Contig-U10437-1
Contig ID Contig-U10437-1
Contig update 2002. 9.13
Contig sequence
>Contig-U10437-1 (Contig-U10437-1Q) /CSM_Contig/Contig-U10437-1Q.Seq.d
NNNNNNNNNNCAACCACCACAACCACAACAACCACCACAAAGACCACCAT
CCACCGTTATCGCTAAACCAGTTGCACCACAAGCACCAGTCGCACCACCA
CAAGCACCAGCTGCTGCTCCACAAGCTCCAGCTCCACCAGCTGCCCCACC
AGCTCCACCAACCCCATCATCAACATCTTTCAAACCACCACAATCATTCA
GTAAACCAGCAACTAAGACAGCTGCTGCAAACAAACCACCTTCACCATCC
TTATCAGCTCCACTCCCATCAACTGTAGCCAATGAAGATTTACAATCACC
CAAAGAAGAAATTTTAACTGAAGTTAGAAAGGAAATTCAAAAAGCTAAAG
ATGAAATTTTANAAGCAATCAG

Gap no gap
Contig length 372
Chromosome number (1..6, M) 5
Chromosome length 5062330
Start point 2857453
End point 2857091
Strand (PLUS/MINUS) MINUS
Number of clones 1
Number of EST 1
Link to clone list U10437
List of clone(s)

est1=VFJ385Z,1,363
Translated Amino Acid sequence
XXXQPPQPQQPPQRPPSTVIAKPVAPQAPVAPPQAPAAAPQAPAPPAAPPAPPTPSSTSF
KPPQSFSKPATKTAAANKPPSPSLSAPLPSTVANEDLQSPKEEILTEVRKEIQKAKDEIL
XAI


Translated Amino Acid sequence (All Frames)
Frame A:
xxxxtttttttttkttihryr*tscttstsrtttstsccstsssstscptsstnpiinif
qtttiiq*tsn*dscckqttftilisstpincsq*rftitqrrnfn*s*kgnsks*r*nf
xsnq


Frame B:
XXXQPPQPQQPPQRPPSTVIAKPVAPQAPVAPPQAPAAAPQAPAPPAAPPAPPTPSSTSF
KPPQSFSKPATKTAAANKPPSPSLSAPLPSTVANEDLQSPKEEILTEVRKEIQKAKDEIL
XAI


Frame C:
xxxnhhnhnnhhkdhhpplslnqlhhkhqshhhkhqlllhklqlhqlphqlhqphhqhls
nhhnhsvnqqlrqllqtnhlhhpyqlhshql*pmkiynhpkkkf*lklerkfkklkmkfx
kqs


own update 2004. 6.10
Homology vs CSM-cDNA
Query= Contig-U10437-1 (Contig-U10437-1Q)
/CSM_Contig/Contig-U10437-1Q.Seq.d
(372 letters)

Database: CSM
6905 sequences; 5,674,871 total letters


Score E
Sequences producing significant alignments: (bits) Value

Contig-U10437-1 (Contig-U10437-1Q) /CSM_Contig/Conti... 414 e-116
Contig-U12298-1 (Contig-U12298-1Q) /CSM_Contig/Conti... 36 0.026
Contig-U13218-1 (Contig-U13218-1Q) /CSM_Contig/Conti... 34 0.10
Contig-U11718-1 (Contig-U11718-1Q) /CSM_Contig/Conti... 34 0.10
Contig-U04903-1 (Contig-U04903-1Q) /CSM_Contig/Conti... 34 0.10
Contig-U14499-1 (Contig-U14499-1Q) /CSM_Contig/Conti... 32 0.40
Contig-U12301-1 (Contig-U12301-1Q) /CSM_Contig/Conti... 32 0.40
Contig-U11539-1 (Contig-U11539-1Q) /CSM_Contig/Conti... 32 0.40
Contig-U11414-1 (Contig-U11414-1Q) /CSM_Contig/Conti... 32 0.40

>Contig-U10437-1 (Contig-U10437-1Q) /CSM_Contig/Contig-U10437-1Q.Seq.d
Length = 372

Score = 414 bits (209), Expect = e-116
Identities = 212/212 (100%)
Strand = Plus / Plus


Query: 161 accccatcatcaacatctttcaaaccaccacaatcattcagtaaaccagcaactaagaca 220
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 161 accccatcatcaacatctttcaaaccaccacaatcattcagtaaaccagcaactaagaca 220


