840947|pid:none) Sequence 42 from Patent EP1439230.... 93 2e-17
DQ168693_1(DQ168693|pid:none) Chiromyza sp. CB0313 elongation fa... 93 2e-17
FJ807265_1(FJ807265|pid:none) Trypanosoma avium elongation facto... 93 2e-17
EU718262_1(EU718262|pid:none) Aschersonia sp. WYYS-47 translatio... 93 2e-17
EU369020_1(EU369020|pid:none) Gibellula sp. NHJ 13158 translatio... 93 2e-17
FN323413_1(FN323413|pid:none) Schistosoma japonicum isolate Anhu... 93 2e-17
DQ522325_1(DQ522325|pid:none) Cordyceps cardinalis strain OSC 93... 93 2e-17
(Q00080) RecName: Full=Elongation factor 1-alpha; Short... 93 2e-17
DQ522339_1(DQ522339|pid:none) Cordyceps unilateralis strain OSC ... 93 2e-17
AF423846_1(AF423846|pid:none) Opthalmopsylla volgensis palestini... 93 2e-17
AY752802_1(AY752802|pid:none) Culicoides sonorensis clone CsEF1a... 93 2e-17
(Q04634) RecName: Full=Elongation factor 1-alpha; Short... 93 2e-17
EU718255_1(EU718255|pid:none) Aschersonia sp. WYSD translation e... 93 2e-17
AY264211_1(AY264211|pid:none) Rhinodoras thomersoni elongation f... 93 2e-17
AF450115_1(AF450115|pid:none) Rhizophydium sp. JEL136 translatio... 93 2e-17
AK297878_1(AK297878|pid:none) Homo sapiens cDNA FLJ52573 complet... 93 2e-17
BC157768_1(BC157768|pid:none) Xenopus tropicalis eukaryotic tran... 93 2e-17
FM200063_1(FM200063|pid:none) Histomonas meleagridis partial mRN... 93 2e-17
(P13549) RecName: Full=Elongation factor 1-alpha, somatic form; ... 93 2e-17
(P32186) RecName: Full=Elongation factor 1-alpha; Short... 93 2e-17
BC105315_1(BC105315|pid:none) Bos taurus eukaryotic translation ... 93 2e-17
AF157273_1(AF157273|pid:none) Parasitella parasitica translation... 93 2e-17
DQ832233_1(DQ832233|pid:none) Sporisorium reilianum AFTOL-ID 490... 93 2e-17
DQ352829_1(DQ352829|pid:none) Sporisorium scitamineum isolate Br... 93 2e-17
EF485058_1(EF485058|pid:none) Parnassius epaphus tsaidamensis el... 93 2e-17
AY264207_1(AY264207|pid:none) Centrodoras cf. brachiatus elongat... 93 2e-17
AF423819_1(AF423819|pid:none) Harpobittacus australis elongation... 93 2e-17
U81803_1(U81803|pid:none) Filobasidiella neoformans translation ... 93 2e-17
EF468761_1(EF468761|pid:none) Cordyceps cf. pruinosa NHJ 10684 t... 93 2e-17
AF056108_1(AF056108|pid:none) Stylonychia mytilus translation el... 93 2e-17
BC022412_1(BC022412|pid:none) Homo sapiens, clone IMAGE:4134193,... 93 2e-17
AF157258_1(AF157258|pid:none) Micromucor ramannianus translation... 93 2e-17
AF056109_1(AF056109|pid:none) Telotrochidium henneguyii translat... 93 2e-17
DQ848175_1(DQ848175|pid:none) Escovopsis sp. nmg020611-02 esc7 e... 93 2e-17
DQ522331_1(DQ522331|pid:none) Cordyceps melolonthae strain OSC 1... 93 2e-17
CU928170_492(CU928170|pid:none) Kluyveromyces thermotolerans str... 93 2e-17
EU336307_1(EU336307|pid:none) Geusibia ashcrafti isolate F128 el... 93 2e-17
DQ311165_1(DQ311165|pid:none) Bombyx mori elongation factor 1 al... 93 2e-17
EF468772_1(EF468772|pid:none) Cordyceps sp. EFCC 2535 translatio... 93 2e-17
