| Contig-U10417-1 |
| Contig ID |
Contig-U10417-1 |
| Contig update |
2002. 9.13 |
| Contig sequence |
 |
| Gap |
no gap |
| Contig length |
1015 |
| Chromosome number (1..6, M) |
1 |
| Chromosome length |
4919822 |
| Start point |
4055562 |
| End point |
4056577 |
| Strand (PLUS/MINUS) |
PLUS |
| Number of clones |
2 |
| Number of EST |
2 |
| Link to clone list |
U10417 |
| List of clone(s) |
|
| Translated Amino Acid sequence |
|
| Translated Amino Acid sequence (All Frames) |
|
| own update |
2004. 6.10 |
| Homology vs CSM-cDNA |
|
| dna update |
2008.11.20 |
| Homology vs DNA |
Query= Contig-U10417-1 (Contig-U10417-1Q) /CSM_Contig/Contig-U10417-1Q.Seq.d
(1015 letters)
Database: ddbj_A
92,845,959 sequences; 95,242,211,685 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value N
(BJ431997) Dictyostelium discoideum cDNA clone:ddv17d11, 3' ... 1049 0.0 1
(BJ416430) Dictyostelium discoideum cDNA clone:ddv26l11, 5' ... 898 0.0 3
(BJ416034) Dictyostelium discoideum cDNA clone:ddv24l18, 5' ... 80 1e-21 3
(BJ417864) Dictyostelium discoideum cDNA clone:ddv15h20, 5' ... 74 6e-20 3
(CP000123) Mycoplasma capricolum subsp. capricolum ATCC 2734... 46 6e-07 20
(BX293980) Mycoplasma mycoides subsp. mycoides SC str. PG1, ... 36 2e-05 20
(EJ364481) 1092963700421 Global-Ocean-Sampling_GS-28-01-01-1... 38 5e-05 4
(BA000026) Mycoplasma penetrans HF-2 DNA, complete genome. 40 6e-05 19
(EK145327) 1095456018323 Global-Ocean-Sampling_GS-31-01-01-1... 40 1e-04 5
(CP000962) Clostridium botulinum A3 str. Loch Maree, complet... 42 2e-04 20
(CP000942) Ureaplasma parvum serovar 3 str. ATCC 27815, comp... 40 3e-04 19
(AP009180) Candidatus Carsonella ruddii PV DNA, complete gen... 36 3e-04 12
(CP000939) Clostridium botulinum B1 str. Okra, complete genome. 42 3e-04 19
(AM412317) Clostridium botulinum A str. ATCC 3502 complete g... 42 5e-04 17
(EK467253) 1095469429716 Global-Ocean-Sampling_GS-32-01-01-1... 58 7e-04 1
(AY198133) Spiroplasma kunkelii strain CR2-3x partial genome... 34 9e-04 11
(AM180355) Clostridium difficile 630 complete genome. 40 0.001 21
(BA000016) Clostridium perfringens str. 13 DNA, complete gen... 36 0.001 20
(AM285304) Spiroplasma citri GII3-3X chromosome, contig Cont... 34 0.001 16
(CP000728) Clostridium botulinum F str. Langeland, complete ... 42 0.003 20
(CP000727) Clostridium botulinum A str. Hall, complete genome. 42 0.003 18
(CP000726) Clostridium botulinum A str. ATCC 19397, complete... 42 0.004 18
(AE014822) Plasmodium falciparum 3D7 chromosome 14 section 7... 42 0.004 13
(BA000021) Wigglesworthia glossinidia endosymbiont of Glossi... 34 0.005 19
(AE014837) Plasmodium falciparum 3D7 chromosome 11 section 2... 40 0.006 11
(CP001056) Clostridium botulinum B str. Eklund 17B, complete... 34 0.009 20