Query: 221 gctgctgcaaacaaaccaccttcaccatccttatcagctccactcccatcaactgtagcc 280
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 221 gctgctgcaaacaaaccaccttcaccatccttatcagctccactcccatcaactgtagcc 280


Query: 281 aatgaagatttacaatcacccaaagaagaaattttaactgaagttagaaaggaaattcaa 340
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 281 aatgaagatttacaatcacccaaagaagaaattttaactgaagttagaaaggaaattcaa 340


Query: 341 aaagctaaagatgaaattttanaagcaatcag 372
||||||||||||||||||||||||||||||||
Sbjct: 341 aaagctaaagatgaaattttanaagcaatcag 372


Score = 81.8 bits (41), Expect = 5e-16
Identities = 41/41 (100%)
Strand = Plus / Plus


Query: 56 gttatcgctaaaccagttgcaccacaagcaccagtcgcacc 96
|||||||||||||||||||||||||||||||||||||||||
Sbjct: 56 gttatcgctaaaccagttgcaccacaagcaccagtcgcacc 96


Score = 30.2 bits (15), Expect = 1.6
Identities = 15/15 (100%)
Strand = Plus / Plus


Query: 75 caccacaagcaccag 89
|||||||||||||||
Sbjct: 96 caccacaagcaccag 110


>Contig-U12298-1 (Contig-U12298-1Q) /CSM_Contig/Contig-U12298-1Q.Seq.d
Length = 1294

Score = 36.2 bits (18), Expect = 0.026
Identities = 18/18 (100%)
Strand = Plus / Plus


Query: 181 caaaccaccacaatcatt 198
||||||||||||||||||
Sbjct: 1118 caaaccaccacaatcatt 1135


>Contig-U13218-1 (Contig-U13218-1Q) /CSM_Contig/Contig-U13218-1Q.Seq.d
Length = 640

Score = 34.2 bits (17), Expect = 0.10
Identities = 17/17 (100%)
Strand = Plus / Plus


Query: 200 agtaaaccagcaactaa 216
|||||||||||||||||
Sbjct: 432 agtaaaccagcaactaa 448


Database: CSM
Posted date: Jun 9, 2004 7:35 PM
Number of letters in database: 5,674,871
Number of sequences in database: 6905

Lambda K H
1.37 0.711 1.31

Gapped
Lambda K H
1.37 0.711 1.31


Matrix: blastn matrix:1 -3
Gap Penalties: Existence: 5, Extension: 2
Number of Hits to DB: 2680
Number of Sequences: 6905
Number of extensions: 2680
Number of successful extensions: 320
Number of sequences better than 10.0: 91
length of query: 372
length of database: 5,674,871
effective HSP length: 16
effective length of query: 356
effective length of database: 5,564,391
effective search space: 1980923196
effective search space used: 1980923196
T: 0
A: 40
X1: 6 (11.9 bits)
X2: 15 (29.7 bits)
S1: 12 (24.3 bits)
S2: 14 (28.2 bits)
dna update 2008.11.20
Homology vs DNA
Query= Contig-U10437-1 (Contig-U10437-1Q) /CSM_Contig/Contig-U10437-1Q.Seq.d
(372 letters)