AB070235_1(AB070235|pid:none) Oikopleura longicauda EF-1a gene f... 93 2e-17
(P28295) RecName: Full=Elongation factor 1-alpha; Short... 93 2e-17
AB070229_1(AB070229|pid:none) Ptychodera flava EF-1a gene for EF... 93 2e-17
EU336312_1(EU336312|pid:none) Ophthalmopsylla jettmari isolate F... 93 2e-17
CR954204_166(CR954204|pid:none) Ostreococcus tauri strain OTTH05... 91 3e-17
DQ883804_1(DQ883804|pid:none) Pleopsidium gobiense isolate AFTOL... 92 3e-17
DQ234567_1(DQ234567|pid:none) Endocronartium harknessii isolate ... 92 3e-17
AF157272_1(AF157272|pid:none) Mycotypha microspora translation e... 92 3e-17
AY785675_1(AY785675|pid:none) Trypanosoma cruzi strain NR cl3 cl... 92 3e-17
AY264232_1(AY264232|pid:none) Leptodoras juruensis elongation fa... 92 3e-17
AF157262_1(AF157262|pid:none) Mortierella verticillata translati... 92 3e-17
D82573_1(D82573|pid:none) Schizosaccharomyces pombe mRNA for elo... 92 3e-17
AY531918_1(AY531918|pid:none) Beauveria bassiana isolate 2857 tr... 92 3e-17
FJ807243_1(FJ807243|pid:none) Peranema trichophorum strain CCAP ... 92 3e-17
DQ522344_1(DQ522344|pid:none) Hydropisphaera erubescens strain A... 92 3e-17
AY580232_1(AY580232|pid:none) Nucula proxima elongation factor 1... 92 3e-17
(Q10119) RecName: Full=Elongation factor 1-alpha-B/C; S... 92 3e-17
DQ848208_1(DQ848208|pid:none) Escovopsis sp. ugm030327-05 esc4 e... 92 3e-17
(P50522) RecName: Full=Elongation factor 1-alpha-A; Sho... 92 3e-17
(P16017) RecName: Full=Elongation factor 1-alpha; Short... 92 3e-17
DQ282612_1(DQ282612|pid:none) Scutellospora heterogama isolate A... 92 3e-17
AF157234_1(AF157234|pid:none) Benjaminiella poitrasii translatio... 92 3e-17
D89112_1(D89112|pid:none) Schizosaccharomyces pombe mRNA, partia... 92 3e-17
(P14864) RecName: Full=Elongation factor 1-alpha; Short... 92 3e-17
AK032059_1(AK032059|pid:none) Mus musculus adult male medulla ob... 92 4e-17
CP001142_85(CP001142|pid:none) Phaeodactylum tricornutum CCAP 10... 92 4e-17
AF423841_1(AF423841|pid:none) Meringis hubbardi elongation facto... 92 4e-17
EU336295_1(EU336295|pid:none) Dolichopsyllus stylosus isolate F1... 92 4e-17
AF450114_1(AF450114|pid:none) Rhizophlyctis harderi translation ... 92 4e-17
X55973_1(X55973|pid:none) D. discoideum EF1-I gene for elongatio... 92 4e-17
AP006852_395(AP006852|pid:none) Candida albicans genomic DNA, ch... 92 4e-17
BC031640_1(BC031640|pid:none) Mus musculus G1 to S phase transit... 92 4e-17
AY952589_1(AY952589|pid:none) Eumicremma minima elongation facto... 92 4e-17
EF490880_1(EF490880|pid:none) Lepeophtheirus salmonis clone LS00... 92 4e-17
BC079092_1(BC079092|pid:none) Rattus norvegicus G1 to S phase tr... 92 4e-17
AY531907_1(AY531907|pid:none) Beauveria bassiana isolate 1969 tr... 92 4e-17
DQ282608_1(DQ282608|pid:none) Neocallimastix sp. GE13 isolate AF... 92 4e-17
EU369010_1(EU369010|pid:none) Akanthomyces novoguineensis strain... 92 4e-17
(A2Q0Z0) RecName: Full=Elongation factor 1-alpha 1; Sho... 92 4e-17
EU336263_1(EU336263|pid:none) Stenoponia tripectinata medialis i... 92 4e-17
