| Homology vs CSM-cDNA |
 |
| Homology vs DNA |
Query= Contig-U10658-1 (Contig-U10658-1Q) /CSM_Contig/Contig-U10658-1Q.Seq.d
(755 letters)
Database: ddbj_A
92,845,959 sequences; 95,242,211,685 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value N
(BJ435502) Dictyostelium discoideum cDNA clone:ddv27h08, 3' ... 430 0.0 3
(U72746) Dictyostelium discoideum cysteine proteinase (cprG)... 381 0.0 4
(BJ436194) Dictyostelium discoideum cDNA clone:ddv30g11, 3' ... 341 e-178 4
(BJ432718) Dictyostelium discoideum cDNA clone:ddv19d17, 3' ... 341 e-177 4
(BJ432398) Dictyostelium discoideum cDNA clone:ddv18g14, 3' ... 341 e-177 4
(BJ428641) Dictyostelium discoideum cDNA clone:ddv12n18, 3' ... 341 e-177 4
(BJ441527) Dictyostelium discoideum cDNA clone:ddv47a01, 3' ... 341 e-177 4
(BJ432573) Dictyostelium discoideum cDNA clone:ddv19h03, 3' ... 341 e-177 4
(BJ437611) Dictyostelium discoideum cDNA clone:ddv34e22, 3' ... 341 e-177 4
(BJ442688) Dictyostelium discoideum cDNA clone:ddv50n13, 3' ... 341 e-176 4
(BJ432433) Dictyostelium discoideum cDNA clone:ddv18m15, 3' ... 341 e-175 4
(BJ376592) Dictyostelium discoideum cDNA clone:ddc29m04, 3' ... 341 e-175 4
(BJ429721) Dictyostelium discoideum cDNA clone:ddv4l16, 3' e... 341 e-174 4
(AU284337) Dictyostelium discoideum gamete cDNA clone:FC-AM2... 341 e-174 4
(BJ433931) Dictyostelium discoideum cDNA clone:ddv23j10, 3' ... 341 e-173 4
(BJ429076) Dictyostelium discoideum cDNA clone:ddv2d10, 3' e... 341 e-172 5
(BJ435400) Dictyostelium discoideum cDNA clone:ddv27c02, 3' ... 341 e-172 4
(BJ434429) Dictyostelium discoideum cDNA clone:ddv16h20, 3' ... 341 e-172 4
(BJ432956) Dictyostelium discoideum cDNA clone:ddv20h10, 3' ... 281 e-171 5
(BJ433576) Dictyostelium discoideum cDNA clone:ddv22f10, 3' ... 341 e-171 4
(BJ435912) Dictyostelium discoideum cDNA clone:ddv28m24, 3' ... 341 e-171 4
(BJ435481) Dictyostelium discoideum cDNA clone:ddv27c08, 3' ... 341 e-171 4
(BJ432089) Dictyostelium discoideum cDNA clone:ddv17h16, 3' ... 341 e-168 4
(BJ435535) Dictyostelium discoideum cDNA clone:ddv27n09, 3' ... 341 e-166 4
(AU039287) Dictyostelium discoideum slug cDNA, clone SLH355. 341 e-161 4
(BJ427945) Dictyostelium discoideum cDNA clone:ddv10l05, 3' ... 341 e-155 3
(BJ429672) Dictyostelium discoideum cDNA clone:ddv4b16, 3' e... 341 e-155 3
(BJ432758) Dictyostelium discoideum cDNA clone:ddv19o17, 3' ... 341 e-155 3
(BJ431964) Dictyostelium discoideum cDNA clone:ddv17n02, 3' ... 341 e-155 3
(AU284394) Dictyostelium discoideum gamete cDNA clone:FC-AR1... 341 e-155 3
(BJ435341) Dictyostelium discoideum cDNA clone:ddv26h19, 3' ... 341 e-155 3
(BJ430532) Dictyostelium discoideum cDNA clone:ddv7h14, 3' e... 341 e-155 3
(BJ435202) Dictyostelium discoideum cDNA clone:ddv26l10, 3' ... 341 e-155 3
(AU033726) Dictyostelium discoideum slug cDNA, clone SLB364. 341 e-155 3
(AU033657) Dictyostelium discoideum slug cDNA, clone SLB276. 341 e-155 3
(BJ436225) Dictyostelium discoideum cDNA clone:ddv30p08, 3' ... 341 e-155 3
(BJ433744) Dictyostelium discoideum cDNA clone:ddv22f22, 3' ... 341 e-155 3
(BJ435047) Dictyostelium discoideum cDNA clone:ddv25k23, 3' ... 341 e-155 3
(AU284432) Dictyostelium discoideum gamete cDNA clone:FC-AV0... 341 e-155 3
(BJ434925) Dictyostelium discoideum cDNA clone:ddv25o10, 3' ... 341 e-155 3
(BJ433530) Dictyostelium discoideum cDNA clone:ddv22m02, 3' ... 341 e-155 3
(BJ430329) Dictyostelium discoideum cDNA clone:ddv6j21, 3' e... 341 e-155 3
(BJ434478) Dictyostelium discoideum cDNA clone:ddv24a05, 3' ... 341 e-155 3
(BJ437576) Dictyostelium discoideum cDNA clone:ddv34n17, 3' ... 341 e-155 3
(BJ431589) Dictyostelium discoideum cDNA clone:ddv14p14, 3' ... 341 e-153 3
(BJ437901) Dictyostelium discoideum cDNA clone:ddv35a20, 3' ... 341 e-153 3
(BJ435450) Dictyostelium discoideum cDNA clone:ddv27l05, 3' ... 333 e-153 3
(BJ434945) Dictyostelium discoideum cDNA clone:ddv25c15, 3' ... 341 e-152 3
(BJ433449) Dictyostelium discoideum cDNA clone:ddv21m22, 3' ... 341 e-150 3
(AU053309) Dictyostelium discoideum slug cDNA, clone SLI367. 341 e-150 3
(BJ432952) Dictyostelium discoideum cDNA clone:ddv20g11, 3' ... 281 e-148 4
(BJ432574) Dictyostelium discoideum cDNA clone:ddv19h04, 3' ... 238 e-147 4
(AU054056) Dictyostelium discoideum slug cDNA, clone SLK520. 341 e-144 2
(AU052880) Dictyostelium discoideum slug cDNA, clone SLF260. 341 e-144 2
(BJ433147) Dictyostelium discoideum cDNA clone:ddv20m22, 3' ... 333 e-140 2
(AU052763) Dictyostelium discoideum slug cDNA, clone SLK602. 226 e-139 3
(BJ435953) Dictyostelium discoideum cDNA clone:ddv29j03, 3' ... 281 e-135 4
(BJ432539) Dictyostelium discoideum cDNA clone:ddv19a06, 3' ... 301 e-133 2
(AU034217) Dictyostelium discoideum slug cDNA, clone SLC271. 341 e-133 2
(BJ429400) Dictyostelium discoideum cDNA clone:ddv3i08, 3' e... 210 e-132 5
(BJ428195) Dictyostelium discoideum cDNA clone:ddv11f06, 3' ... 226 e-132 4
(AU053420) Dictyostelium discoideum slug cDNA, clone SLI616. 341 e-128 2
(AU039686) Dictyostelium discoideum slug cDNA, clone SLG183. 327 e-127 2
(AU052906) Dictyostelium discoideum slug cDNA, clone SLF303. 341 e-122 2
(BJ435882) Dictyostelium discoideum cDNA clone:ddv28e23, 3' ... 230 e-122 3
(AU052382) Dictyostelium discoideum slug cDNA, clone SLD227. 341 e-120 2
(BJ416778) Dictyostelium discoideum cDNA clone:ddv27c08, 5' ... 381 e-119 3
(BJ428470) Dictyostelium discoideum cDNA clone:ddv12f02, 3' ... 202 e-103 3
(AU061899) Dictyostelium discoideum slug cDNA, clone SLG536. 381 e-101 1
(BJ429378) Dictyostelium discoideum cDNA clone:ddv3d09, 3' e... 341 3e-94 2
(AU039897) Dictyostelium discoideum slug cDNA, clone SLG690. 341 2e-89 1
(AU034931) Dictyostelium discoideum slug cDNA, clone SLE358. 337 4e-88 1
(BJ435901) Dictyostelium discoideum cDNA clone:ddv28k23, 3' ... 331 2e-86 1
(AU053008) Dictyostelium discoideum slug cDNA, clone SLF506. 325 1e-84 1
(BJ435042) Dictyostelium discoideum cDNA clone:ddv25j24, 3' ... 210 3e-82 4
(AU052566) Dictyostelium discoideum slug cDNA, clone SLD531. 301 2e-77 1
(BJ431827) Dictyostelium discoideum cDNA clone:ddv15p16, 3' ... 190 7e-72 2
(BJ441288) Dictyostelium discoideum cDNA clone:ddv46b12, 3' ... 198 2e-65 5
(BJ432053) Dictyostelium discoideum cDNA clone:ddv17p09, 3' ... 184 2e-65 6
(BJ431127) Dictyostelium discoideum cDNA clone:ddv9o24, 3' e... 198 2e-65 5
(BJ429786) Dictyostelium discoideum cDNA clone:ddv4j22, 3' e... 198 2e-65 5
(U72745) Dictyostelium discoideum cysteine proteinase (cprF)... 198 2e-64 5
(BJ432386) Dictyostelium discoideum cDNA clone:ddv18e14, 3' ... 192 8e-64 5
(BJ409826) Dictyostelium discoideum cDNA clone:ddv10l05, 5' ... 256 1e-63 1
(BJ435007) Dictyostelium discoideum cDNA clone:ddv25b24, 3' ... 184 1e-61 5
(BJ429337) Dictyostelium discoideum cDNA clone:ddv3k06, 3' e... 184 1e-61 5
(BJ431086) Dictyostelium discoideum cDNA clone:ddv9g20, 3' e... 184 2e-61 5
(BJ430691) Dictyostelium discoideum cDNA clone:ddv8h10, 3' e... 184 2e-61 5
(BJ435816) Dictyostelium discoideum cDNA clone:ddv28c17, 3' ... 178 6e-60 5
(BJ433859) Dictyostelium discoideum cDNA clone:ddv23l06, 3' ... 178 8e-60 5
(AU264224) Dictyostelium discoideum vegetative cDNA clone:VS... 168 5e-53 4
(BJ432715) Dictyostelium discoideum cDNA clone:ddv19d14, 3' ... 216 9e-52 1
(AU264223) Dictyostelium discoideum vegetative cDNA clone:VS... 161 6e-51 4
(BJ434177) Dictyostelium discoideum cDNA clone:ddv16i05, 3' ... 129 2e-45 5
(BJ434194) Dictyostelium discoideum cDNA clone:ddv16m02, 3' ... 129 2e-45 5
(BJ431105) Dictyostelium discoideum cDNA clone:ddv9k22, 3' e... 129 2e-45 5
(BJ435306) Dictyostelium discoideum cDNA clone:ddv26a20, 3' ... 127 8e-45 5
(AU263200) Dictyostelium discoideum vegetative cDNA clone:VS... 123 1e-43 5
(BJ434518) Dictyostelium discoideum cDNA clone:ddv24i04, 3' ... 121 4e-43 5
(BJ435006) Dictyostelium discoideum cDNA clone:ddv25b23, 3' ... 121 4e-43 5
>(BJ435502) Dictyostelium discoideum cDNA clone:ddv27h08, 3' end,
single read.
