Contig-U10660-1
Contig ID Contig-U10660-1
Contig update 2002. 9.13
Contig sequence
>Contig-U10660-1 (Contig-U10660-1Q) /CSM_Contig/Contig-U10660-1Q.Seq.d
CAAAGATAATGATGAAACTTGGGAACCATTATTAATTTTAATTCCAATGA
GATTAGGTTTGGATGGATTAAATAGTATTTATCATTCTTCATTGTTAGAA
ATCTTTAAGTTTCCTCAAAATNTTGGTGTTGTTGGTGGAAAACCAAGAGC
ATCACTTTATTTTATCGCTGCACAAGATGATAACTTATTTTATTTAGATC
CACATACTGTTCAAAATCATATAGAAGTTGAAAATGGTTCTAAATTCCCT
TTAAATACCTTCTTTTGTAGCACCACAAAGAGAACACATGTTTCAGAAGT
TGACCCATCATTGGTAGTTGCTTTCTTTTGCAAGACCAAAGATGATTTTA
ATGATTTTGTTGAAAGATCAAAAAAGATGACATCTCAAATGGAAAATCCA
ATTTTCTCAATATTTGATAATGAACCAGATTATGATTCAAGTCGTGATTA
TGAATATGAAGAAATTGATGAAACTGGGTGGTGAGACATCTGACGATATA
GATATCGAAGCTGACTATCATATGTATGTAATAAATTAATTCAAAAAAAC
AATTACTACAATACTCAATATTATAATAACACA

Gap no gap
Contig length 583
Chromosome number (1..6, M) 4
Chromosome length 5430582
Start point 1053983
End point 1053400
Strand (PLUS/MINUS) MINUS
Number of clones 3
Number of EST 4
Link to clone list U10660
List of clone(s)

est1=VFN612Z,1,545
est2=VSF543F,32,581
est3=VSG741F,32,584
est4=VSF543Z,286,490
Translated Amino Acid sequence
KDNDETWEPLLILIPMRLGLDGLNSIYHSSLLEIFKFPQNXGVVGGKPRASLYFIAAQDD
NLFYLDPHTVQNHIEVENGSKFPLNTFFCSTTKRTHVSEVDPSLVVAFFCKTKDDFNDFV
ERSKKMTSQMENPIFSIFDNEPDYDSSRDYEYEEIDETGW*di*ryryrs*lsyvcnkli
qknnyyntqyynnt


Translated Amino Acid sequence (All Frames)
Frame A:
qr***nlgtiinfnsneirfgwik*ylsffivrnl*vsskxwccwwktksitlfyrctr*
*lilfrstycsksyrs*kwf*ipfkylll*hhkentcfrs*piigscfllqdqr*f**fc
*kikkddisngksnflni***trl*fks*l*i*rn**nwvvrhlti*iskltiicm**in
skkqllqysil**h


Frame B:
KDNDETWEPLLILIPMRLGLDGLNSIYHSSLLEIFKFPQNXGVVGGKPRASLYFIAAQDD
NLFYLDPHTVQNHIEVENGSKFPLNTFFCSTTKRTHVSEVDPSLVVAFFCKTKDDFNDFV
ERSKKMTSQMENPIFSIFDNEPDYDSSRDYEYEEIDETGW*di*ryryrs*lsyvcnkli
qknnyyntqyynnt


Frame C:
kimmklgnhy*f*fq*d*vwmd*ivfiilhc*kslsflkxlvllvenqehhfilslhkmi
tyfi*ihilfkii*klkmvlnsl*ipsfvapqrehmfqklthhw*llsfarpkmilmill
kdqkr*hlkwkiqfsqylimnqimiqvvimnmkklmklggetsddidieadyhmyvin*f
kktittilniiit


own update 2004. 6.10
Homology vs CSM-cDNA
Query= Contig-U10660-1 (Contig-U10660-1Q)
/CSM_Contig/Contig-U10660-1Q.Seq.d
(583 letters)

Database: CSM
6905 sequences; 5,674,871 total letters


Score E
Sequences producing significant alignments: (bits) Value

Contig-U10660-1 (Contig-U10660-1Q) /CSM_Contig/Conti... 1108 0.0
Contig-U11717-1 (Contig-U11717-1Q) /CSM_Contig/Conti... 42 7e-04
Contig-U12431-1 (Contig-U12431-1Q) /CSM_Contig/Conti... 36 0.041
Contig-U13099-1 (Contig-U13099-1Q) /CSM_Contig/Conti... 34 0.16
Contig-U10933-1 (Contig-U10933-1Q) /CSM_Contig/Conti... 34 0.16
Contig-U09307-1 (Contig-U09307-1Q) /CSM_Contig/Conti... 34 0.16
Contig-U06106-1 (Contig-U06106-1Q) /CSM_Contig/Conti... 34 0.16
Contig-U05976-1 (Contig-U05976-1Q) /CSM_Contig/Conti... 34 0.16
Contig-U03714-1 (Contig-U03714-1Q) /CSM_Contig/Conti... 34 0.16
Contig-U03225-1 (Contig-U03225-1Q) /CSM_Contig/Conti... 34 0.16