(EK263453) 1095462198549 Global-Ocean-Sampling_GS-31-01-01-1... 40 0.013 4
(CP000721) Clostridium beijerinckii NCIMB 8052, complete gen... 36 0.014 18
(AM285321) Spiroplasma citri GII3-3X chromosome, contig Cont... 34 0.016 9
(AE014852) Plasmodium falciparum 3D7 chromosome 12, section ... 36 0.018 12
(AE015929) Staphylococcus epidermidis ATCC 12228, complete g... 32 0.020 25
(CU469464) Candidatus Phytoplasma mali strain AT complete ch... 34 0.020 14
(EF773857) Mus musculus C57BL/6N IST10905G2BBF1 gene trap em... 50 0.021 2
(CP000312) Clostridium perfringens SM101, complete genome. 36 0.026 21
(CU468223) S.lycopersicum DNA sequence from clone LE_HBa-111... 44 0.027 7
(AE014817) Plasmodium falciparum 3D7 chromosome 14 section 2... 40 0.036 9
(DU600608) OO__Ba0097K02.r OO__Ba Oryza officinalis genomic ... 42 0.037 2
(CP000882) Hemiselmis andersenii chromosome 2, complete sequ... 36 0.039 8
(AJ235270) Rickettsia prowazekii strain Madrid E, complete g... 42 0.042 8
(AX392735) Sequence 25 from Patent WO0212526. 40 0.049 4
(AR707082) Sequence 25 from patent US 6933145. 40 0.049 4
(AC116956) Dictyostelium discoideum chromosome 2 map 1418423... 34 0.060 12
(CP000033) Lactobacillus acidophilus NCFM, complete genome. 40 0.072 18
(CP000825) Prochlorococcus marinus str. MIT 9215, complete g... 34 0.081 23
(CP001078) Clostridium botulinum E3 str. Alaska E43, complet... 34 0.086 21
(CP000673) Clostridium kluyveri DSM 555, complete genome. 34 0.087 22
(AC108613) Rattus norvegicus clone CH230-292H7, *** SEQUENCI... 36 0.091 6
(EJ650111) 1092953008016 Global-Ocean-Sampling_GS-30-02-01-1... 36 0.091 3
(AP009351) Staphylococcus aureus subsp. aureus str. Newman D... 36 0.094 19
(EJ698933) 1092956029173 Global-Ocean-Sampling_GS-30-02-01-1... 36 0.095 3
(AE014824) Plasmodium falciparum 3D7 chromosome 14 section 9... 32 0.098 12
(AC115684) Dictyostelium discoideum chromosome 2 map 3108975... 32 0.11 10
(AC025949) Staphylococcus aureus clone sabac-114, complete s... 42 0.11 5
(CR940348) Theileria annulata genomic DNA chromosome 2. 36 0.11 21
(AE013218) Buchnera aphidicola str. Sg (Schizaphis graminum)... 34 0.11 15
(AL445564) Mycoplasma pulmonis (strain UAB CTIP) complete ge... 34 0.13 15
(AC117072) Dictyostelium discoideum chromosome 2 map 3879572... 36 0.13 11
(AP010798) Solanum lycopersicum DNA, chromosome 8, clone: C0... 38 0.15 5
(AC171157) Atelerix albiventris clone LB4-282D8, WORKING DRA... 34 0.16 10
(AC115612) Dictyostelium discoideum chromosome 2 map 6245135... 34 0.16 11
(AC102224) Mus musculus chromosome 3, clone RP24-372D1, comp... 50 0.17 1
(AC192940) Pan troglodytes BAC clone CH251-374A17 from chrom... 50 0.17 1
(AL390840) Human DNA sequence from clone RP13-213K19 on chro... 50 0.17 1