Database: ddbj_A
92,845,959 sequences; 95,242,211,685 total letters

Searching..................................................done

Score E
Sequences producing significant alignments: (bits) Value N

(BJ432802) Dictyostelium discoideum cDNA clone:ddv19j21, 3' ... 402 e-123 2
(AJ786025) Dictyostelium discoideum mRNA for VASP protein. 387 e-117 2
(BJ346269) Dictyostelium discoideum cDNA clone:dda30l10, 3' ... 387 e-112 2
(AU284496) Dictyostelium discoideum gamete cDNA clone:FC-AZ1... 387 e-103 1
(AU052782) Dictyostelium discoideum slug cDNA, clone SLK677. 387 e-103 1
(AU052498) Dictyostelium discoideum slug cDNA, clone SLD425. 387 e-103 1
(AU039275) Dictyostelium discoideum slug cDNA, clone SLH329. 387 e-103 1
(AU038176) Dictyostelium discoideum slug cDNA, clone SSH374. 387 e-103 1
(AU034182) Dictyostelium discoideum slug cDNA, clone SLC230. 387 e-103 1
(C91254) Dictyostelium discoideum slug cDNA, clone SSJ504. 387 e-103 1
(C90679) Dictyostelium discoideum slug cDNA, clone SSJ612. 387 e-103 1
(BJ345082) Dictyostelium discoideum cDNA clone:dda21e16, 3' ... 387 e-103 1
(BJ343894) Dictyostelium discoideum cDNA clone:dda17d18, 3' ... 387 e-103 1
(BJ342274) Dictyostelium discoideum cDNA clone:dda13a08, 3' ... 387 e-103 1
(BJ347376) Dictyostelium discoideum cDNA clone:dda26m22, 3' ... 276 e-102 3
(C22970) Dictyostelium discoideum gamete cDNA, clone FC-AL12. 381 e-101 1
(AU053524) Dictyostelium discoideum slug cDNA, clone SLI838. 357 1e-96 2
(AU053815) Dictyostelium discoideum slug cDNA, clone SLJ738. 357 1e-96 2
(BJ398372) Dictyostelium discoideum cDNA clone:dds12o02, 3' ... 355 7e-94 1
(AU284573) Dictyostelium discoideum gamete cDNA clone:FC-BD1... 323 8e-92 2
(AU052572) Dictyostelium discoideum slug cDNA, clone SLD538. 254 2e-63 1
(BJ440251) Dictyostelium discoideum cDNA clone:ddv43i04, 3' ... 157 3e-34 1
(BJ421568) Dictyostelium discoideum cDNA clone:ddv43i04, 5' ... 157 3e-34 1
(BJ345309) Dictyostelium discoideum cDNA clone:dda23e10, 3' ... 100 8e-33 3
(BJ326671) Dictyostelium discoideum cDNA clone:dda17d18, 5' ... 74 4e-09 1
(EA394875) Sequence 43699 from patent US 7314974. 46 0.87 1
(AC114514) Rattus norvegicus clone CH230-63A18, WORKING DRAF... 46 0.87 1
(AC106111) Rattus norvegicus clone CH230-140K16, *** SEQUENC... 46 0.87 1
(BP610534) Arabidopsis thaliana cDNA clone:RAFL16-11-N13, 3'... 46 0.87 1
(BP581202) Arabidopsis thaliana cDNA clone:RAFL14-30-O05, 3'... 46 0.87 1
(EY665201) CS00-C1-101-083-B10-CT.F Sweet orange leaf, infec... 46 0.87 1
(CP001037) Nostoc punctiforme PCC 73102, complete genome. 46 0.87 1
(AL772305) Mouse DNA sequence from clone RP23-86E8 on chromo... 32 1.7 2
(AZ751945) RPCI-24-128O1.TV RPCI-24 Mus musculus genomic clo... 32 2.4 2
(AY263397) Arabidopsis thaliana Nramp6b mRNA, complete cds; ... 44 3.4 1
(AY074865) Arabidopsis thaliana At1g15960/T24D18_6 mRNA, com... 44 3.4 1
(AJ291831) Arabidopsis thaliana mRNA for putative metal tran... 44 3.4 1
(AC010924) Arabidopsis thaliana chromosome 1 BAC T24D18 sequ... 44 3.4 1
(AC162846) Bos taurus clone CH240-121N14, WORKING DRAFT SEQU... 44 3.4 1
(AC151498) Dasypus novemcinctus clone VMRC5-119C6, WORKING D... 44 3.4 1
(AC151400) Dasypus novemcinctus clone VMRC5-220D23, WORKING ... 44 3.4 1
(AC095950) Rattus norvegicus clone CH230-11A19, *** SEQUENCI... 44 3.4 1
(AC095799) Rattus norvegicus clone CH230-9G3, *** SEQUENCING... 44 3.4 1
(AC173087) Bos taurus clone CH240-278H7, WORKING DRAFT SEQUE... 44 3.4 1
(ER527303) 1093015706481 Global-Ocean-Sampling_GS-35-01-01-1... 44 3.4 1
(AL090589) Arabidopsis thaliana genome survey sequence T7 en... 44 3.4 1
(B62436) T21L20TR TAMU Arabidopsis thaliana genomic clone T2... 44 3.4 1
(DN625587) UCRCA01_06K11_r Bark of Madame Vinous Sweet Orang... 44 3.4 1
(DN625586) UCRCA01_06K11_f Bark of Madame Vinous Sweet Orang... 44 3.4 1
(DB947719) Manihot esculenta mRNA, clone: CAS01_028_O05, 3'end. 44 3.4 1
(EY811125) PT11-C1-900-015-A12-CT.F Poncirus trifoliata leaf... 44 3.4 1
(AC147533) Macropus eugenii clone ME_KBa-311C4, complete seq... 42 3.5 3
(AY248861) Plasmodium falciparum DBLd14 erythrocyte membrane... 38 3.7 2
(BJ722687) Oryzias latipes cDNA clone:MF01FFA026p15, 3' end. 36 3.8 2
(ER564698) 1093015763209 Global-Ocean-Sampling_GS-36-01-01-2... 32 8.5 2