Length = 746
Score = 430 bits (217), Expect(3) = 0.0
Identities = 217/217 (100%)
Strand = Plus / Minus
Query: 11 aaagcagctacccatacactgctgaagacggtaaaaaatgtaaattcaacccaaagaatg 70
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 746 aaagcagctacccatacactgctgaagacggtaaaaaatgtaaattcaacccaaagaatg 687
Query: 71 ttgctgctcaattatcatcatacgttaacgttacctctggttcagaatcagatttagctg 130
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 686 ttgctgctcaattatcatcatacgttaacgttacctctggttcagaatcagatttagctg 627
Query: 131 ccaaagttactcaaggtccaacctcagttgccattgatgcatccaaccaatcattccaat 190
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 626 ccaaagttactcaaggtccaacctcagttgccattgatgcatccaaccaatcattccaat 567
Query: 191 tgtacgtttcagattcacaatctgctggttcagaatc 227
|||||||||||||||||||||||||||||||||||||
Sbjct: 566 tgtacgtttcagattcacaatctgctggttcagaatc 530
Score = 341 bits (172), Expect(3) = 0.0
Identities = 172/172 (100%)
Strand = Plus / Minus
Query: 502 agtggtagcaatagcaacggtggtgtttatccaaccgctggtgactactggatcgttaaa 561
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 255 agtggtagcaatagcaacggtggtgtttatccaaccgctggtgactactggatcgttaaa 196
Query: 562 aactcatggggtacctcatggggtatggatggttacattttaatgaccaaaggaaataac 621
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 195 aactcatggggtacctcatggggtatggatggttacattttaatgaccaaaggaaataac 136
Query: 622 aatcaatgcggtattgcaacaatggcctcacgtccaactgctgttgcatcac 673
||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 135 aatcaatgcggtattgcaacaatggcctcacgtccaactgctgttgcatcac 84
Score = 210 bits (106), Expect(3) = 0.0
Identities = 106/106 (100%)
Strand = Plus / Minus
Query: 291 tggttctcaatcattctctggttccttatactctggttcatactctggttcccaatctgg 350
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 466 tggttctcaatcattctctggttccttatactctggttcatactctggttcccaatctgg 407
Query: 351 ttcccaatctggtaacagcggtgctgctgttaaacaaactggtgct 396
||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 406 ttcccaatctggtaacagcggtgctgctgttaaacaaactggtgct 361
Score = 44.1 bits (22), Expect(2) = 0.31
Identities = 31/34 (91%)
Strand = Plus / Minus
Query: 330 atactctggttcccaatctggttcccaatctggt 363
|||||||||||| | ||||||||||||||||||
Sbjct: 439 atactctggttcatactctggttcccaatctggt 406
Score = 28.2 bits (14), Expect(2) = 0.31
Identities = 14/14 (100%)
Strand = Plus / Minus
Query: 107 ctggttcagaatca 120
||||||||||||||
Sbjct: 542 ctggttcagaatca 529
Score = 44.1 bits (22), Expect(2) = 1.1
Identities = 31/34 (91%)
Strand = Plus / Minus
Query: 318 atactctggttcatactctggttcccaatctggt 351
|||||||||||| | ||||||||||||||||||
Sbjct: 427 atactctggttcccaatctggttcccaatctggt 394
Score = 26.3 bits (13), Expect(2) = 1.1
Identities = 13/13 (100%)
Strand = Plus / Minus
Query: 215 ctggttcagaatc 227
|||||||||||||
Sbjct: 650 ctggttcagaatc 638
Lambda K H
1.37 0.711 1.31
Matrix: blastn matrix:1 -3
Number of Sequences: 92845959
Number of Hits to DB: 453,417,951
Number of extensions: 24267945
Number of successful extensions: 1672386
Number of sequences better than 10.0: 987
Length of query: 755
Length of database: 95,242,211,685
Length adjustment: 24
Effective length of query: 731
Effective length of database: 97,308,875,965
Effective search space: 71132788330415
Effective search space used: 71132788330415
X1: 11 (21.8 bits)
S2: 22 (44.1 bits)
|
| Homology vs Protein |
Query= Contig-U10658-1 (Contig-U10658-1Q) /CSM_Contig/Contig-U10658-1Q.Seq.d
(755 letters)
Database: nrp_A
3,204,285 sequences; 1,040,966,779 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
(Q94504) RecName: Full=Cysteine proteinase 7; EC=3.4.22... 125 2e-27
(Q94503) RecName: Full=Cysteine proteinase 6; EC=3.4.22... 97 7e-19
L36204_1(L36204|pid:none) Dictyostelium discoideum cysteine prot... 87 6e-16
(P04989) RecName: Full=Cysteine proteinase 2; EC=3.4.22... 74 4e-12
(P54640) RecName: Full=Cysteine proteinase 5; EC=3.4.22... 73 1e-11
L36205_1(L36205|pid:none) Dictyostelium discoideum cysteine prot... 73 1e-11
DQ280314_1(DQ280314|pid:none) Hymeniacidon perlevis cathepsin L ... 72 1e-11
EU143709_1(EU143709|pid:none) Stichopus japonicus cathepsin L mR... 71 4e-11
AY679763_1(AY679763|pid:none) Trichomonas vaginalis cathepsin L-... 70 5e-11
EF066525_1(EF066525|pid:none) Radix peregra cathepsin-L-like cys... 70 5e-11
AF098670_1(AF098670|pid:none) Tethya aurantia silicatein beta mR... 70 7e-11
AY554271_1(AY554271|pid:none) Heterodera glycines cathepsin L-li... 69 1e-10
AY277910_1(AY277910|pid:none) Branchiostoma belcheri tsingtaunes... 69 2e-10
AY057110_1(AY057110|pid:none) Dictyocaulus viviparus cathepsin L... 69 2e-10
EU659125_1(EU659125|pid:none) Radopholus similis cathepsin S-lik... 67 5e-10
AY618311_1(AY618311|pid:none) Mytilus galloprovincialis cathepsi... 67 5e-10
BC075887_1(BC075887|pid:none) Danio rerio cathepsin L.1, mRNA (c... 67 6e-10
DQ474246_1(DQ474246|pid:none) Lygus lineolaris cathepsin-L mRNA,... 67 8e-10
AF412313_1(AF412313|pid:none) Haemonchus contortus cathepsin L c... 67 8e-10
D63670_1(D63670|pid:none) Spirometra erinacei mRNA for cysteine ... 67 8e-10
AY004155_1(AY004155|pid:none) Haemonchus contortus cathepsin L c... 67 8e-10
EU909156_1(EU909156|pid:none) Latrunculia oparinae silicatein A2... 67 8e-10
AB020491_1(AB020491|pid:none) Haemaphysalis longicornis mRNA for... 66 1e-09
AY336798_1(AY336798|pid:none) Rhipicephalus haemaphysaloides hae... 66 1e-09
EZ000236_1(EZ000236|pid:none) TSA: Amblyomma americanum Contig61... 66 1e-09
AY208822_1(AY208822|pid:none) Rhipicephalus appendiculatus midgu... 66 1e-09
S57422(S57422) cysteine proteinase (EC 3.4.22.-) 8 - Tritrichomo... 66 1e-09
AF039554_1(AF039554|pid:none) Acanthamoeba culbertsoni cysteine ... 66 1e-09
(O17473) RecName: Full=Cathepsin L-like; EC=3.4.22.15; ... 66 1e-09
EF053509_1(EF053509|pid:none) Acanthamoeba castellanii cysteine ... 66 1e-09
AX497240_1(AX497240|pid:none) Sequence 7 from Patent WO0229058. 66 1e-09
AJ872184_1(AJ872184|pid:none) Lubomirskia baicalensis mRNA for c... 66 1e-09
EU551631_1(EU551631|pid:none) Dermacentor variabilis isolate DvM... 65 2e-09
DQ904526_1(DQ904526|pid:none) Neobenedenia melleni cathepsin L-l... 65 2e-09
X91644_1(X91644|pid:none) E.histolytica DNA encoding for cystein... 65 2e-09