(AL355523) Human DNA sequence *** SEQUENCING CANCELLED *** f... 50 0.17 1
(CP000382) Clostridium novyi NT, complete genome. 50 0.17 1
(CP000083) Colwellia psychrerythraea 34H, complete genome. 50 0.17 1
(AE017263) Mesoplasma florum L1 complete genome. 32 0.17 18
(AM285305) Spiroplasma citri GII3-3X chromosome, contig Cont... 32 0.17 11
(ER303163) 1092343722065 Global-Ocean-Sampling_GS-34-01-01-1... 48 0.17 2
(AC117176) Dictyostelium discoideum chromosome 2 map 5018074... 32 0.18 12
(AC116957) Dictyostelium discoideum chromosome 2 map 1685067... 32 0.18 15
(BA000018) Staphylococcus aureus subsp. aureus N315 DNA, com... 46 0.18 19
(AF250284) Amsacta moorei entomopoxvirus, complete genome. 38 0.19 11
(EK384179) 1095469474856 Global-Ocean-Sampling_GS-31-01-01-1... 44 0.19 2
(AC115592) Dictyostelium discoideum chromosome 2 map 1-12595... 32 0.20 12
(AE016826) Buchnera aphidicola str. Bp (Baizongia pistaciae)... 36 0.20 15
(AE014821) Plasmodium falciparum 3D7 chromosome 14 section 6... 36 0.21 13
(AC190027) Glycine max clone gmp1-134b7, WORKING DRAFT SEQUE... 30 0.22 12
(AE009951) Fusobacterium nucleatum subsp. nucleatum ATCC 255... 34 0.23 22
(BA000017) Staphylococcus aureus subsp. aureus Mu50 DNA, com... 36 0.24 19
(AP009324) Staphylococcus aureus subsp. aureus Mu3 DNA, comp... 36 0.24 19
(AC116984) Dictyostelium discoideum chromosome 2 map 2567470... 32 0.25 18
(AC092948) Homo sapiens 3 BAC RP11-536F13 (Roswell Park Canc... 34 0.25 9
(CP000736) Staphylococcus aureus subsp. aureus JH1, complete... 36 0.26 19
(CP000703) Staphylococcus aureus subsp. aureus JH9, complete... 36 0.26 19
(AJ938182) Staphylococcus aureus RF122 complete genome. 36 0.27 20
(AC116977) Dictyostelium discoideum chromosome 2 map 5515173... 34 0.28 14
(AE014827) Plasmodium falciparum 3D7 chromosome 14 section 1... 32 0.30 9
(CU463976) Pig DNA sequence *** SEQUENCING IN PROGRESS *** f... 36 0.31 6
(EK415209) 1095506309991 Global-Ocean-Sampling_GS-31-01-01-1... 38 0.32 3
(EK148953) 1095456038193 Global-Ocean-Sampling_GS-31-01-01-1... 36 0.32 3
(AC087797) Oryza sativa chromosome 3 BAC OSJNBb0022E02 genom... 44 0.32 7
(AM478927) Vitis vinifera contig VV78X213699.5, whole genome... 48 0.33 2
(CU550726) Pig DNA sequence *** SEQUENCING IN PROGRESS *** f... 38 0.33 6
(EJ991667) 1093023054551 Global-Ocean-Sampling_GS-30-02-01-1... 36 0.35 3
(AY653733) Acanthamoeba polyphaga mimivirus, complete genome. 34 0.35 18
(EJ877860) 1093018380190 Global-Ocean-Sampling_GS-30-02-01-1... 36 0.36 3
(CP000896) Acholeplasma laidlawii PG-8A, complete genome. 40 0.36 23
(EJ952198) 1093018953683 Global-Ocean-Sampling_GS-30-02-01-1... 36 0.38 3
(CU914794) Pig DNA sequence *** SEQUENCING IN PROGRESS *** f... 38 0.38 7
>(BJ431997) Dictyostelium discoideum cDNA clone:ddv17d11, 3' end,
single read.