AB035256_1(AB035256|pid:none) Oryctolagus cuniculus mRNA for euk... 92 4e-17
AM910991_208(AM910991|pid:none) Plasmodium knowlesi strain H chr... 92 4e-17
AF016240_1(AF016240|pid:none) Planoprotostelium aurantium protei... 92 4e-17
X55972_1(X55972|pid:none) D. discoideum EF1-II gene for elongati... 92 4e-17
(Q9Y713) RecName: Full=Elongation factor 1-alpha; Short... 92 4e-17
AB253792_1(AB253792|pid:none) Athalia rosae EF-1-alpha mRNA for ... 92 4e-17
AK145785_1(AK145785|pid:none) Mus musculus blastocyst blastocyst... 92 4e-17
DQ463994_1(DQ463994|pid:none) Metarhizium anisopliae var. anisop... 92 4e-17
AB077103_1(AB077103|pid:none) Piptocephalis freseniana EF-1 alph... 92 4e-17
EU336327_1(EU336327|pid:none) Conorhinopsylla stanfordi isolate ... 92 4e-17
(Q96WZ1) RecName: Full=Elongation factor 1-alpha; Short... 92 4e-17
EU574868_1(EU574868|pid:none) Ornithodoros coriaceus clone OC-59... 92 4e-17
(P18624) RecName: Full=Elongation factor 1-alpha; Short... 92 4e-17
(Q7YZN9) RecName: Full=Eukaryotic peptide chain release factor G... 92 5e-17
(P41745) RecName: Full=Elongation factor 1-alpha; Short... 92 5e-17
EU326287_1(EU326287|pid:none) Speyeria mormonia elongation facto... 92 5e-17
AF423871_1(AF423871|pid:none) Pulex irritans elongation factor 1... 92 5e-17
DQ922897_1(DQ922897|pid:none) Euptoieta hegesia voucher NW127-22... 92 5e-17
EF493991_1(EF493991|pid:none) Eresia perna perna voucher NW114-5... 92 5e-17
AF157245_1(AF157245|pid:none) Dichotomocladium elegans translati... 92 5e-17
DQ056288_1(DQ056288|pid:none) Platygloea disciformis isolate AFT... 92 5e-17
AF157242_1(AF157242|pid:none) Cokeromyces recurvatus translation... 92 5e-17
EF469063_1(EF469063|pid:none) Hirsutella sp. NHJ 12525 translati... 92 5e-17
DQ522357_1(DQ522357|pid:none) Simplicillium lanosoniveum strain ... 92 5e-17
EU336301_1(EU336301|pid:none) Stephanocircus pectinipes isolate ... 92 5e-17
M25504_1(M25504|pid:none) X.laevis elongation factor-1 alpha-cha... 92 5e-17
AY582826_1(AY582826|pid:none) Corallochytrium limacisporum ef1a ... 92 5e-17
(Q18EY5) RecName: Full=Elongation factor 1-alpha; Short... 92 5e-17
AB070232_1(AB070232|pid:none) Asterias amurensis EF-1a gene for ... 92 5e-17
AF423820_1(AF423820|pid:none) Bittacus selysi elongation factor ... 92 5e-17
FM867804_1(FM867804|pid:none) Cochliomyia hominivorax partial ef... 92 5e-17
AF423874_1(AF423874|pid:none) Craneopsylla minerva wolffheuglia ... 92 5e-17
AY788718_1(AY788718|pid:none) Baeotus aelius voucher NW130-16 el... 92 5e-17
AY580239_1(AY580239|pid:none) Obelia sp. KJP-2004 elongation fac... 92 5e-17
AB116235_1(AB116235|pid:none) Rosellinia sp. PF1022 tef1 gene fo... 92 5e-17
FM992689_752(FM992689|pid:none) Candida dubliniensis CD36 chromo... 92 5e-17
DQ883774_1(DQ883774|pid:none) Diploschistes cinereocaesius isola... 92 5e-17
FM867807_1(FM867807|pid:none) Cochliomyia hominivorax partial ef... 92 5e-17
EU336302_1(EU336302|pid:none) Ctenoparia topali isolate F120 elo... 92 5e-17