BC074718_1(BC074718|pid:none) Xenopus tropicalis MGC69486 protei... 65 2e-09
EU025855_1(EU025855|pid:none) Dermacentor variabilis cathepsin L... 65 2e-09
AY207373_1(AY207373|pid:none) Tenebrio molitor cathepsin L-like ... 65 2e-09
Y15901_2(Y15901|pid:none) Xenopus laevis mRNA for beta-type phos... 65 2e-09
EU106630_1(EU106630|pid:none) Tyrophagus putrescentiae cathepsin... 65 2e-09
FJ763762_1(FJ763762|pid:none) Delia coarctata cathepsin L-like c... 65 2e-09
S47432(S47432;A48398) cathepsin L (EC 3.4.22.15) - Norway lobste... 65 2e-09
AY332271_1(AY332271|pid:none) Tenebrio molitor cathepsin-L-like ... 65 2e-09
Y13925_1(Y13925|pid:none) Penaeus vannamei cathepsin L2 gene, pa... 65 2e-09
BC060335_1(BC060335|pid:none) Xenopus laevis cDNA clone MGC:6855... 65 2e-09
AJ583512_1(AJ583512|pid:none) Diabrotica virgifera virgifera mRN... 65 3e-09
EF567052_1(EF567052|pid:none) Heterodera glycines isolate Ca_HG_... 65 3e-09
EF567051_1(EF567051|pid:none) Heterodera glycines isolate Ca_HG_... 65 3e-09
AY333292_1(AY333292|pid:none) Branchiostoma lanceolatum isolate ... 64 4e-09
AF194426_1(AF194426|pid:none) Myxine glutinosa clone hicl20 cyst... 64 4e-09
AY333294_1(AY333294|pid:none) Branchiostoma lanceolatum isolate ... 64 4e-09
Y09499_1(Y09499|pid:none) H.glycines mRNA for cathepsin S-like c... 64 4e-09
EU909159_1(EU909159|pid:none) Latrunculia oparinae cathepsin mRN... 64 4e-09
BT082794_1(BT082794|pid:none) Anoplopoma fimbria clone afim-evh-... 64 4e-09
AY333293_1(AY333293|pid:none) Branchiostoma lanceolatum isolate ... 64 4e-09
S57425(S57425) cysteine proteinase (EC 3.4.22.-) 7 - Tritrichomo... 64 4e-09
BT082380_1(BT082380|pid:none) Anoplopoma fimbria clone afim-evh-... 64 4e-09
EU659123_1(EU659123|pid:none) Bursaphelenchus xylophilus catheps... 64 4e-09
AB055411_1(AB055411|pid:none) Spirometra erinaceieuropaei PGF-E ... 64 4e-09
EU000411_1(EU000411|pid:none) Strongylus vulgaris cathepsin L-li... 64 5e-09
EF070511_1(EF070511|pid:none) Maconellicoccus hirsutus clone WHM... 64 5e-09
AY158071_1(AY158071|pid:none) Petrosia ficiformis silicatein mRN... 64 5e-09
AB081844_1(AB081844|pid:none) Engraulis japonicus aCat2 mRNA for... 64 5e-09
AY528231_1(AY528231|pid:none) Leptinotarsa decemlineata clone In... 64 5e-09
AY336797_1(AY336797|pid:none) Rhipicephalus haemaphysaloides hae... 64 5e-09
AB370209_1(AB370209|pid:none) Ephydatia fluviatilis mRNA for sil... 64 5e-09
AY363263_1(AY363263|pid:none) Triatoma infestans cathepsin L-lik... 64 5e-09
EU000410_1(EU000410|pid:none) Strongylus vulgaris cathepsin L-li... 64 5e-09
EF070510_1(EF070510|pid:none) Maconellicoccus hirsutus clone WHM... 64 5e-09
AJ489298_1(AJ489298|pid:none) Aphis gossypii mRNA for putative c... 64 7e-09
DQ667144_1(DQ667144|pid:none) Diaprepes abbreviatus cathepsin L ... 64 7e-09
Y00697_1(Y00697|pid:none) Rat mRNA for cathepsin L (EC 3.4.22.15). 64 7e-09
AJ496197_1(AJ496197|pid:none) Myzus persicae mRNA for putative c... 64 7e-09
BC051665_1(BC051665|pid:none) Mus musculus cDNA sequence BC05166... 64 7e-09
AK145559_1(AK145559|pid:none) Mus musculus blastocyst blastocyst... 64 7e-09
X91642_1(X91642|pid:none) E.histolytica DNA encoding for cystein... 64 7e-09
DQ459304_1(DQ459304|pid:none) Aedes aegypti cathepsin L (CAT-L2)... 64 7e-09
KHRTL(S07098;S00155;S02445;A41550;S02446)cathepsin L (EC 3.4.22.... 64 7e-09
EF488012_1(EF488012|pid:none) Dermestes frischii digestive cyste... 63 9e-09
AY333297_1(AY333297|pid:none) Branchiostoma lanceolatum isolate ... 63 9e-09
DQ364228_1(DQ364228|pid:none) Hymeniacidon perlevis silicatein a... 63 9e-09
AY533166_1(AY533166|pid:none) Brugia malayi cathepsin L-like cys... 63 9e-09
AY277628_1(AY277628|pid:none) Fasciola hepatica cathepsin L mRNA... 63 9e-09
Y13924_1(Y13924|pid:none) Penaeus vannamei cathepsin L gene. 63 9e-09
CQ840832_1(CQ840832|pid:none) Sequence 2 from Patent WO200405881... 63 1e-08
EF428205_1(EF428205|pid:none) Ixodes ricinus cathepsin L-like cy... 63 1e-08
EU909158_1(EU909158|pid:none) Latrunculia oparinae silicatein B ... 63 1e-08
AB236968_1(AB236968|pid:none) Carassius auratus mRNA for catheps... 63 1e-08
L33772_1(L33772|pid:none) Fasciola hepatica cathepsin L-like pro... 63 1e-08
AF239264_1(AF239264|pid:none) Fasciola gigantica cathepsin L (ca... 63 1e-08
CQ840836_1(CQ840836|pid:none) Sequence 6 from Patent WO200405881... 63 1e-08
BT080951_1(BT080951|pid:none) Caligus clemensi clone ccle-evs-50... 63 1e-08
AF510856_1(AF510856|pid:none) Fasciola gigantica cathepsin L2 mR... 63 1e-08
AF239267_1(AF239267|pid:none) Fasciola gigantica cathepsin L (ca... 63 1e-08
AJ877017_1(AJ877017|pid:none) Suberites domuncula silicaa-g gene... 62 1e-08
AJ272013_1(AJ272013|pid:none) Suberites domuncula mRNA for silic... 62 1e-08
(Q5E998) RecName: Full=Cathepsin L2; EC=3.4.22.43; Flag... 62 1e-08
EF213115_1(EF213115|pid:none) Penaeus monodon cathepsin L mRNA, ... 62 1e-08
EU156179_1(EU156179|pid:none) Fasciola gigantica cathepsin L (ca... 62 1e-08
S41428(S41428) cysteine proteinase (EC 3.4.22.-) CP2 precursor -... 62 1e-08
AF239268_1(AF239268|pid:none) Fasciola gigantica cathepsin L (ca... 62 1e-08
D82884_1(D82884|pid:none) Sitophilus zeamais mRNA for cysteine p... 62 1e-08
(P25975) RecName: Full=Cathepsin L1; EC=3.4.22.15; Cont... 62 1e-08
DQ459303_1(DQ459303|pid:none) Aedes aegypti cathepsin L (CAT-L1)... 62 1e-08
EF567049_1(EF567049|pid:none) Heterodera avenae isolate Ca_Ha ca... 62 2e-08
CQ840838_1(CQ840838|pid:none) Sequence 8 from Patent WO200405881... 62 2e-08
AY519971_1(AY519971|pid:none) Fasciola hepatica clone Porto 1 ca... 62 2e-08
EU835858_1(EU835858|pid:none) Fasciola hepatica clone 21e10 cath... 62 2e-08
(Q24940) RecName: Full=Cathepsin L-like proteinase; EC=... 62 2e-08
AY573569_1(AY573569|pid:none) Fasciola hepatica strain Firat cat... 62 2e-08
BC080004_1(BC080004|pid:none) Xenopus laevis MGC81823 protein, m... 62 2e-08
AF410881_1(AF410881|pid:none) Frankliniella occidentalis cystein... 62 2e-08
AY519972_1(AY519972|pid:none) Fasciola hepatica clone INSA 2 cat... 62 2e-08
FN357360_3(FN357360|pid:none) Schistosoma mansoni genome sequenc... 62 2e-08
EF536899_1(EF536899|pid:none) Fasciola gigantica cathepsin (cat-... 62 2e-08