Length = 634
Score = 1049 bits (529), Expect = 0.0
Identities = 607/633 (95%)
Strand = Plus / Minus
Query: 383 ttttatcaaaaaatttaaaagaacaattaaattttgatggtgatgataaaattgaacaaa 442
||||||||||||||||||||||||||||||||||||||||||| ||| | ||||||||||
Sbjct: 634 ttttatcaaaaaatttaaaagaacaattaaattttgatggtgacgatgatattgaacaaa 575
Query: 443 ttattgagactaaatcaggtattgtcaaaacatatccattattaaaacatcatttaaata 502
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 574 ttattgagactaaatcaggtattgtcaaaacatatccattattaaaacatcatttaaata 515
Query: 503 ataaagaaaaggatgttataatggtgaaagttaatatgggaacatctaaaatatcaagat 562
||||||| || ||||||||||||||||||||||||||||||||| | ||| | |||||||
Sbjct: 514 ataaagataatgatgttataatggtgaaagttaatatgggaacaccaaaagtttcaagat 455
Query: 563 taattaatgaaattgattataatattccaaaaactttaagtaaacaatcaccacttgaaa 622
| ||||| ||||| ||| | ||||||||||| ||||| || || |||||| |||| |
Sbjct: 454 ttattaacgaaatcgatcgtcatattccaaaagttttaacaaatcagtcaccaattgaga 395
Query: 623 gttacatgtacaccattgatattggattaccatactgttcaaaattagaatgtgtttatg 682
|||| ||||| ||||||||||| |||||||||||||||||||||||||||||||||||||
Sbjct: 394 gttatatgtataccattgatatcggattaccatactgttcaaaattagaatgtgtttatg 335
Query: 683 taacagttggaggcaaccaatgtgttgtatttatcgatagaaatattgaattgggttatt 742
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 334 taacagttggaggcaaccaatgtgttgtatttatcgatagaaatattgaattgggttatt 275
Query: 743 tagattcttcatatggtgatcatacaaaattctcaacaattgattttaaagagatttcag 802
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 274 tagattcttcatatggtgatcatacaaaattctcaacaattgattttaaagagatttcag 215
Query: 803 atattattcaaagtaatgtaaatggttttgatgatattccaaatgttgaatttgtaattc 862
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 214 atattattcaaagtaatgtaaatggttttgatgatattccaaatgttgaatttgtaattc 155
Query: 863 aatcaccacaagataaacttgaaaataaagttatctcaagagttgttgaaagaggtaatg 922
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 154 aatcaccacaagataaacttgaaaataaagttatctcaagagttgttgaaagaggtaatg 95
Query: 923 gtgaaacattagcatgtggtactggtgcatgtggtgtagcaatatcatcaattctcaaag 982
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 94 gtgaaacattagcatgtggtactggtgcatgtggtgtagcaatatcatcaattctcaaag 35
Query: 983 gttattgtaatgaaaatactgaaattactgttg 1015
|||||||||||||||||||||||||||||||||
Sbjct: 34 gttattgtaatgaaaatactgaaattactgttg 2
Lambda K H
1.37 0.711 1.31
Matrix: blastn matrix:1 -3
Number of Sequences: 92845959
Number of Hits to DB: 1,448,394,041
Number of extensions: 96386360
Number of successful extensions: 8905206
Number of sequences better than 10.0: 440
Length of query: 1015
Length of database: 95,242,211,685
Length adjustment: 24
Effective length of query: 991
Effective length of database: 97,308,875,965
Effective search space: 96433096081315
Effective search space used: 96433096081315
X1: 11 (21.8 bits)
S2: 22 (44.1 bits)
|
| protein update |
2009. 6.27 |
| Homology vs Protein |
Query= Contig-U10417-1 (Contig-U10417-1Q) /CSM_Contig/Contig-U10417-1Q.Seq.d
(1015 letters)
Database: nrp_A
3,204,285 sequences; 1,040,966,779 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