>(BJ432802) Dictyostelium discoideum cDNA clone:ddv19j21, 3' end,
single read.
Length = 363

Score = 402 bits (203), Expect(2) = e-123
Identities = 206/206 (100%)
Strand = Plus / Minus


Query: 167 tcatcaacatctttcaaaccaccacaatcattcagtaaaccagcaactaagacagctgct 226
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 207 tcatcaacatctttcaaaccaccacaatcattcagtaaaccagcaactaagacagctgct 148


Query: 227 gcaaacaaaccaccttcaccatccttatcagctccactcccatcaactgtagccaatgaa 286
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 147 gcaaacaaaccaccttcaccatccttatcagctccactcccatcaactgtagccaatgaa 88


Query: 287 gatttacaatcacccaaagaagaaattttaactgaagttagaaaggaaattcaaaaagct 346
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 87 gatttacaatcacccaaagaagaaattttaactgaagttagaaaggaaattcaaaaagct 28


Query: 347 aaagatgaaattttanaagcaatcag 372
||||||||||||||||||||||||||
Sbjct: 27 aaagatgaaattttanaagcaatcag 2

Score = 73.8 bits (37), Expect(2) = e-123
Identities = 37/37 (100%)
Strand = Plus / Minus


Query: 56 gttatcgctaaaccagttgcaccacaagcaccagtcg 92
|||||||||||||||||||||||||||||||||||||
Sbjct: 318 gttatcgctaaaccagttgcaccacaagcaccagtcg 282

Lambda K H
1.37 0.711 1.31

Matrix: blastn matrix:1 -3
Number of Sequences: 92845959
Number of Hits to DB: 285,087,149
Number of extensions: 17185594
Number of successful extensions: 1389404
Number of sequences better than 10.0: 55
Length of query: 372
Length of database: 95,242,211,685
Length adjustment: 23
Effective length of query: 349
Effective length of database: 93,106,754,628
Effective search space: 32494257365172
Effective search space used: 32494257365172
X1: 11 (21.8 bits)
S2: 21 (42.1 bits)

protein update 2009. 6.27
Homology vs Protein
Query= Contig-U10437-1 (Contig-U10437-1Q) /CSM_Contig/Contig-U10437-1Q.Seq.d
(372 letters)