AF410883_1(AF410883|pid:none) Frankliniella occidentalis cystein... 62 2e-08
EU835857_1(EU835857|pid:none) Fasciola hepatica clone 22e06 cath... 62 2e-08
(P13277) RecName: Full=Digestive cysteine proteinase 1; ... 62 3e-08
X91643_1(X91643|pid:none) E.dispar RNA encoding for cysteine pro... 62 3e-08
AY220615_1(AY220615|pid:none) Hydra vulgaris cathepsin L precurs... 62 3e-08
AY208824_1(AY208824|pid:none) Rhipicephalus appendiculatus midgu... 62 3e-08
EF611824_1(EF611824|pid:none) Fasciola hepatica secreted catheps... 62 3e-08
AY373973_1(AY373973|pid:none) Helicoverpa armigera cathepsin L-l... 62 3e-08
AM500857_1(AM500857|pid:none) Geodia cydonium mRNA for silicatei... 62 3e-08
EU287918_1(EU287918|pid:none) Fasciola hepatica cathepsin L6 (CL... 62 3e-08
AK145382_1(AK145382|pid:none) Mus musculus 4 days embryo whole b... 62 3e-08
U62289_1(U62289|pid:none) Fasciola hepatica secreted cathepsin L... 62 3e-08
BC152284_1(BC152284|pid:none) Danio rerio similar to cathepsin L... 61 3e-08
DQ000609_1(DQ000609|pid:none) Globodera pallida cathepsin L-like... 61 3e-08
BC152236_1(BC152236|pid:none) Danio rerio similar to cathepsin L... 61 3e-08
AF136272_1(AF136272|pid:none) Mus musculus cathepsin J precursor... 61 3e-08
AY893779_1(AY893779|pid:none) Synthetic construct Homo sapiens c... 61 3e-08
DQ533985_1(DQ533985|pid:none) Fasciola hepatica cathepsin L2 mRN... 61 3e-08
AF331036_1(AF331036|pid:none) Onchocerca volvulus cathepsin L-li... 61 3e-08
AY515271_1(AY515271|pid:none) Taenia solium cathepsin L-like cys... 61 3e-08
(Q9GKL8) RecName: Full=Cathepsin L1; EC=3.4.22.15; AltN... 61 3e-08
BC153504_1(BC153504|pid:none) Danio rerio similar to cathepsin L... 61 3e-08
AB441815_1(AB441815|pid:none) Taenia solium clp gene for catheps... 61 3e-08
AY999065_1(AY999065|pid:none) Globodera pallida cathepsin L-like... 61 3e-08
AB441816_1(AB441816|pid:none) Taenia saginata clp gene for cathe... 61 3e-08
(P06797) RecName: Full=Cathepsin L1; EC=3.4.22.15; AltN... 61 4e-08
AB010924_1(AB010924|pid:none) Fasciola gigantica FhCL(B7-3) gene... 61 4e-08
AY890446_1(AY890446|pid:none) Synthetic construct Homo sapiens c... 61 4e-08
AF121837_1(AF121837|pid:none) Mus musculus cell-line L929 cathep... 61 4e-08
JX0366(JX0366;S13208) cysteine endopeptidase (EC 3.4.22.-) precu... 61 4e-08
AK165397_1(AK165397|pid:none) Mus musculus adult male kidney cDN... 61 4e-08
AK147142_1(AK147142|pid:none) Mus musculus cDNA, RIKEN full-leng... 61 4e-08
AK153417_1(AK153417|pid:none) Mus musculus bone marrow macrophag... 61 4e-08
AK075100_1(AK075100|pid:none) Homo sapiens cDNA FLJ90619 fis, cl... 61 4e-08
AK161538_1(AK161538|pid:none) Mus musculus 11 days pregnant adul... 61 4e-08
AB010923_1(AB010923|pid:none) Fasciola gigantica FhCL gene for c... 61 4e-08
AB248269_1(AB248269|pid:none) Echinococcus multilocularis EmCLP1... 61 4e-08
AK011589_1(AK011589|pid:none) Mus musculus 10 days embryo whole ... 61 4e-08
(P07711) RecName: Full=Cathepsin L1; EC=3.4.22.15; AltN... 61 4e-08
BC142983_1(BC142983|pid:none) Homo sapiens cathepsin L1, mRNA (c... 61 4e-08
AJ605118_1(AJ605118|pid:none) Platichthys flesus partial mRNA fo... 60 6e-08
AB091670_1(AB091670|pid:none) Pandalus borealis PbCtL mRNA for c... 60 6e-08
(P43236) RecName: Full=Cathepsin K; EC=3.4.22.38; AltNa... 60 6e-08
EF567048_1(EF567048|pid:none) Heterodera carotae isolate Ca_Hca ... 60 7e-08
EF670319_1(EF670319|pid:none) Artemia persimilis cathepsin L-1 (... 60 7e-08
S41427(S41427) cysteine proteinase (EC 3.4.22.-) CP1 precursor -... 60 7e-08
S58669_1(S58669|pid:none) Entamoeba histolytica cysteine protein... 60 7e-08
AF147207_1(AF147207|pid:none) Artemia franciscana cathepsin L-li... 60 7e-08
AF239266_1(AF239266|pid:none) Fasciola gigantica cathepsin L (ca... 60 7e-08
(Q80UB0) RecName: Full=Testin-2; Contains: RecName: Full=Testi... 60 7e-08
AF194427_1(AF194427|pid:none) Myxine glutinosa clone hicl22 cyst... 60 7e-08
(P25784) RecName: Full=Digestive cysteine proteinase 3; ... 60 7e-08
AK145933_1(AK145933|pid:none) Mus musculus 13 days pregnant adul... 60 7e-08
AY795054_1(AY795054|pid:none) Artemia franciscana cathepsin L pr... 60 7e-08
Y14734_1(Y14734|pid:none) Homo sapiens mRNA for cathepsin L2. 60 1e-07
BC154984_1(BC154984|pid:none) Xenopus laevis hypothetical protei... 60 1e-07
AJ968947_1(AJ968947|pid:none) Lubomirskia baicalensis mRNA for s... 60 1e-07
AY829805_1(AY829805|pid:none) Lonomia obliqua cysteine peptidase... 60 1e-07
AK312806_1(AK312806|pid:none) Homo sapiens cDNA, FLJ93235, highl... 60 1e-07
DQ474247_1(DQ474247|pid:none) Lygus lineolaris cathepsin-L-like ... 60 1e-07
EF567034_1(EF567034|pid:none) Globodera pallida isolate Ca_GPS10... 59 1e-07
EF567020_1(EF567020|pid:none) Globodera pallida isolate Ca_GPE1 ... 59 1e-07
PDBN(1BGO) MOL_ID: 1;MOL_ID: 1; MOLECULE: CATHEPSIN K; MOLECULE:... 59 1e-07
X87213_1(X87213|pid:none) E.dispar mRNA for cysteine proteinase. 59 1e-07
AE013599_1894(AE013599|pid:none) Drosophila melanogaster chromos... 59 1e-07
(Q95029) RecName: Full=Cathepsin L; EC=3.4.22.15; AltNa... 59 1e-07
AY428949_1(AY428949|pid:none) Fasciola gigantica cathepsin L (ca... 59 1e-07
BC109853_1(BC109853|pid:none) Bos taurus cathepsin K preproprote... 59 1e-07
U20280_1(U20280|pid:none) Human cathepsin X mRNA, complete cds. 59 1e-07
AF239265_1(AF239265|pid:none) Fasciola gigantica cathepsin L (ca... 59 1e-07
AF331035_1(AF331035|pid:none) Brugia malayi cathepsin L-like cys... 59 1e-07
EF567046_1(EF567046|pid:none) Globodera mexicana isolate Ca_GM2 ... 59 1e-07
(P61276) RecName: Full=Cathepsin K; EC=3.4.22.38; Flags... 59 1e-07
EF567030_1(EF567030|pid:none) Globodera pallida isolate Ca_GPS6 ... 59 1e-07
(Q9GLE3) RecName: Full=Cathepsin K; EC=3.4.22.38; Flags... 59 1e-07
(O35186) RecName: Full=Cathepsin K; EC=3.4.22.38; Flags... 59 1e-07
EF567021_1(EF567021|pid:none) Globodera pallida isolate Ca_GPE2 ... 59 1e-07
EF567029_1(EF567029|pid:none) Globodera pallida isolate Ca_GPS5 ... 59 1e-07
CR541719_1(CR541719|pid:none) Homo sapiens full open reading fra... 59 1e-07
EF567045_1(EF567045|pid:none) Globodera mexicana isolate Ca_GM1 ... 59 1e-07
EF567032_1(EF567032|pid:none) Globodera pallida isolate Ca_GPS8 ... 59 1e-07