CP000786_576(CP000786|pid:none) Leptospira biflexa serovar Patoc... 111 5e-23
AP008230_2743(AP008230|pid:none) Desulfitobacterium hafniense Y5... 106 1e-21
(B3PEI8) RecName: Full=Diaminopimelate epimerase; Short... 106 1e-21
CP000742_4(CP000742|pid:none) Methanococcus vannielii SB, comple... 106 1e-21
(Q72W63) RecName: Full=Diaminopimelate epimerase; Short... 105 2e-21
CP000867_1724(CP000867|pid:none) Methanococcus maripaludis C6, c... 105 2e-21
CP001336_3852(CP001336|pid:none) Desulfitobacterium hafniense DC... 105 3e-21
CP001147_1104(CP001147|pid:none) Thermodesulfovibrio yellowstoni... 104 6e-21
BX950229_917(BX950229|pid:none) Methanococcus maripaludis strain... 103 9e-21
CP000745_161(CP000745|pid:none) Methanococcus maripaludis C7, co... 103 1e-20
CP000551_970(CP000551|pid:none) Prochlorococcus marinus str. AS9... 102 2e-20
CP001098_1146(CP001098|pid:none) Halothermothrix orenii H 168, c... 102 2e-20
CP000609_717(CP000609|pid:none) Methanococcus maripaludis C5, co... 102 3e-20
CP001089_3290(CP001089|pid:none) Geobacter lovleyi SZ, complete ... 102 3e-20
CP000111_971(CP000111|pid:none) Prochlorococcus marinus str. MIT... 101 4e-20
(Q04W97) RecName: Full=Diaminopimelate epimerase; Short... 101 5e-20
CP001083_2022(CP001083|pid:none) Clostridium botulinum Ba4 str. ... 101 5e-20
CP000382_1055(CP000382|pid:none) Clostridium novyi NT, complete ... 101 5e-20
CP000698_3842(CP000698|pid:none) Geobacter uraniireducens Rf4, c... 100 8e-20
CP001390_1381(CP001390|pid:none) Geobacter sp. FRC-32, complete ... 100 8e-20
(A1AWJ5) RecName: Full=Diaminopimelate epimerase; Short... 100 1e-19
(Q3AC09) RecName: Full=Diaminopimelate epimerase; Short... 99 2e-19
CP000576_972(CP000576|pid:none) Prochlorococcus marinus str. MIT... 99 3e-19
CP000116_2526(CP000116|pid:none) Thiobacillus denitrificans ATCC... 99 3e-19
(A4J568) RecName: Full=Diaminopimelate epimerase; Short... 98 4e-19
CP001154_1844(CP001154|pid:none) Laribacter hongkongensis HLHK9,... 98 4e-19
CP000482_3365(CP000482|pid:none) Pelobacter propionicus DSM 2379... 97 7e-19
CP000148_2957(CP000148|pid:none) Geobacter metallireducens GS-15... 97 7e-19
AE017180_528(AE017180|pid:none) Geobacter sulfurreducens PCA, co... 97 7e-19
CP001339_44(CP001339|pid:none) Thioalkalivibrio sp. HL-EbGR7, co... 97 9e-19
CP000142_3282(CP000142|pid:none) Pelobacter carbinolicus DSM 238... 97 9e-19
CP001087_3703(CP001087|pid:none) Desulfobacterium autotrophicum ... 97 1e-18
CP001104_403(CP001104|pid:none) Eubacterium eligens ATCC 27750, ... 96 2e-18
(Q0W3B6) RecName: Full=Diaminopimelate epimerase; Short... 96 3e-18
(A7GUE1) RecName: Full=Diaminopimelate epimerase; Short... 96 3e-18
CP000922_2379(CP000922|pid:none) Anoxybacillus flavithermus WK1,... 95 3e-18
(Q46185) RecName: Full=Diaminopimelate epimerase; Short... 95 4e-18
(A0RKC7) RecName: Full=Diaminopimelate epimerase; Short... 95 4e-18
(Q9K7F0) RecName: Full=Diaminopimelate epimerase; Short... 95 4e-18
CP001358_1134(CP001358|pid:none) Desulfovibrio desulfuricans sub... 95 4e-18
CP001393_2024(CP001393|pid:none) Anaerocellum thermophilum DSM 6... 94 6e-18