>Contig-U10660-1 (Contig-U10660-1Q) /CSM_Contig/Contig-U10660-1Q.Seq.d
Length = 583

Score = 1108 bits (559), Expect = 0.0
Identities = 576/583 (98%)
Strand = Plus / Plus


Query: 1 caaagataatgatgaaacttgggaaccattattaattttaattccaatgagattaggttt 60
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 1 caaagataatgatgaaacttgggaaccattattaattttaattccaatgagattaggttt 60


Query: 61 ggatggattaaatagtatttatcattcttcattgttagaaatctttaagtttcctcaaaa 120
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 61 ggatggattaaatagtatttatcattcttcattgttagaaatctttaagtttcctcaaaa 120


Query: 121 tnttggtgttgttggtggaaaaccaagagcatcactttattttatcgctgcacaagatga 180
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 121 tnttggtgttgttggtggaaaaccaagagcatcactttattttatcgctgcacaagatga 180


Query: 181 taacttattttatttagatccacatactgttcaaaatcatatagaagttgaaaatggttc 240
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 181 taacttattttatttagatccacatactgttcaaaatcatatagaagttgaaaatggttc 240


Query: 241 taaattccctttaaataccttcttttgtagcaccacaaagagaacacatgtttcagaagt 300
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 241 taaattccctttaaataccttcttttgtagcaccacaaagagaacacatgtttcagaagt 300


Query: 301 tgacccatcattggtagttgctttcttttgcaagaccaaagatgattttaatgattttgt 360
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 301 tgacccatcattggtagttgctttcttttgcaagaccaaagatgattttaatgattttgt 360


Query: 361 tgaaagatcaaaaaagatgacatctcaaatggaaaatccaattttctcaatatttgataa 420
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 361 tgaaagatcaaaaaagatgacatctcaaatggaaaatccaattttctcaatatttgataa 420


Query: 421 tgaaccagattatgattcaagtcgtgattatgaatatgaagaaattgatgaaactgggtg 480
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 421 tgaaccagattatgattcaagtcgtgattatgaatatgaagaaattgatgaaactgggtg 480


Query: 481 gtgagacatctgacgatatagatatcgaagctgactatcatatgtatgtaataaattaat 540
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 481 gtgagacatctgacgatatagatatcgaagctgactatcatatgtatgtaataaattaat 540


Query: 541 tcnnnnnnncaattactacaatactcaatattataataacaca 583
|| ||||||||||||||||||||||||||||||||||
Sbjct: 541 tcaaaaaaacaattactacaatactcaatattataataacaca 583


>Contig-U11717-1 (Contig-U11717-1Q) /CSM_Contig/Contig-U11717-1Q.Seq.d
Length = 1580

Score = 42.1 bits (21), Expect = 7e-04
Identities = 21/21 (100%)
Strand = Plus / Plus


Query: 455 tatgaagaaattgatgaaact 475
|||||||||||||||||||||
Sbjct: 1230 tatgaagaaattgatgaaact 1250


>Contig-U12431-1 (Contig-U12431-1Q) /CSM_Contig/Contig-U12431-1Q.Seq.d
Length = 626

Score = 36.2 bits (18), Expect = 0.041
Identities = 21/22 (95%)
Strand = Plus / Minus


Query: 343 tgattttaatgattttgttgaa 364
||||| ||||||||||||||||
Sbjct: 445 tgattgtaatgattttgttgaa 424


Database: CSM
Posted date: Jun 9, 2004 7:35 PM
Number of letters in database: 5,674,871
Number of sequences in database: 6905

Lambda K H
1.37 0.711 1.31

Gapped
Lambda K H
1.37 0.711 1.31


Matrix: blastn matrix:1 -3
Gap Penalties: Existence: 5, Extension: 2
Number of Hits to DB: 11,893
Number of Sequences: 6905
Number of extensions: 11893
Number of successful extensions: 1123
Number of sequences better than 10.0: 337
length of query: 583
length of database: 5,674,871
effective HSP length: 16
effective length of query: 567
effective length of database: 5,564,391
effective search space: 3155009697
effective search space used: 3155009697
T: 0
A: 40
X1: 6 (11.9 bits)
X2: 15 (29.7 bits)
S1: 12 (24.3 bits)
S2: 14 (28.2 bits)
dna update 2008.11.21
Homology vs DNA
Query= Contig-U10660-1 (Contig-U10660-1Q) /CSM_Contig/Contig-U10660-1Q.Seq.d
(583 letters)