Database: nrp_A
3,204,285 sequences; 1,040,966,779 total letters

Searching..................................................done

Score E
Sequences producing significant alignments: (bits) Value

X98534_1(X98534|pid:none) H.sapiens VASP gene, exons 4 to 13 and... 37 0.28
(P50552) RecName: Full=Vasodilator-stimulated phosphoprotein; ... 37 0.28
BC026019_1(BC026019|pid:none) Homo sapiens vasodilator-stimulate... 37 0.28
(P50551) RecName: Full=Vasodilator-stimulated phosphoprotein; ... 37 0.28
A84509_1(A84509|pid:none) Sequence 124 from Patent WO9845704. &... 37 0.28
(Q2TA49) RecName: Full=Vasodilator-stimulated phosphoprotein; ... 37 0.28
AY007501_1(AY007501|pid:none) Hirudo medicinalis enabled-like pr... 36 0.36
(P70460) RecName: Full=Vasodilator-stimulated phosphoprotein; ... 35 0.62
X98475_1(X98475|pid:none) M.musculus VASP gene. 35 0.62
AK170780_1(AK170780|pid:none) Mus musculus NOD-derived CD11c +ve... 35 0.62
BC134961_1(BC134961|pid:none) Danio rerio zgc:162320, mRNA (cDNA... 34 1.4
BC168841_1(BC168841|pid:none) Rattus norvegicus vasodilator-stim... 34 1.4
FN317007_1(FN317007|pid:none) Schistosoma japonicum isolate Anhu... 33 2.4
AL928979_1(AL928979|pid:none) Zebrafish DNA sequence from clone ... 33 2.4
(Q5R896) RecName: Full=Ena/VASP-like protein; AltName: Full=Ena/... 33 2.4
BX663502_1(BX663502|pid:none) Zebrafish DNA sequence from clone ... 33 2.4
FN357388_31(FN357388|pid:none) Schistosoma mansoni genome sequen... 33 4.0
BC049376_1(BC049376|pid:none) Homo sapiens Enah/Vasp-like, mRNA ... 32 6.8
BC077932_1(BC077932|pid:none) Xenopus laevis vasodilator-stimula... 32 6.8
AB173007_1(AB173007|pid:none) Macaca fascicularis brain cDNA clo... 32 6.8
BC065327_1(BC065327|pid:none) Danio rerio Enah/Vasp-like b, mRNA... 32 6.8
U72519_1(U72519|pid:none) Mus musculus Ena-VASP like protein (Ev... 32 6.8
BC155188_1(BC155188|pid:none) Danio rerio Enah/Vasp-like b, mRNA... 32 6.8
AK301379_1(AK301379|pid:none) Homo sapiens cDNA FLJ61429 complet... 32 6.8
(O08719) RecName: Full=Ena/VASP-like protein; AltName: Full=Ena/... 32 6.8
BC072836_1(BC072836|pid:none) Xenopus laevis MGC80202 protein, m... 32 6.8
AF131766_1(AF131766|pid:none) Homo sapiens clone 24860 Ena-VASP ... 32 6.8
BC059810_1(BC059810|pid:none) Mus musculus Ena-vasodilator stimu... 32 6.8
(Q9UI08) RecName: Full=Ena/VASP-like protein; AltName: Full=Ena/... 32 6.8

>X98534_1(X98534|pid:none) H.sapiens VASP gene, exons 4 to 13 and
joined CDS.
Length = 378

Score = 36.6 bits (83), Expect = 0.28
Identities = 16/27 (59%), Positives = 22/27 (81%)
Frame = +2

Query: 287 DLQSPKEEILTEVRKEIQKAKDEILXA 367
DLQ K+E+L EV+KE+QK K+EI+ A
Sbjct: 341 DLQRVKQELLEEVKKELQKVKEEIIEA 367

Lambda K H
0.318 0.134 0.401

Gapped
Lambda K H
0.267 0.0410 0.140

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3204285
Number of Hits to DB: 211,876,510
Number of extensions: 1789601
Number of successful extensions: 15916
Number of sequences better than 10.0: 29
Number of HSP's gapped: 15912
Number of HSP's successfully gapped: 29
Length of query: 124
Length of database: 1,040,966,779
Length adjustment: 90
Effective length of query: 34
Effective length of database: 752,581,129
Effective search space: 25587758386
Effective search space used: 25587758386
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 29 (15.8 bits)

PSORT

psg: 0.75 gvh: 0.36 alm: 0.53 top: 0.53 tms: 0.00 mit: 0.48 mip: 0.03
nuc: 0.00 erl: 0.00 erm: 0.00 pox: 0.00 px2: 0.00 vac: 0.00 rnp: 0.00
act: 0.00 caa: 0.00 yqr: 0.00 tyr: 0.00 leu: 0.00 gpi: 0.00 myr: 0.00
dna: 0.00 rib: 0.00 bac: 0.00 m1a: 0.00 m1b: 0.00 m2 : 0.00 mNt: 0.00
m3a: 0.00 m3b: 0.00 m_ : 1.00

68.0 %: mitochondrial
12.0 %: cytoplasmic
12.0 %: nuclear
4.0 %: cytoskeletal
4.0 %: peroxisomal

>> prediction for Contig-U10437-1 is mit

VS (DIR, S) 0
VH (FL, L) 0
VF (FL, S) 1
AH (FL, L) 0
AF (FL, S) 0
SL (DIR, L) 0
SS (DIR, S) 0
SH (FL, L) 0
SF (FL, S) 0
CH (FL, L) 0
CF (FL, S) 0
FCL (DIR, L) 0
FC (DIR, S) 0
FC-IC (SUB) 0