AB071667_1(AB071667|pid:none) Halichondria okadai mRNA for silic... 59 1e-07
DQ902583_1(DQ902583|pid:none) Clonorchis sinensis clone cs002d09... 59 1e-07
AF498292_1(AF498292|pid:none) Danio rerio cathepsin mRNA, partia... 59 2e-07
AF456460_1(AF456460|pid:none) Rattus norvegicus cathepsin Q2 (Ct... 59 2e-07
EF567025_1(EF567025|pid:none) Globodera pallida isolate Ca_GPS1 ... 59 2e-07
BT047088_1(BT047088|pid:none) Salmo salar clone ssal-evd-579-155... 59 2e-07
(P09648) RecName: Full=Cathepsin L1; EC=3.4.22.15; Cont... 59 2e-07
D31970_1(D31970|pid:none) Fruitfly DNA for cysteine proteinase-1... 59 2e-07
BT073939_1(BT073939|pid:none) Oncorhynchus mykiss clone omyk-evo... 59 2e-07
BC066490_1(BC066490|pid:none) Danio rerio cathepsin L, a, mRNA (... 59 2e-07
AP008210_259(AP008210|pid:none) Oryza sativa (japonica cultivar-... 59 2e-07
AB370208_1(AB370208|pid:none) Ephydatia fluviatilis mRNA for sil... 59 2e-07
EF567044_1(EF567044|pid:none) Globodera tabacum 'azteca' isolate... 59 2e-07
AY463696_1(AY463696|pid:none) Trichomonas vaginalis cathepsin L-... 59 2e-07
AY126713_1(AY126713|pid:none) Metapenaeus ensis cathepsin L prec... 59 2e-07
EF567037_1(EF567037|pid:none) Globodera rostochiensis isolate Ca... 59 2e-07
EF567043_1(EF567043|pid:none) Globodera tabacum virginiae isolat... 59 2e-07
AY126712_1(AY126712|pid:none) Metapenaeus ensis cathepsin L prec... 59 2e-07
EF567040_1(EF567040|pid:none) Globodera rostochiensis isolate Ca... 59 2e-07
AB098625_1(AB098625|pid:none) Daucus carota DcCysP2 mRNA for cys... 59 2e-07
KHCHL(S00081;A25654;A26818;B25654)cathepsin L (EC 3.4.22.15) - c... 59 2e-07
EF567038_1(EF567038|pid:none) Globodera rostochiensis isolate Ca... 59 2e-07
S67481(S67481)cathepsin L-like cysteine proteinase (EC 3.4.22.-)... 59 2e-07
CT025745_2(CT025745|pid:none) Zebrafish DNA sequence from clone ... 59 2e-07
AJ968946_1(AJ968946|pid:none) Lubomirskia baicalensis mRNA for s... 59 2e-07
EU287916_1(EU287916|pid:none) Fasciola hepatica cathepsin L4 (CL... 59 2e-07
AB306512_1(AB306512|pid:none) Plautia stali mRNA for cathepsin L... 59 2e-07
AJ784227_1(AJ784227|pid:none) Suberites domuncula mRNA for silic... 59 2e-07
AJ547635_1(AJ547635|pid:none) Suberites domuncula mRNA for silic... 59 2e-07
EU287917_1(EU287917|pid:none) Fasciola hepatica cathepsin L4 (CL... 59 2e-07
BC152283_1(BC152283|pid:none) Danio rerio wu:fa26c03, mRNA (cDNA... 59 2e-07
BC108031_1(BC108031|pid:none) Danio rerio cathepsin L, 1 b, mRNA... 59 2e-07
BT074607_1(BT074607|pid:none) Osmerus mordax clone omor-rgc-519-... 59 2e-07
AY366355_1(AY366355|pid:none) Litopenaeus vannamei cathepsin L g... 59 2e-07
BC097257_1(BC097257|pid:none) Rattus norvegicus cathepsin Q-like... 58 3e-07
AB370207_1(AB370207|pid:none) Ephydatia fluviatilis mRNA for sil... 58 3e-07
AY950578_1(AY950578|pid:none) Paralichthys olivaceus cathepsin S... 58 3e-07
EU022371_1(EU022371|pid:none) Schistosoma mansoni cathepsin L3 p... 58 3e-07
EF535003_1(EF535003|pid:none) Misgurnus mizolepis cathepsin L mR... 58 3e-07
AF479265_1(AF479265|pid:none) Meriones unguiculatus cathepsin P ... 58 3e-07
BC121682_1(BC121682|pid:none) Xenopus tropicalis hypothetical pr... 58 3e-07
FN357489_8(FN357489|pid:none) Schistosoma mansoni genome sequenc... 58 3e-07
AB081845_1(AB081845|pid:none) Engraulis japonicus aCatL mRNA for... 58 4e-07
Y14966_1(Y14966|pid:none) Penaeus vannamei gene encoding catheps... 58 4e-07
FN314781_1(FN314781|pid:none) Schistosoma japonicum isolate Anhu... 58 4e-07
FN314780_1(FN314780|pid:none) Schistosoma japonicum isolate Anhu... 58 4e-07
EU551630_1(EU551630|pid:none) Dermacentor variabilis isolate DvM... 58 4e-07
BT083851_1(BT083851|pid:none) Zea mays full-length cDNA clone ZM... 58 4e-07
FN314778_1(FN314778|pid:none) Schistosoma japonicum isolate Anhu... 58 4e-07
AY811692_1(AY811692|pid:none) Schistosoma japonicum SJCHGC02869 ... 58 4e-07
FN314779_1(FN314779|pid:none) Schistosoma japonicum isolate Anhu... 58 4e-07
EU966324_1(EU966324|pid:none) Zea mays clone 293605 cysteine pro... 58 4e-07
EU915299_1(EU915299|pid:none) Ictalurus punctatus cathepsin L mR... 57 5e-07
AY217742_1(AY217742|pid:none) Fundulus heteroclitus cathepsin H ... 57 5e-07
AY376236_1(AY376236|pid:none) Tritrichomonas foetus strain K cys... 57 5e-07
AB009306_1(AB009306|pid:none) Fasciola hepatica mRNA for catheps... 57 5e-07
AY822073_1(AY822073|pid:none) Penaeus monodon cathepsin L (CTSL)... 57 5e-07
EF015467_1(EF015467|pid:none) Hippoglossus hippoglossus cathepsi... 57 5e-07
BT074465_1(BT074465|pid:none) Osmerus mordax clone omor-rgc-503-... 57 5e-07
FN314782_1(FN314782|pid:none) Schistosoma japonicum isolate Anhu... 57 5e-07
DQ909016_1(DQ909016|pid:none) Clonorchis sinensis cathepsin L-li... 57 6e-07
EF068256_1(EF068256|pid:none) Spodoptera exigua cathepsin L-like... 57 6e-07
AY333299_1(AY333299|pid:none) Petromyzon marinus isolate Pema-ca... 57 6e-07
S74227(S74227) cathepsin K (EC 3.4.22.-) precursor - mouse &X94... 57 6e-07
(P55097) RecName: Full=Cathepsin K; EC=3.4.22.38; Flags... 57 6e-07
EF567027_1(EF567027|pid:none) Globodera pallida isolate Ca_GPS3 ... 57 8e-07
BC066625_1(BC066625|pid:none) Danio rerio cathepsin S, a, mRNA (... 57 8e-07
EF413921_1(EF413921|pid:none) Brugia pahangi cathepsin L-like mR... 57 8e-07
AJ872183_1(AJ872183|pid:none) Lubomirskia baicalensis mRNA for s... 57 8e-07
CR548627_7(CR548627|pid:none) Zebrafish DNA sequence from clone ... 57 8e-07
AY192364_1(AY192364|pid:none) Trifolium repens cysteine protease... 57 8e-07
AB370206_1(AB370206|pid:none) Ephydatia fluviatilis mRNA for sil... 57 8e-07
FJ772427_1(FJ772427|pid:none) Lutjanus argentimaculatus cathepsi... 57 8e-07
BX465190_7(BX465190|pid:none) Zebrafish DNA sequence from clone ... 57 8e-07
BT045723_1(BT045723|pid:none) Salmo salar clone ssal-rgf-529-273... 57 8e-07
BC083200_1(BC083200|pid:none) Danio rerio cathepsin L, like, mRN... 56 1e-06
AJ968945_1(AJ968945|pid:none) Lubomirskia baicalensis mRNA for s... 56 1e-06
BC095788_1(BC095788|pid:none) Danio rerio cathepsin S, b.1, mRNA... 56 1e-06
S15844(S15844;S23680;S16972;S23957)cathepsin S (EC 3.4.22.27) - ... 56 1e-06
AM409328_1(AM409328|pid:none) Trifolium pratense partial cp8 gen... 56 1e-06