Database: ddbj_A
92,845,959 sequences; 95,242,211,685 total letters

Searching..................................................done

Score E
Sequences producing significant alignments: (bits) Value N

(BJ435728) Dictyostelium discoideum cDNA clone:ddv28g04, 3' ... 940 0.0 2
(AU266772) Dictyostelium discoideum vegetative cDNA clone:VS... 763 0.0 3
(AU265392) Dictyostelium discoideum vegetative cDNA clone:VS... 670 0.0 4
(AU265393) Dictyostelium discoideum vegetative cDNA clone:VS... 250 5e-62 1
(EJ223599) 1092351316291 Global-Ocean-Sampling_GS-27-01-01-1... 48 0.35 1
(AM653971) Entamoeba moshkovskii FIC GSS, clone mosh007b10.p1k. 36 0.98 2
(BA000026) Mycoplasma penetrans HF-2 DNA, complete genome. 36 1.2 13
(BX530062) Zebrafish DNA sequence from clone DKEY-13M1 in li... 46 1.4 1
(BC068345) Danio rerio arrestin domain containing 2, mRNA (c... 46 1.4 1
(AY423023) Danio rerio KIAA1376-like protein mRNA, complete ... 46 1.4 1
(AM910994) Plasmodium knowlesi strain H chromosome 12, compl... 46 1.4 1
(EJ095325) 1095460286520 Global-Ocean-Sampling_GS-26-01-01-1... 46 1.4 1
(EJ091961) 1095460200981 Global-Ocean-Sampling_GS-26-01-01-1... 46 1.4 1
(EJ080832) 1095460024457 Global-Ocean-Sampling_GS-26-01-01-1... 46 1.4 1
(EB957132) 11721824 ZF35 Danio rerio cDNA clone 3432269, mRN... 46 1.4 1
(EB919339) 10888354 ZF31 Danio rerio cDNA clone 3263521, mRN... 46 1.4 1
(EB902329) 12343472 ZF28 Danio rerio cDNA clone 3319284, mRN... 46 1.4 1
(EB881272) 9348023 ZF24 Danio rerio cDNA clone 3182869, mRNA... 46 1.4 1
(DV599635) AGENCOURT_62296044 NIH_ZGC_14 Danio rerio cDNA cl... 46 1.4 1
(DT072966) AGENCOURT_56113745 NIH_ZGC_10 Danio rerio cDNA cl... 46 1.4 1
(CT654158) Danio rerio EST, clone ZF_mu_135f09 5'. 46 1.4 1
(CT593528) Danio rerio EST, clone ZF_mu_14l16 5'. 46 1.4 1
(CF594865) AGENCOURT_15713771 NIH_ZGC_8 Danio rerio cDNA clo... 46 1.4 1
(CD604048) RZ151A3A03.T3 Zebrafish Kidney Marrow cDNA librar... 46 1.4 1
(CD599427) RK116A2D03.T3 Zebrafish Kidney Marrow cDNA librar... 46 1.4 1
(CD592213) RK071A2E08.T3 Zebrafish Kidney Marrow cDNA librar... 46 1.4 1
(CB361157) ZF001-P00032-DPE-F-A_E06 GISZF001 Danio rerio cDN... 46 1.4 1
(CA787593) AGENCOURT_11031637 NCI_CGAP_ZKid1 Danio rerio cDN... 46 1.4 1
(BQ263766) faa16g08.y1 Sugano SJD adult male Danio rerio cDN... 46 1.4 1
(BM082511) fu22b09.y1 Campbell zebrafish ovary Danio rerio c... 46 1.4 1
(BI842955) fr01c01.y1 zebrafish fin day3 regeneration Danio ... 46 1.4 1
(BG883536) fp26c02.y1 zebrafish gridded kidney Danio rerio c... 46 1.4 1
(AW419947) fj85e08.y1 zebrafish gridded kidney Danio rerio c... 46 1.4 1
(EV558905) DR_4WG_FL08_G06 4-week-old gonad (TLL) Danio reri... 46 1.4 1
(AW233123) fj28d08.y1 Zebrafish adult olfactory Danio rerio ... 46 1.4 1
(CP000568) Clostridium thermocellum ATCC 27405, complete gen... 46 1.4 1
(CP000742) Methanococcus vannielii SB, complete genome. 36 2.0 14
(BH051127) RPCI-24-336J23.TJB RPCI-24 Mus musculus genomic c... 38 2.0 2
(BH029088) RPCI-24-336F23.TJB RPCI-24 Mus musculus genomic c... 38 2.1 2
(AM623713) Entamoeba dispar GSS, clone dispar102g06.q1k. 40 2.4 2
(EF070296) Tetrahymena paravorax strain RP cytochrome oxidas... 36 3.2 3
(BV517943) soe01g12.g1 Clint Pan troglodytes verus STS genom... 44 5.5 1
(L42952) Malus domestica Ap15 mRNA, complete cds. 44 5.5 1
(AY789241) Malus x domestica major allergen Mal d 1.02 (Mal ... 44 5.5 1
(AY789240) Malus x domestica major allergen Mal d 1.02 (Mal ... 44 5.5 1
(AY789239) Malus x domestica major allergen Mal d 1.02 (Mal ... 44 5.5 1
(AY428578) Malus x domestica clone 1b Mal d 1-like mRNA, com... 44 5.5 1
(AY026911) Malus x domestica ribonuclease-like PR-10a (YPR10... 44 5.5 1
(AF124836) Malus domestica clone Ga6 major allergen mal d 1 ... 44 5.5 1