AY881020_1(AY881020|pid:none) Dacryopinax spathularia isolate AF... 92 5e-17
EU336324_1(EU336324|pid:none) Parastivalius novaeguinae isolate ... 92 5e-17
FJ529210_1(FJ529210|pid:none) Oscarella carmela elongation facto... 92 5e-17
FM867789_1(FM867789|pid:none) Cochliomyia hominivorax partial ef... 92 5e-17
U72244_1(U72244|pid:none) Leishmania braziliensis tandemly repea... 91 7e-17
FM867794_1(FM867794|pid:none) Cochliomyia hominivorax partial ef... 91 7e-17
AY919293_1(AY919293|pid:none) Pharmacophagus antenor elongation ... 91 7e-17
DQ352827_1(DQ352827|pid:none) Sporisorium reilianum isolate 326 ... 91 7e-17
DQ848199_1(DQ848199|pid:none) Escovopsis sp. sv030615-04 esc1 el... 91 7e-17
EU074281_1(EU074281|pid:none) Alcyonidium diaphanum elongation f... 91 7e-17
EU336325_1(EU336325|pid:none) Bibikovana sp. 1 MFW-2008 elongati... 91 7e-17
DQ338884_1(DQ338884|pid:none) Palla decius elongation factor-1 a... 91 7e-17
EU275640_1(EU275640|pid:none) Acraea meyeri voucher NW115-10 elo... 91 7e-17
EU275636_1(EU275636|pid:none) Acraea issoria voucher NW108-22 el... 91 7e-17
EU920793_1(EU920793|pid:none) Coenonympha sunbecca voucher UK2-4... 91 7e-17
EU275648_1(EU275648|pid:none) Acraea pseudegina voucher NW116-16... 91 7e-17
AF157226_1(AF157226|pid:none) Absidia coerulea translation elong... 91 7e-17
AF234554_1(AF234554|pid:none) Phyllodesma americana elongation f... 91 7e-17
AF157293_1(AF157293|pid:none) Sporodiniella umbellata translatio... 91 7e-17
AF173418_1(AF173418|pid:none) Troides helena elongation factor-1... 91 7e-17
AY919294_1(AY919294|pid:none) Cressida cressida elongation facto... 91 7e-17
EF468782_1(EF468782|pid:none) Lecanicillium attenuatum strain CB... 91 7e-17
AY788700_1(AY788700|pid:none) Mesoxantha esothea voucher NW83-5 ... 91 7e-17
EF485084_1(EF485084|pid:none) Parnassius orleans elongation fact... 91 7e-17
DQ848194_1(DQ848194|pid:none) Escovopsis sp. agh030609-03 esc1 e... 91 7e-17
EU718257_1(EU718257|pid:none) Aschersonia sp. WYYS-46 translatio... 91 7e-17
EF468771_1(EF468771|pid:none) Cordyceps sp. NHJ 12582 translatio... 91 7e-17
AF157238_1(AF157238|pid:none) Chlamydoabsidia padenii translatio... 91 7e-17
EU336285_1(EU336285|pid:none) Carteretta clavata isolate F099 el... 91 7e-17
EU336293_1(EU336293|pid:none) Neotyphloceras crassispina chilens... 91 7e-17
CR940353_470(CR940353|pid:none) Theileria annulata strain Ankara... 91 7e-17
(P02994) RecName: Full=Elongation factor 1-alpha; Short... 91 7e-17
EU336308_1(EU336308|pid:none) Amphalius runatus necopinus isolat... 91 7e-17
EU336317_1(EU336317|pid:none) Plocopsylla achilles isolate F163 ... 91 7e-17
AB097425_1(AB097425|pid:none) Syncephalis depressa EF-1a gene fo... 91 7e-17
DQ848192_1(DQ848192|pid:none) Escovopsis sp. ugm020531-04 esc1 e... 91 7e-17
EF468794_1(EF468794|pid:none) Phytocordyceps ninchukispora strai... 91 7e-17
AY788703_1(AY788703|pid:none) Chersonesia rahria voucher NW111-3... 91 7e-17
AF234547_1(AF234547|pid:none) Eutachyptera psidii elongation fac... 91 7e-17