M95211_1(M95211|pid:none) Bovine cathepsin S (catS) mRNA, partia... 56 1e-06
BX119902_1(BX119902|pid:none) Zebrafish DNA sequence from clone ... 56 1e-06
(P25326) RecName: Full=Cathepsin S; EC=3.4.22.27; Flags... 56 1e-06
AF542132_1(AF542132|pid:none) Theromyzon tessulatum cathepsin L ... 56 1e-06
FJ349098_1(FJ349098|pid:none) Acanthodendrilla sp. Vietnam cathe... 56 1e-06
EF567033_1(EF567033|pid:none) Globodera pallida isolate Ca_GPS9 ... 56 1e-06
DQ356053_1(DQ356053|pid:none) Tenebrio molitor clone AM3-32 puta... 56 1e-06
AB219573_1(AB219573|pid:none) Ephydatia fluviatilis mRNA for sil... 56 1e-06
FN316427_1(FN316427|pid:none) Schistosoma japonicum isolate Anhu... 56 1e-06
AC130601_2(AC130601|pid:none) Oryza sativa (japonica cultivar-gr... 56 1e-06
AY891889_1(AY891889|pid:none) Synthetic construct Homo sapiens c... 55 2e-06
CR456881_1(CR456881|pid:none) Homo sapiens full open reading fra... 55 2e-06
CR749582_1(CR749582|pid:none) Homo sapiens mRNA; cDNA DKFZp686B2... 55 2e-06
AY212286_1(AY212286|pid:none) Fundulus heteroclitus cathepsin L ... 55 2e-06
AF358668_1(AF358668|pid:none) Oncorhynchus mykiss procathepsin L... 55 2e-06
BT058408_1(BT058408|pid:none) Salmo salar clone Contig454 Cathep... 55 2e-06
AF426248_1(AF426248|pid:none) Homo sapiens truncated cathepsin H... 55 2e-06
AY893780_1(AY893780|pid:none) Synthetic construct Homo sapiens c... 55 2e-06
EU093092_1(EU093092|pid:none) Sus scrofa cathepsin H variant 2 (... 55 2e-06
AY504966_1(AY504966|pid:none) Iris hollandica putative cysteine ... 55 2e-06
BT057383_1(BT057383|pid:none) Salmo salar clone ssal-evf-519-083... 55 2e-06
(O70370) RecName: Full=Cathepsin S; EC=3.4.22.27; Flags... 55 2e-06
FJ812078_1(FJ812078|pid:none) Spongilla lacustris silicatein alp... 55 2e-06
AM941125_1(AM941125|pid:none) Hordeum vulgare subsp. vulgare mRN... 55 2e-06
AF419329_1(AF419329|pid:none) Fasciola gigantica cathepsin L mRN... 55 2e-06
EU532429_1(EU532429|pid:none) Sus scrofa cathepsin H (CTSH) gene... 55 2e-06
(P09668) RecName: Full=Cathepsin H; EC=3.4.22.16; Conta... 55 2e-06
AJ002386_1(AJ002386|pid:none) Mus musculus mRNA for cathepsin S. 55 2e-06
AF426247_1(AF426247|pid:none) Homo sapiens cathepsin H mRNA, com... 55 2e-06
(O46427) RecName: Full=Cathepsin H; EC=3.4.22.16; Conta... 55 2e-06
AF038546_1(AF038546|pid:none) Mus musculus cathepsin S precursor... 55 2e-06
BT081306_1(BT081306|pid:none) Caligus clemensi clone ccle-evs-50... 55 2e-06
U61296_1(U61296|pid:none) Oncorhynchus mykiss cathepsin L mRNA, ... 55 2e-06
AK028366_1(AK028366|pid:none) Mus musculus 18 days pregnant adul... 55 2e-06
AK153540_1(AK153540|pid:none) Mus musculus bone marrow macrophag... 55 2e-06
AC117076_20(AC117076|pid:none) Dictyostelium discoideum chromoso... 55 2e-06
Y18466_1(Y18466|pid:none) Mus musculus mRNA for cathepsin S, par... 55 2e-06
AK226753_1(AK226753|pid:none) Arabidopsis thaliana mRNA for papa... 55 2e-06
AC000132_24(AC000132|pid:none) Sequence of BAC F21M12 from Arabi... 55 2e-06
NRL(1AEC) actinidain (EC 3.4.22.14) (with [N- 55 2e-06
BC087770_1(BC087770|pid:none) Xenopus tropicalis cathepsin S, mR... 55 2e-06
EF490928_1(EF490928|pid:none) Lepeophtheirus salmonis clone LS01... 55 2e-06
BT047054_1(BT047054|pid:none) Salmo salar clone ssal-evf-540-233... 55 2e-06
M38422_1(M38422|pid:none) Actinidia deliciosa actinidin gene, co... 55 2e-06
DQ356054_1(DQ356054|pid:none) Tenebrio molitor clone AM4-22 puta... 55 2e-06
NRL(2ACT) actinidain (EC 3.4.22.14) - kiwi fruit 55 2e-06
(A5HII1) RecName: Full=Actinidain; Short=Actinidin; ... 55 2e-06
AF388175_1(AF388175|pid:none) Arabidopsis thaliana papain-like c... 55 2e-06
FN316438_1(FN316438|pid:none) Schistosoma japonicum isolate Anhu... 55 2e-06
EF530134_1(EF530134|pid:none) Actinidia deliciosa actinidin Act2... 55 2e-06
D90407_1(D90407|pid:none) Oryza sativa Japonica Group mRNA for o... 55 3e-06
AF454956_1(AF454956|pid:none) Brassica oleracea senescence-assoc... 55 3e-06
(Q3T0I2) RecName: Full=Cathepsin H; EC=3.4.22.16; Conta... 55 3e-06
AF115280_1(AF115280|pid:none) Sarcocystis muris thiolproteinase ... 55 3e-06
EF530135_1(EF530135|pid:none) Actinidia eriantha actinidin Act2b... 55 3e-06
AB267407_1(AB267407|pid:none) Triticum aestivum mRNA for tritica... 55 3e-06
AB098630_1(AB098630|pid:none) Daucus carota DcCysP7 mRNA for cys... 55 3e-06
DQ017755_1(DQ017755|pid:none) Mesocricetus auratus placental cat... 55 3e-06
BC002125_1(BC002125|pid:none) Mus musculus cathepsin S, mRNA (cD... 55 3e-06
FJ502032_1(FJ502032|pid:none) Aristichthys nobilis clone A135 ca... 55 3e-06
AP008210_2224(AP008210|pid:none) Oryza sativa (japonica cultivar... 55 3e-06
AB436161_1(AB436161|pid:none) Bombyx mori catL-like mRNA for cat... 54 4e-06
AB040454_1(AB040454|pid:none) Astragalus sinicus cysteine protei... 54 4e-06
AJ279093_1(AJ279093|pid:none) Fasciola hepatica partial mRNA for... 54 4e-06
EU973371_1(EU973371|pid:none) Zea mays clone 397658 unknown mRNA. 54 4e-06
AC135231_14(AC135231|pid:none) Medicago truncatula clone mth2-28... 54 4e-06
FB844666_1(FB844666|pid:none) Sequence 63939 from Patent WO20080... 54 4e-06
BT042091_1(BT042091|pid:none) Zea mays full-length cDNA clone ZM... 54 4e-06
CS491404_1(CS491404|pid:none) Sequence 7 from Patent WO2007008070. 54 4e-06
AY333300_1(AY333300|pid:none) Paralabidochromis chilotes isolate... 54 4e-06
Y11003_1(Y11003|pid:none) N.tabacum mRNA for putative pre-pro-cy... 54 4e-06
EF530144_1(EF530144|pid:none) Actinidia deliciosa cysteine prote... 54 4e-06
(Q40143) RecName: Full=Cysteine proteinase 3; EC=3.4.22... 54 4e-06
EU195859_1(EU195859|pid:none) Fasciola hepatica dev-stage metace... 54 4e-06
BC090560_1(BC090560|pid:none) Xenopus tropicalis hypothetical pr... 54 4e-06
BC135767_1(BC135767|pid:none) Xenopus tropicalis hypothetical pr... 54 4e-06
AC140034_6(AC140034|pid:none) Medicago truncatula clone mth2-17g... 54 4e-06
FJ617001_1(FJ617001|pid:none) Fasciola hepatica cathepsin 1L mRN... 54 4e-06
AM426624_1(AM426624|pid:none) Vitis vinifera contig VV78X063867.... 54 4e-06
(Q90686) RecName: Full=Cathepsin K; EC=3.4.22.38; AltNa... 54 4e-06
BC075275_1(BC075275|pid:none) Xenopus tropicalis cathepsin K (py... 54 4e-06