(AF124835) Malus domestica clone Ja3 major allergen mal d 1 ... 44 5.5 1
(AF124834) Malus domestica clone Gl2 major allergen mal d 1 ... 44 5.5 1
(AF124833) Malus domestica clone GD1 major allergen mal d 1 ... 44 5.5 1
(AF074721) Malus domestica major allergen Mal d 1 (MALD1) mR... 44 5.5 1
(AF020542) Malus domestica major allergen Mal d 1 gene, comp... 44 5.5 1
(AC010404) Homo sapiens chromosome 4 clone CTD-2149O24, comp... 44 5.5 1
(AC100357) Mus musculus clone RP23-128F4, LOW-PASS SEQUENCE ... 44 5.5 1
(CU694548) Pig DNA sequence *** SEQUENCING IN PROGRESS *** f... 44 5.5 1
(AC230137) Bos taurus clone CH240-519I7, WORKING DRAFT SEQUE... 44 5.5 1
(AC167082) Oryctolagus cuniculus clone LB1-288J13, WORKING D... 44 5.5 1
(ER880280) MUGQ_CH252P271H12Sp6_CN567_042 CHORI-252 Vervet M... 44 5.5 1
(EK191649) 1095460021190 Global-Ocean-Sampling_GS-31-01-01-1... 44 5.5 1
(AV402937) Bombyx mori cDNA clone:heS30753. 44 5.5 1
(EB178020) 000929AAFA009004HT (AAFA) Royal Gala apple skin p... 44 5.5 1
(EB178008) 020812AAFA012367HT (AAFA) Royal Gala apple skin p... 44 5.5 1
(EB177975) 020812AAFA012292HT (AAFA) Royal Gala apple skin p... 44 5.5 1
(EB177853) 020807AAFA012175HT (AAFA) Royal Gala apple skin p... 44 5.5 1
(EB177080) 001001AAFA008099HT (AAFA) Royal Gala apple skin p... 44 5.5 1
(EB176812) 000928AAFA006942HT (AAFA) Royal Gala apple skin p... 44 5.5 1
(EB176611) 000918AAFA004528HT (AAFA) Royal Gala apple skin p... 44 5.5 1
(EB176403) 000917AAFA006132HT (AAFA) Royal Gala apple skin p... 44 5.5 1
(EB176221) 000917AAFA005263HT (AAFA) Royal Gala apple skin p... 44 5.5 1
(EB175667) 000901AAFA002952HT (AAFA) Royal Gala apple skin p... 44 5.5 1
(EB153468) 021015ABLB999060HT (ABLB) Braeburn cell culture t... 44 5.5 1
(EB152880) 030210ABPB005875HT (ABPB) M9 root tips Malus x do... 44 5.5 1
(EB151429) 021203ABPB999091HT (ABPB) M9 root tips Malus x do... 44 5.5 1
(EB151310) 030203ABPB003924HT (ABPB) M9 root tips Malus x do... 44 5.5 1
(EB150497) 011030ABEA006830HT (ABEA) Royal Gala seedling lea... 44 5.5 1
(EB149902) 011027ABEA005545HT (ABEA) Royal Gala seedling lea... 44 5.5 1
(EB146447) 010908ABEA999019HT (ABEA) Royal Gala seedling lea... 44 5.5 1
(EB146144) 021018ABCA005311HT (ABCA) Royal Gala fruit stored... 44 5.5 1
(EB145987) 021016ABCA004531HT (ABCA) Royal Gala fruit stored... 44 5.5 1
(EB145720) 021016ABCA003339HT (ABCA) Royal Gala fruit stored... 44 5.5 1
(EB145646) 021015ABCA003129HT (ABCA) Royal Gala fruit stored... 44 5.5 1
(EB145407) 021014ABCA005129HT (ABCA) Royal Gala fruit stored... 44 5.5 1
(EB144509) 021008ABCA002572HT (ABCA) Royal Gala fruit stored... 44 5.5 1
(EB144488) 011003ABDA007036HT (ABDA) Royal Gala fruit stored... 44 5.5 1
(EB144461) 011003ABDA006921HT (ABDA) Royal Gala fruit stored... 44 5.5 1
(EB144444) 011003ABDA006870HT (ABDA) Royal Gala fruit stored... 44 5.5 1
(EB144276) 010930ABDA006487HT (ABDA) Royal Gala fruit stored... 44 5.5 1
(EB144255) 010930ABDA006419HT (ABDA) Royal Gala fruit stored... 44 5.5 1
(EB143420) 010928ABDA003279HT (ABDA) Royal Gala fruit stored... 44 5.5 1
(EB143182) 010926ABDA002869HT (ABDA) Royal Gala fruit stored... 44 5.5 1
(EB142971) 010901ABDA002173HT (ABDA) Royal Gala fruit stored... 44 5.5 1
(EB142938) 010901ABDA002075HT (ABDA) Royal Gala fruit stored... 44 5.5 1
(EB142737) 010831ABDA001470HT (ABDA) Royal Gala fruit stored... 44 5.5 1
(EB142040) 010811AASB002181HT (AASB) Royal Gala 10 DAFB frui... 44 5.5 1
(EB141246) 010813AASB003355HT (AASB) Royal Gala 10 DAFB frui... 44 5.5 1
(EB141215) 010813AASB001629HT (AASB) Royal Gala 10 DAFB frui... 44 5.5 1
(EB118124) 000817AALB001312HT (AALB) Royal Gala 150 DAFB fru... 44 5.5 1
(EB117826) 001001AALA009646HT (AALA) Royal Gala 150 DAFB fru... 44 5.5 1