DQ848173_1(DQ848173|pid:none) Escovopsis sp. agh020712-04 esc1 e... 91 7e-17
AF003554_1(AF003554|pid:none) Parasimulium crosskeyi elongation ... 91 7e-17
AY531917_1(AY531917|pid:none) Beauveria bassiana isolate 2641 tr... 91 7e-17
AF151605_1(AF151605|pid:none) Orgyia leucostigma elongation fact... 91 7e-17
EU275628_1(EU275628|pid:none) Acraea andromacha voucher NW115-8 ... 91 7e-17
EU336286_1(EU336286|pid:none) Frontopsylla nakagawai borealosini... 91 7e-17
EU275630_1(EU275630|pid:none) Acraea camaena voucher NW160-12 el... 91 7e-17
AF423865_1(AF423865|pid:none) Panorpa japonica elongation factor... 91 7e-17
AF016241_1(AF016241|pid:none) Planoprotostelium aurantium protei... 91 7e-17
AF423847_1(AF423847|pid:none) Merope tuber elongation factor 1-a... 91 9e-17
AF157304_1(AF157304|pid:none) Zygorhynchus heterogamus translati... 91 9e-17
DQ848195_1(DQ848195|pid:none) Escovopsis sp. agh030618-02 esc1 e... 91 9e-17
DQ351106_1(DQ351106|pid:none) Hypermnestra helios isolate FS-b-1... 91 9e-17
T51896(T51896)probable translation release factor erf3 [imported... 91 9e-17
EU057533_1(EU057533|pid:none) Candida lassenensis strain NRRL YB... 91 9e-17
EF485099_1(EF485099|pid:none) Hypermnestra helios elongation fac... 91 9e-17
AB032900_1(AB032900|pid:none) Seriola quinqueradiata mRNA for el... 91 9e-17
DQ848168_1(DQ848168|pid:none) Escovopsis sp. agh020706-01 elonga... 91 9e-17
AF423843_1(AF423843|pid:none) Stenoponia americana elongation fa... 91 9e-17
EF485077_1(EF485077|pid:none) Parnassius nordmanni elongation fa... 91 9e-17
AF173415_1(AF173415|pid:none) Battus philenor elongation factor-... 91 9e-17
AF526290_1(AF526290|pid:none) Limnadopsis birchii elongation fac... 91 9e-17
EU920784_1(EU920784|pid:none) Coenonympha hero voucher EW3-14 el... 91 9e-17
DQ922872_1(DQ922872|pid:none) Phalanta phalantha voucher NW86-3 ... 91 9e-17
DQ848196_1(DQ848196|pid:none) Escovopsis sp. agh030627-01 esc1 e... 91 9e-17
AB097423_1(AB097423|pid:none) Coemansia mojavensis EF1a gene for... 91 9e-17
EF485078_1(EF485078|pid:none) Parnassius clodius elongation fact... 91 9e-17
DQ848166_1(DQ848166|pid:none) Escovopsis sp. abs020621-02 esc1 e... 91 9e-17
AF423869_1(AF423869|pid:none) Panorpodes pulcher elongation fact... 91 9e-17
EU920778_1(EU920778|pid:none) Coenonympha arcanioides voucher UK... 91 9e-17
EF485070_1(EF485070|pid:none) Parnassius cephalus elongation fac... 91 9e-17
S01193(S01193) translation elongation factor eEF-1 alpha chain (... 91 9e-17
AY952586_1(AY952586|pid:none) Abrostola asclepiadis elongation f... 91 9e-17
EU920795_1(EU920795|pid:none) Coenonympha tullia voucher EW5-11 ... 91 9e-17
AY267546_1(AY267546|pid:none) Therevid NCSU-0300008 elongation f... 91 9e-17
EU336267_1(EU336267|pid:none) Myodopsylla palposa isolate F057 e... 91 9e-17
AF157302_1(AF157302|pid:none) Utharomyces epallocaulus translati... 91 9e-17
>AY185332_1(AY185332|pid:none) Dictyostelium discoideum Hsp70
subfamily B suppressor 1 (HBS1) mRNA, partial cds.