M38135_1(M38135|pid:none) Rat cathepsin H (RCHII) mRNA,. 54 5e-06
EF472892_1(EF472892|pid:none) Oryctolagus cuniculus cathepsin H ... 54 5e-06
FJ373524_1(FJ373524|pid:none) Helianthus annuus isolate B cultiv... 54 5e-06
(P00786) RecName: Full=Cathepsin H; EC=3.4.22.16; AltNa... 54 5e-06
AF250840_1(AF250840|pid:none) Mus musculus EPCS68 mRNA, complete... 54 5e-06
DQ381232_1(DQ381232|pid:none) Ictalurus punctatus clone SNNC08 c... 54 5e-06
T03941(T03941) cysteine proteinase (EC 3.4.22.-) precursor - com... 54 5e-06
AY604196_1(AY604196|pid:none) Gossypium hirsutum putative cystei... 54 5e-06
FJ373523_1(FJ373523|pid:none) Helianthus annuus isolate A cultiv... 54 5e-06
DQ147988_1(DQ147988|pid:none) Macaca mulatta clone dl2_j19_t7_12... 54 5e-06
(P25251) RecName: Full=Cysteine proteinase COT44; EC=3.... 54 5e-06
FJ373534_1(FJ373534|pid:none) Helianthus petiolaris isolate A al... 54 5e-06
AM167901_1(AM167901|pid:none) Ephydatia fluviatilis partial mRNA... 54 5e-06
BT071384_1(BT071384|pid:none) Picea sitchensis clone WS0285_P02 ... 54 5e-06
EU915298_1(EU915298|pid:none) Ictalurus punctatus cathspsin H mR... 54 5e-06
FN316423_1(FN316423|pid:none) Schistosoma japonicum isolate Anhu... 54 7e-06
AY700587_1(AY700587|pid:none) Zingiber officinale cysteine prote... 54 7e-06
FN316432_1(FN316432|pid:none) Schistosoma japonicum isolate Anhu... 54 7e-06
AY815993_1(AY815993|pid:none) Schistosoma japonicum clone SJCHGC... 54 7e-06
EF144889_1(EF144889|pid:none) Populus trichocarpa clone WS01119_... 54 7e-06
AY813528_1(AY813528|pid:none) Schistosoma japonicum clone SJCHGC... 54 7e-06
AY815453_1(AY815453|pid:none) Schistosoma japonicum SJCHGC06231 ... 54 7e-06
FN316429_1(FN316429|pid:none) Schistosoma japonicum isolate Anhu... 54 7e-06
AY526905_1(AY526905|pid:none) Pelargonium x hortorum cysteine pr... 54 7e-06
FN316440_1(FN316440|pid:none) Schistosoma japonicum isolate Anhu... 54 7e-06
AB267820_1(AB267820|pid:none) Ipomoea nil In15 mRNA for cysteine... 54 7e-06
AY812857_1(AY812857|pid:none) Schistosoma japonicum clone SJCHGC... 54 7e-06
AY815868_1(AY815868|pid:none) Schistosoma japonicum SJCHGC00098 ... 54 7e-06
(P15242) RecName: Full=Testin-2; AltName: Full=CMB-23; Contains:... 54 7e-06
AY812909_1(AY812909|pid:none) Schistosoma japonicum clone SJCHGC... 54 7e-06
AY814917_1(AY814917|pid:none) Schistosoma japonicum clone SJCHGC... 54 7e-06
AY814036_1(AY814036|pid:none) Schistosoma japonicum clone SJCHGC... 54 7e-06
FN316424_1(FN316424|pid:none) Schistosoma japonicum isolate Anhu... 54 7e-06
FN316416_1(FN316416|pid:none) Schistosoma japonicum isolate Anhu... 54 7e-06
FN316420_1(FN316420|pid:none) Schistosoma japonicum isolate Anhu... 54 7e-06
AK149949_1(AK149949|pid:none) Mus musculus bone marrow macrophag... 54 7e-06
AY813268_1(AY813268|pid:none) Schistosoma japonicum clone SJCHGC... 54 7e-06
FN316415_1(FN316415|pid:none) Schistosoma japonicum isolate Anhu... 54 7e-06
AY814745_1(AY814745|pid:none) Schistosoma japonicum clone SJCHGC... 54 7e-06
AY813594_1(AY813594|pid:none) Schistosoma japonicum clone SJCHGC... 54 7e-06
(Q8HY81) RecName: Full=Cathepsin S; EC=3.4.22.27; Flags... 53 9e-06
EF530146_1(EF530146|pid:none) Actinidia deliciosa cysteine prote... 53 9e-06
AF157961_1(AF157961|pid:none) Hypera postica cysteine proteinase... 53 9e-06
FB844508_1(FB844508|pid:none) Sequence 63781 from Patent WO20080... 53 9e-06
BC097484_1(BC097484|pid:none) Rattus norvegicus cathepsin R, mRN... 53 9e-06
AY192362_1(AY192362|pid:none) Trifolium repens cysteine protease... 53 9e-06
AY192365_1(AY192365|pid:none) Trifolium repens cysteine protease... 53 9e-06
AF242372_1(AF242372|pid:none) Ipomoea batatas cysteine protease ... 53 9e-06
AF182079_1(AF182079|pid:none) Matricaria chamomilla thiol protea... 53 9e-06
AY192366_1(AY192366|pid:none) Trifolium repens cysteine protease... 53 1e-05
AY192363_1(AY192363|pid:none) Trifolium repens cysteine protease... 53 1e-05
AY171099_1(AY171099|pid:none) Gossypium hirsutum cysteine protea... 53 1e-05
AB369066_1(AB369066|pid:none) Triticum aestivum mRNA for tritica... 53 1e-05
EF530132_1(EF530132|pid:none) Actinidia arguta actinidin Act1b m... 53 1e-05
EF147908_1(EF147908|pid:none) Populus trichocarpa clone WS0125_O... 53 1e-05
AM941122_1(AM941122|pid:none) Hordeum vulgare subsp. vulgare mRN... 53 1e-05
BC093339_1(BC093339|pid:none) Danio rerio cathepsin S, b.2, mRNA... 53 1e-05
BC067615_1(BC067615|pid:none) Danio rerio cathepsin H, mRNA (cDN... 53 1e-05
AF019147_1(AF019147|pid:none) Zea mays cysteine proteinase Mir3 ... 53 1e-05
BT033837_1(BT033837|pid:none) Zea mays full-length cDNA clone ZM... 53 1e-05
FB844668_1(FB844668|pid:none) Sequence 63941 from Patent WO20080... 53 1e-05
EU964144_1(EU964144|pid:none) Zea mays clone 276186 cysteine pro... 53 1e-05
U33215_1(U33215|pid:none) Paragonimus westermani cysteine protei... 53 1e-05
AC135231_17(AC135231|pid:none) Medicago truncatula clone mth2-28... 53 1e-05
AY528228_1(AY528228|pid:none) Leptinotarsa decemlineata clone In... 53 1e-05
FB844656_1(FB844656|pid:none) Sequence 63929 from Patent WO20080... 53 1e-05
AY223542_1(AY223542|pid:none) Fundulus heteroclitus cathepsin K ... 53 1e-05
AY795055_1(AY795055|pid:none) Artemia franciscana cathepsin L2 p... 53 1e-05
AJ249847_1(AJ249847|pid:none) Lolium multiflorum mRNA for cystei... 53 1e-05
AK301472_1(AK301472|pid:none) Homo sapiens cDNA FLJ50259 complet... 52 2e-05
AY017412_1(AY017412|pid:none) Nicotiana tabacum NTCP23-like cyst... 52 2e-05
AB331922_1(AB331922|pid:none) Brassica rapa var. perviridis BrCP... 52 2e-05
BT041678_1(BT041678|pid:none) Zea mays full-length cDNA clone ZM... 52 2e-05
EU961973_1(EU961973|pid:none) Zea mays clone 239400 thiol protea... 52 2e-05
EU964674_1(EU964674|pid:none) Zea mays clone 280773 unknown mRNA. 52 2e-05
DQ658268_1(DQ658268|pid:none) Emiliania huxleyi clone Plate1_A09... 52 2e-05
(P25774) RecName: Full=Cathepsin S; EC=3.4.22.27; Flags... 52 2e-05
AB032168_1(AB032168|pid:none) Nicotiana tabacum NTCP-23 mRNA for... 52 2e-05
EF576485_1(EF576485|pid:none) Oryza sativa (indica cultivar-grou... 52 2e-05
FB844650_1(FB844650|pid:none) Sequence 63923 from Patent WO20080... 52 2e-05