>(BJ435728) Dictyostelium discoideum cDNA clone:ddv28g04, 3' end,
single read.
Length = 544

Score = 940 bits (474), Expect(2) = 0.0
Identities = 477/477 (100%)
Strand = Plus / Minus


Query: 1 caaagataatgatgaaacttgggaaccattattaattttaattccaatgagattaggttt 60
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 544 caaagataatgatgaaacttgggaaccattattaattttaattccaatgagattaggttt 485


Query: 61 ggatggattaaatagtatttatcattcttcattgttagaaatctttaagtttcctcaaaa 120
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 484 ggatggattaaatagtatttatcattcttcattgttagaaatctttaagtttcctcaaaa 425


Query: 121 tnttggtgttgttggtggaaaaccaagagcatcactttattttatcgctgcacaagatga 180
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 424 tnttggtgttgttggtggaaaaccaagagcatcactttattttatcgctgcacaagatga 365


Query: 181 taacttattttatttagatccacatactgttcaaaatcatatagaagttgaaaatggttc 240
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 364 taacttattttatttagatccacatactgttcaaaatcatatagaagttgaaaatggttc 305


Query: 241 taaattccctttaaataccttcttttgtagcaccacaaagagaacacatgtttcagaagt 300
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 304 taaattccctttaaataccttcttttgtagcaccacaaagagaacacatgtttcagaagt 245


Query: 301 tgacccatcattggtagttgctttcttttgcaagaccaaagatgattttaatgattttgt 360
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 244 tgacccatcattggtagttgctttcttttgcaagaccaaagatgattttaatgattttgt 185


Query: 361 tgaaagatcaaaaaagatgacatctcaaatggaaaatccaattttctcaatatttgataa 420
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 184 tgaaagatcaaaaaagatgacatctcaaatggaaaatccaattttctcaatatttgataa 125


Query: 421 tgaaccagattatgattcaagtcgtgattatgaatatgaagaaattgatgaaactgg 477
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 124 tgaaccagattatgattcaagtcgtgattatgaatatgaagaaattgatgaaactgg 68

Score = 131 bits (66), Expect(2) = 0.0
Identities = 66/66 (100%)
Strand = Plus / Minus


Query: 477 ggtggtgagacatctgacgatatagatatcgaagctgactatcatatgtatgtaataaat 536
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 69 ggtggtgagacatctgacgatatagatatcgaagctgactatcatatgtatgtaataaat 10


Query: 537 taattc 542
||||||
Sbjct: 9 taattc 4

Lambda K H
1.37 0.711 1.31

Matrix: blastn matrix:1 -3
Number of Sequences: 92845959
Number of Hits to DB: 782,106,281
Number of extensions: 50547342
Number of successful extensions: 4023546
Number of sequences better than 10.0: 183
Length of query: 583
Length of database: 95,242,211,685
Length adjustment: 23
Effective length of query: 560
Effective length of database: 93,106,754,628
Effective search space: 52139782591680
Effective search space used: 52139782591680
X1: 11 (21.8 bits)
S2: 22 (44.1 bits)

protein update 2009. 6.28
Homology vs Protein
Query= Contig-U10660-1 (Contig-U10660-1Q) /CSM_Contig/Contig-U10660-1Q.Seq.d
(583 letters)