Length = 322
Score = 429 bits (1104), Expect(2) = e-127
Identities = 216/216 (100%), Positives = 216/216 (100%)
Frame = +3
Query: 489 TLIECIDSFSVGERLLNKPFRMNISDVYKSSSKGYVAVGGKIEAGLLGNGDKILISPGND 668
TLIECIDSFSVGERLLNKPFRMNISDVYKSSSKGYVAVGGKIEAGLLGNGDKILISPGND
Sbjct: 85 TLIECIDSFSVGERLLNKPFRMNISDVYKSSSKGYVAVGGKIEAGLLGNGDKILISPGND 144
Query: 669 ICTIKSIRRNNLESEWAVGGDNVDLSLVVENPSILRVGCILSDPEKPIPLSKRFIAQIVT 848
ICTIKSIRRNNLESEWAVGGDNVDLSLVVENPSILRVGCILSDPEKPIPLSKRFIAQIVT
Sbjct: 145 ICTIKSIRRNNLESEWAVGGDNVDLSLVVENPSILRVGCILSDPEKPIPLSKRFIAQIVT 204
Query: 849 FTLPIPMTNGYQVVFHAHSMEEPATITRLISLLDSNGAVSKKNPRCISDTCTALVEITLG 1028
FTLPIPMTNGYQVVFHAHSMEEPATITRLISLLDSNGAVSKKNPRCISDTCTALVEITLG
Sbjct: 205 FTLPIPMTNGYQVVFHAHSMEEPATITRLISLLDSNGAVSKKNPRCISDTCTALVEITLG 264
Query: 1029 RLSCLELYSSYRQLGRFTLRNGGVTIAAGLITEFYD 1136
RLSCLELYSSYRQLGRFTLRNGGVTIAAGLITEFYD
Sbjct: 265 RLSCLELYSSYRQLGRFTLRNGGVTIAAGLITEFYD 300
Score = 50.1 bits (118), Expect(2) = e-127
Identities = 22/22 (100%), Positives = 22/22 (100%)
Frame = +2
Query: 422 TGENLIDRQESKLLKWYDSKQP 487
TGENLIDRQESKLLKWYDSKQP
Sbjct: 63 TGENLIDRQESKLLKWYDSKQP 84
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3204285
Number of Hits to DB: 1,743,810,699
Number of extensions: 32537844
Number of successful extensions: 92558
Number of sequences better than 10.0: 6450
Number of HSP's gapped: 81441
Number of HSP's successfully gapped: 6465
Length of query: 445
Length of database: 1,040,966,779
Length adjustment: 132
Effective length of query: 313
Effective length of database: 618,001,159
Effective search space: 193434362767
Effective search space used: 193434362767
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 32 (16.9 bits)
|
| PSORT |
|
| VS (DIR, S) |
0 |
| VH (FL, L) |
5 |
| VF (FL, S) |
0 |
| AH (FL, L) |
0 |
| AF (FL, S) |
2 |
| SL (DIR, L) |
0 |
| SS (DIR, S) |
1 |
| SH (FL, L) |
0 |
| SF (FL, S) |
0 |
| CH (FL, L) |
4 |
| CF (FL, S) |
0 |
| FCL (DIR, L) |
0 |
| FC (DIR, S) |
0 |
| FC-IC (SUB) |
0 |