BT033703_1(BT033703|pid:none) Zea mays full-length cDNA clone ZM... 52 2e-05
EF087762_1(EF087762|pid:none) Picea sitchensis clone WS02745_M21... 52 2e-05
(Q10717) RecName: Full=Cysteine proteinase 2; EC=3.4.22... 52 2e-05
FB844670_1(FB844670|pid:none) Sequence 63943 from Patent WO20080... 52 2e-05
AF454958_1(AF454958|pid:none) Brassica oleracea senescence-assoc... 52 2e-05
(Q8HY82) RecName: Full=Cathepsin S; EC=3.4.22.27; Flags... 52 2e-05
DQ084022_1(DQ084022|pid:none) Nicotiana benthamiana cysteine pro... 52 2e-05
AJ784223_1(AJ784223|pid:none) Suberites domuncula mRNA for cathe... 52 2e-05
FB844658_1(FB844658|pid:none) Sequence 63931 from Patent WO20080... 52 2e-05
(Q5RB02) RecName: Full=Dipeptidyl-peptidase 1; EC=3.4.1... 52 2e-05
AY891245_1(AY891245|pid:none) Synthetic construct Homo sapiens c... 52 2e-05
AK070448_1(AK070448|pid:none) Oryza sativa Japonica Group cDNA c... 52 2e-05
S57776(S57776) cysteine proteinase (EC 3.4.22.-) - clove pink (f... 52 2e-05
AB017648_1(AB017648|pid:none) Bos taurus gene for preprocathepsi... 52 2e-05
AB109188_1(AB109188|pid:none) Helianthus annuus scp3 mRNA for cy... 52 2e-05
AY345219_1(AY345219|pid:none) Acanthoscelides obtectus cathepsin... 52 2e-05
AB363729_1(AB363729|pid:none) Platycodon grandiflorus PgCP2 mRNA... 52 2e-05
FB844530_1(FB844530|pid:none) Sequence 63803 from Patent WO20080... 52 2e-05
(Q3ZCJ8) RecName: Full=Dipeptidyl-peptidase 1; EC=3.4.1... 52 2e-05
AJ719318_1(AJ719318|pid:none) Gallus gallus mRNA for hypothetica... 52 2e-05
AB372256_1(AB372256|pid:none) Capsicum chinense mRNA for putativ... 52 2e-05
FJ373522_1(FJ373522|pid:none) Helianthus annuus isolate Tennesse... 52 2e-05
L30111_1(L30111|pid:none) Cyprinus carpio cysteine proteinase ge... 52 2e-05
FB844594_1(FB844594|pid:none) Sequence 63867 from Patent WO20080... 52 2e-05
AY973616_1(AY973616|pid:none) Manihot esculenta cysteine proteas... 52 3e-05
DQ209288_1(DQ209288|pid:none) Brassica napus cysteine protease m... 52 3e-05
BT000674_1(BT000674|pid:none) Arabidopsis thaliana clone RAFL05-... 52 3e-05
FJ807676_1(FJ807676|pid:none) Dicentrarchus labrax cathepsin L m... 52 3e-05
FN316418_1(FN316418|pid:none) Schistosoma japonicum isolate Anhu... 52 3e-05
U38476_1(U38476|pid:none) Schistosoma japonicum preprocathepsin ... 52 3e-05
FB844624_1(FB844624|pid:none) Sequence 63897 from Patent WO20080... 52 3e-05
BT042417_1(BT042417|pid:none) Zea mays full-length cDNA clone ZM... 52 3e-05
AB098627_1(AB098627|pid:none) Daucus carota DcCysP4 mRNA for cys... 52 3e-05
(P05167) RecName: Full=Thiol protease aleurain; EC=3.4.... 52 3e-05
AF454960_1(AF454960|pid:none) Brassica oleracea senescence-assoc... 52 3e-05
EF530141_1(EF530141|pid:none) Actinidia deliciosa cysteine prote... 52 3e-05
BT050087_1(BT050087|pid:none) Salmo salar clone ssal-evd-563-114... 52 3e-05
AP003759_6(AP003759|pid:none) Oryza sativa Japonica Group genomi... 52 3e-05
AM471605_1(AM471605|pid:none) Vitis vinifera contig VV78X053392.... 52 3e-05
AK071907_1(AK071907|pid:none) Oryza sativa Japonica Group cDNA c... 51 3e-05
AJ004958_1(AJ004958|pid:none) Pisum sativum mRNA for TPE4A thiol... 51 3e-05
AY662996_1(AY662996|pid:none) Petunia x hybrida cysteine protein... 51 3e-05
AB300460_1(AB300460|pid:none) Lotus japonicus LjCyp2 mRNA for cy... 51 3e-05
CP001327_125(CP001327|pid:none) Micromonas sp. RCC299 chromosome... 51 3e-05
AB011377_1(AB011377|pid:none) Periplaneta americana mRNA for hom... 51 3e-05
AB098631_1(AB098631|pid:none) Daucus carota DcCysP8 mRNA for cys... 51 3e-05
DQ631808_1(DQ631808|pid:none) Lycopersicon esculentum phytophtho... 51 3e-05
AF072190_1(AF072190|pid:none) Oryzias latipes clone FS30-4 cathe... 51 3e-05
EF530145_1(EF530145|pid:none) Actinidia deliciosa cysteine prote... 51 3e-05
EF530142_1(EF530142|pid:none) Actinidia deliciosa cysteine prote... 51 4e-05
AB098629_1(AB098629|pid:none) Daucus carota DcCysP6 mRNA for cys... 51 4e-05
EF576540_1(EF576540|pid:none) Oryza sativa (indica cultivar-grou... 51 4e-05
(P25776) RecName: Full=Oryzain alpha chain; EC=3.4.22.-... 51 4e-05
FB844528_1(FB844528|pid:none) Sequence 63801 from Patent WO20080... 51 4e-05
U93166_1(U93166|pid:none) Prunus armeniaca cysteine protease mRN... 51 4e-05
AB267409_1(AB267409|pid:none) Triticum aestivum mRNA for tritica... 51 4e-05
AY159369_1(AY159369|pid:none) Leptinotarsa decemlineata clone In... 51 4e-05
D89588(D89588)protein R09F10.1 [imported] - Caenorhabditis elegans 51 4e-05
AL606692_8(AL606692|pid:none) Oryza sativa genomic DNA, chromoso... 51 4e-05
AB004648_1(AB004648|pid:none) Oryza sativa Japonica Group RepA g... 51 4e-05
AY891248_1(AY891248|pid:none) Synthetic construct Homo sapiens c... 50 6e-05
CR940352_253(CR940352|pid:none) Theileria annulata strain Ankara... 50 6e-05
AM488912_1(AM488912|pid:none) Vitis vinifera contig VV78X019368.... 50 6e-05
>(Q94504) RecName: Full=Cysteine proteinase 7; EC=3.4.22.-;
AltName: Full=Proteinase 1; Flags: Precursor;
&U72746_1(U72746|pid:none)
Length = 460
Score = 125 bits (313), Expect = 2e-27
Identities = 62/62 (100%), Positives = 62/62 (100%)
Frame = +1
Query: 13 SSYPYTAEDGKKCKFNPKNVAAQLSSYVNVTSGSESDLAAKVTQGPTSVAIDASNQSFQL 192
SSYPYTAEDGKKCKFNPKNVAAQLSSYVNVTSGSESDLAAKVTQGPTSVAIDASNQSFQL
Sbjct: 198 SSYPYTAEDGKKCKFNPKNVAAQLSSYVNVTSGSESDLAAKVTQGPTSVAIDASNQSFQL 257
Query: 193 YV 198
YV
Sbjct: 258 YV 259
Score = 109 bits (273), Expect = 8e-23
Identities = 49/49 (100%), Positives = 49/49 (100%)
Frame = +1
Query: 529 YPTAGDYWIVKNSWGTSWGMDGYILMTKGNNNQCGIATMASRPTAVASL 675
YPTAGDYWIVKNSWGTSWGMDGYILMTKGNNNQCGIATMASRPTAVASL
Sbjct: 412 YPTAGDYWIVKNSWGTSWGMDGYILMTKGNNNQCGIATMASRPTAVASL 460
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3204285
Number of Hits to DB: 798,969,417
Number of extensions: 11862465
Number of successful extensions: 29444
Number of sequences better than 10.0: 1453
Number of HSP's gapped: 29110
Number of HSP's successfully gapped: 2024
Length of query: 251
Length of database: 1,040,966,779
Length adjustment: 125
Effective length of query: 126
Effective length of database: 640,431,154
Effective search space: 80694325404
Effective search space used: 80694325404
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 31 (16.5 bits)
|