Database: nrp_A
3,204,285 sequences; 1,040,966,779 total letters

Searching..................................................done

Score E
Sequences producing significant alignments: (bits) Value

BC134886_1(BC134886|pid:none) Danio rerio ATG4 autophagy related... 127 3e-28
AJ504653_1(AJ504653|pid:none) Mus musculus mRNA for autophagin-1... 124 2e-27
AK302963_1(AK302963|pid:none) Homo sapiens cDNA FLJ56391 complet... 123 4e-27
(Q9Y4P1) RecName: Full=Cysteine protease ATG4B; EC=3.4.... 123 4e-27
AK316167_1(AK316167|pid:none) Homo sapiens cDNA, FLJ79066 comple... 123 4e-27
AB023160_1(AB023160|pid:none) Homo sapiens mRNA for KIAA0943 pro... 123 4e-27
AK027462_1(AK027462|pid:none) Homo sapiens cDNA FLJ14556 fis, cl... 122 9e-27
AC133528_3(AC133528|pid:none) Homo sapiens BAC clone RP11-367H1 ... 122 9e-27
AK296818_1(AK296818|pid:none) Homo sapiens cDNA FLJ55223 complet... 122 9e-27
(Q6PZ02) RecName: Full=Cysteine protease ATG4B; EC=3.4.... 121 1e-26
AK088811_1(AK088811|pid:none) Mus musculus 2 days neonate thymus... 121 1e-26
AK027763_1(AK027763|pid:none) Homo sapiens cDNA FLJ14857 fis, cl... 120 2e-26
(Q640G7) RecName: Full=Cysteine protease ATG4B; EC=3.4.... 120 3e-26
AK298109_1(AK298109|pid:none) Homo sapiens cDNA FLJ55469 complet... 120 3e-26
BC095617_1(BC095617|pid:none) Danio rerio zgc:111958, mRNA (cDNA... 120 3e-26
AB172765_1(AB172765|pid:none) Macaca fascicularis brain cDNA clo... 120 3e-26
BT039657_1(BT039657|pid:none) Zea mays full-length cDNA clone ZM... 119 6e-26
BT037469_1(BT037469|pid:none) Zea mays full-length cDNA clone ZM... 119 6e-26
BC121870_1(BC121870|pid:none) Xenopus tropicalis cysteine endope... 119 8e-26
FJ750847_1(FJ750847|pid:none) Triticum aestivum cysteine protein... 119 8e-26
BT054942_1(BT054942|pid:none) Zea mays full-length cDNA clone ZM... 118 1e-25
(Q9M1Y0) RecName: Full=Cysteine protease ATG4b; EC=3.4.... 118 1e-25
(Q75KP8) RecName: Full=Cysteine protease ATG4A; EC=3.4.... 117 2e-25
AP008209_1637(AP008209|pid:none) Oryza sativa (japonica cultivar... 117 2e-25
(Q2XPP4) RecName: Full=Cysteine protease ATG4B; EC=3.4.... 117 2e-25
(Q7XPW8) RecName: Full=Cysteine protease ATG4B; EC=3.4.... 117 2e-25
AC004005_28(AC004005|pid:none) Arabidopsis thaliana chromosome 2... 116 5e-25
(Q8S929) RecName: Full=Cysteine protease ATG4a; EC=3.4.... 116 5e-25
AM458338_2(AM458338|pid:none) Vitis vinifera contig VV78X165900.... 111 1e-23
AK041379_1(AK041379|pid:none) Mus musculus 3 days neonate thymus... 108 8e-23
(Q96KQ1) RecName: Full=Cysteine protease ATG4A; EC=3.4.... 108 1e-22
BC041862_1(BC041862|pid:none) Homo sapiens ATG4 autophagy relate... 108 1e-22
AY069453_1(AY069453|pid:none) Drosophila melanogaster LD17482 fu... 108 1e-22
AY191018_1(AY191018|pid:none) Dictyostelium discoideum autophagy... 107 2e-22
(Q557H7) RecName: Full=Cysteine protease atg4; EC=3.4.2... 107 2e-22
AC116330_13(AC116330|pid:none) Dictyostelium discoideum chromoso... 107 2e-22
(Q6PZ05) RecName: Full=Cysteine protease ATG4A; EC=3.4.... 107 2e-22
BC122931_1(BC122931|pid:none) Xenopus tropicalis APG4 autophagy ... 107 3e-22
BC157740_1(BC157740|pid:none) Xenopus laevis hypothetical protei... 106 4e-22
AL031177_11(AL031177|pid:none) Human DNA sequence from clone RP5... 106 5e-22
(Q5R699) RecName: Full=Cysteine protease ATG4A; EC=3.4.... 105 7e-22
(Q6GPU1) RecName: Full=Cysteine protease ATG4A; EC=3.4.... 104 2e-21
AL732352_9(AL732352|pid:none) Oryza sativa genomic DNA, chromoso... 102 6e-21
BC160890_1(BC160890|pid:none) Rattus norvegicus similar to Cyste... 102 8e-21
(A7KAL5) RecName: Full=Probable cysteine protease atg4; ... 102 1e-20
AC099323_1(AC099323|pid:none) Oryza sativa chromosome 3 BAC OSJN... 101 1e-20
T27461(T27461)hypothetical protein Y87G2A.i - Caenorhabditis ele... 100 5e-20
BT075925_1(BT075925|pid:none) Caligus rogercresseyi clone crog-e... 100 5e-20
AE014134_198(AE014134|pid:none) Drosophila melanogaster chromoso... 99 6e-20
(A2QY50) RecName: Full=Probable cysteine protease atg4; ... 99 8e-20
BC018678_1(BC018678|pid:none) Homo sapiens ATG4 autophagy relate... 98 2e-19
BC133598_1(BC133598|pid:none) Bos taurus ATG4 autophagy related ... 98 2e-19
(Q96DT6) RecName: Full=Cysteine protease ATG4C; EC=3.4.... 97 2e-19
BC168141_1(BC168141|pid:none) Rattus norvegicus ATG4 autophagy r... 97 3e-19
BT080720_1(BT080720|pid:none) Caligus clemensi clone ccle-evs-51... 96 5e-19
BC142399_1(BC142399|pid:none) Bos taurus ATG4 autophagy related ... 96 5e-19
(Q8BGV9) RecName: Full=Cysteine protease ATG4D; EC=3.4.... 96 7e-19
(Q2U5B0) RecName: Full=Probable cysteine protease atg4; ... 96 9e-19
BC058981_1(BC058981|pid:none) Mus musculus autophagy-related 4C ... 95 1e-18
(Q811C2) RecName: Full=Cysteine protease ATG4C; EC=3.4.... 95 1e-18
BC149849_1(BC149849|pid:none) Bos taurus ATG4 autophagy related ... 95 1e-18
(Q4U3V5) RecName: Full=Probable cysteine protease ATG4; ... 95 1e-18
(Q684M2) RecName: Full=Cysteine protease ATG4D; EC=3.4.... 95 1e-18
BC071514_1(BC071514|pid:none) Danio rerio autophagy-related 4C (... 95 1e-18
(Q5B7L0) RecName: Full=Cysteine protease atg4; EC=3.4.2... 95 1e-18
(Q86TL0) RecName: Full=Cysteine protease ATG4D; EC=3.4.... 95 2e-18
AX118991_1(AX118991|pid:none) Sequence 155 from Patent WO0129221. 95 2e-18
(Q6CH28) RecName: Full=Probable cysteine protease ATG4; ... 94 2e-18
AK056210_1(AK056210|pid:none) Homo sapiens cDNA FLJ31648 fis, cl... 94 2e-18
AK223383_1(AK223383|pid:none) Homo sapiens mRNA for APG4 autopha... 94 3e-18
AJ720212_1(AJ720212|pid:none) Gallus gallus mRNA for hypothetica... 94 3e-18
(Q9P373) RecName: Full=Probable cysteine protease atg4; ... 93 5e-18
(A3LQU0) RecName: Full=Probable cysteine protease ATG4; ... 92 1e-17
AK027332_1(AK027332|pid:none) Homo sapiens cDNA FLJ14426 fis, cl... 92 1e-17
(Q5XH30) RecName: Full=Cysteine protease ATG4C; EC=3.4.... 91 2e-17
(Q6CQ60) RecName: Full=Probable cysteine protease ATG4; ... 88 1e-16
(A1CJ08) RecName: Full=Probable cysteine protease atg4; ... 88 2e-16
(Q6BYP8) RecName: Full=Probable cysteine protease ATG4; ... 87 3e-16
(Q7S3X7) RecName: Full=Probable cysteine protease atg-4; ... 87 4e-16
(Q2HH40) RecName: Full=Probable cysteine protease ATG4; ... 86 1e-15
CP000584_17(CP000584|pid:none) Ostreococcus lucimarinus CCE9901 ... 86 1e-15
FJ374666_1(FJ374666|pid:none) Magnaporthe oryzae strain Guy11 AT... 83 5e-15
(Q523C3) RecName: Full=Cysteine protease ATG4; EC=3.4.2... 83 5e-15
(Q5K9L9) RecName: Full=Cysteine protease ATG4; EC=3.4.2... 80 5e-14
FN357298_5(FN357298|pid:none) Schistosoma mansoni genome sequenc... 78 2e-13
(Q75E61) RecName: Full=Probable cysteine protease ATG4; ... 78 2e-13
(A5DSB4) RecName: Full=Probable cysteine protease ATG4; ... 77 3e-13
(Q59UG3) RecName: Full=Cysteine protease ATG4; EC=3.4.2... 77 4e-13
CU928178_656(CU928178|pid:none) Zygosaccharomyces rouxii strain ... 75 1e-12
CU928166_344(CU928166|pid:none) Kluyveromyces thermotolerans str... 75 1e-12
(A7KAI3) RecName: Full=Probable cysteine protease ATG4; ... 75 1e-12
(Q0U199) RecName: Full=Probable cysteine protease ATG4; ... 75 1e-12
FN392319_1312(FN392319|pid:none) Pichia pastoris GS115 chromosom... 75 2e-12
D88844(D88844)protein ZK792.1 [imported] - Caenorhabditis elegans 70 4e-11
BC007639_1(BC007639|pid:none) Homo sapiens ATG4 autophagy relate... 69 7e-11
AK123425_1(AK123425|pid:none) Homo sapiens cDNA FLJ41431 fis, cl... 69 7e-11
AE014187_168(AE014187|pid:none) Plasmodium falciparum 3D7 chromo... 69 9e-11
(A7TQN1) RecName: Full=Probable cysteine protease ATG4; ... 68 2e-10
AL031177_12(AL031177|pid:none) Human DNA sequence from clone RP5... 67 3e-10
(Q6FP20) RecName: Full=Probable cysteine protease ATG4; ... 65 1e-09
S63181(S63181;S63189;S67375;S72093) hypothetical protein YNL223w... 65 2e-09
AM910995_307(AM910995|pid:none) Plasmodium knowlesi strain H chr... 62 1e-08
FN357388_26(FN357388|pid:none) Schistosoma mansoni genome sequen... 60 4e-08
AM494969_412(AM494969|pid:none) Leishmania braziliensis chromoso... 59 7e-08
AJ320509_1(AJ320509|pid:none) Homo sapiens mRNA for putative aut... 59 1e-07
AK293533_1(AK293533|pid:none) Homo sapiens cDNA FLJ60428 complet... 59 1e-07
DQ768298_1(DQ768298|pid:none) Trypanosoma cruzi autophagin-2 gen... 57 4e-07
CT005269_405(CT005269|pid:none) Leishmania major strain Friedlin... 57 5e-07
AM502248_26(AM502248|pid:none) Leishmania infantum chromosome 30. 52 9e-06
(Q8NJJ3) RecName: Full=Probable cysteine protease ATG4; ... 52 1e-05
AC013353_22(AC013353|pid:none) Trypanosoma brucei chromosome 6 c... 48 2e-04
CR548612_310(CR548612|pid:none) Paramecium tetraurelia macronucl... 40 0.060
AL772148_1(AL772148|pid:none) Zebrafish DNA sequence from clone ... 33 4.3
FN357416_32(FN357416|pid:none) Schistosoma mansoni genome sequen... 33 7.3
FN392322_72(FN392322|pid:none) Pichia pastoris GS115 chromosome ... 32 9.5
CR940352_340(CR940352|pid:none) Theileria annulata strain Ankara... 32 9.5

>BC134886_1(BC134886|pid:none) Danio rerio ATG4 autophagy related 4
homolog B (S. cerevisiae), mRNA (cDNA clone MGC:162096
IMAGE:7918031), complete cds.
Length = 394

Score = 127 bits (318), Expect = 3e-28
Identities = 56/139 (40%), Positives = 88/139 (63%), Gaps = 1/139 (0%)
Frame = +2

Query: 20 WEPLLILIPMRLGLDGLNSIYHSSLLEIFKFPQNXGVVGGKPRASLYFIAAQDDNLFYLD 199
W+PL++LIP+RLGL +N Y L + F PQ+ GV+GGKP ++ YFI D L YLD
Sbjct: 221 WKPLVLLIPLRLGLSDINEAYIEPLKQCFMMPQSLGVIGGKPNSAHYFIGFVGDELIYLD 280

Query: 200 PHTVQNHIEVENGSKFPLNTFFCSTTK-RTHVSEVDPSLVVAFFCKTKDDFNDFVERSKK 376
PHT Q ++ FP +++ C R H+ E+DPS+ FFC+T+DDF+D+ + +K
Sbjct: 281 PHTTQPAVDPSEDGHFPDDSYHCQHPPCRMHICELDPSIAAGFFCQTEDDFDDWCAQIRK 340

Query: 377 MTSQMENPIFSIFDNEPDY 433
+++ P+F + D++P +
Sbjct: 341 VSNCRGLPMFELVDSQPSH 359

Lambda K H
0.318 0.134 0.401

Gapped
Lambda K H
0.267 0.0410 0.140

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3204285
Number of Hits to DB: 851,895,959
Number of extensions: 16154031
Number of successful extensions: 31856
Number of sequences better than 10.0: 116
Number of HSP's gapped: 31751
Number of HSP's successfully gapped: 121
Length of query: 194
Length of database: 1,040,966,779
Length adjustment: 122
Effective length of query: 72
Effective length of database: 650,044,009
Effective search space: 46803168648
Effective search space used: 46803168648
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 30 (16.2 bits)

PSORT

psg: 0.75 gvh: 0.57 alm: 0.39 top: 0.53 tms: 0.00 mit: 0.15 mip: 0.00
nuc: 0.00 erl: 0.00 erm: 0.00 pox: 0.00 px2: 0.00 vac: 0.00 rnp: 0.00
act: 0.00 caa: 0.00 yqr: 0.00 tyr: 0.00 leu: 0.00 gpi: 0.00 myr: 0.00
dna: 0.00 rib: 0.00 bac: 0.00 m1a: 0.00 m1b: 0.00 m2 : 0.00 mNt: 0.00
m3a: 0.00 m3b: 0.00 m_ : 1.00

52.0 %: cytoplasmic
28.0 %: nuclear
12.0 %: mitochondrial
4.0 %: cytoskeletal
4.0 %: Golgi

>> prediction for Contig-U10660-1 is cyt

VS (DIR, S) 2
VH (FL, L) 0
VF (FL, S) 1
AH (FL, L) 0
AF (FL, S) 0
SL (DIR, L) 0
SS (DIR, S) 0
SH (FL, L) 0
SF (FL, S) 0
CH (FL, L) 0
CF (FL, S) 0
FCL (DIR, L) 0
FC (DIR, S) 0
FC-IC (SUB) 0