(B7JDJ2) RecName: Full=Diaminopimelate epimerase; Short... 94 1e-17
CP000109_404(CP000109|pid:none) Thiomicrospira crunogena XCL-2, ... 94 1e-17
BT041126_1(BT041126|pid:none) Zea mays full-length cDNA clone ZM... 94 1e-17
(A2ZLS4) RecName: Full=Putative diaminopimelate epimerase, chlor... 93 1e-17
(Q816D1) RecName: Full=Diaminopimelate epimerase; Short... 93 1e-17
CP001078_2109(CP001078|pid:none) Clostridium botulinum E3 str. A... 93 1e-17
(B2HX82) RecName: Full=Diaminopimelate epimerase; Short... 93 1e-17
(Q2QNF7) RecName: Full=Putative diaminopimelate epimerase, chlor... 93 2e-17
(Q2Y5Z0) RecName: Full=Diaminopimelate epimerase; Short... 92 2e-17
(Q6LLN5) RecName: Full=Diaminopimelate epimerase; Short... 92 2e-17
(B0VDN4) RecName: Full=Diaminopimelate epimerase; Short... 92 3e-17
(B2A663) RecName: Full=Diaminopimelate epimerase; Short... 92 3e-17
CP000552_969(CP000552|pid:none) Prochlorococcus marinus str. MIT... 92 4e-17
(B7HBI0) RecName: Full=Diaminopimelate epimerase; Short... 92 4e-17
CP001056_2352(CP001056|pid:none) Clostridium botulinum B str. Ek... 91 5e-17
CT573072_314(CT573072|pid:none) Kuenenia stuttgartiensis genome ... 91 5e-17
(O32114) RecName: Full=Diaminopimelate epimerase; Short... 91 5e-17
(Q0AIP0) RecName: Full=Diaminopimelate epimerase; Short... 91 6e-17
BT033271_1(BT033271|pid:none) Zea mays full-length cDNA clone ZM... 91 6e-17
CP001107_1420(CP001107|pid:none) Eubacterium rectale ATCC 33656,... 91 6e-17
BT085414_1(BT085414|pid:none) Zea mays full-length cDNA clone ZM... 91 8e-17
CP000712_5078(CP000712|pid:none) Pseudomonas putida F1, complete... 91 8e-17
(B7IMV5) RecName: Full=Diaminopimelate epimerase; Short... 90 1e-16
(B2KDH2) RecName: Full=Diaminopimelate epimerase; Short... 90 1e-16
(B0TGR9) RecName: Full=Diaminopimelate epimerase; Short... 90 1e-16
(Q500B6) RecName: Full=Diaminopimelate epimerase; Short... 90 1e-16
CP000655_1995(CP000655|pid:none) Polynucleobacter necessarius su... 90 1e-16
(A9VN01) RecName: Full=Diaminopimelate epimerase; Short... 89 2e-16
(Q88B09) RecName: Full=Diaminopimelate epimerase; Short... 89 2e-16
(A5UHQ4) RecName: Full=Diaminopimelate epimerase; Short... 89 2e-16
(Q3K4R8) RecName: Full=Diaminopimelate epimerase; Short... 89 2e-16
CP000284_196(CP000284|pid:none) Methylobacillus flagellatus KT, ... 89 2e-16
(Q65RL9) RecName: Full=Diaminopimelate epimerase; Short... 89 2e-16
CR925678_21(CR925678|pid:none) Ehrlichia ruminantium str. Welgev... 89 3e-16
(A7Z8D3) RecName: Full=Diaminopimelate epimerase; Short... 89 3e-16
(Q1QSV1) RecName: Full=Diaminopimelate epimerase; Short... 88 4e-16
(B0VT30) RecName: Full=Diaminopimelate epimerase; Short... 88 4e-16
AP009049_1101(AP009049|pid:none) Clostridium kluyveri NBRC 12016... 88 4e-16
(Q2JUV6) RecName: Full=Diaminopimelate epimerase; Short... 88 4e-16
(Q4FV85) RecName: Full=Diaminopimelate epimerase; Short... 88 4e-16
(Q3BXU3) RecName: Full=Diaminopimelate epimerase; Short... 88 4e-16
AP008955_4117(AP008955|pid:none) Brevibacillus brevis NBRC 10059... 88 5e-16
CP000514_488(CP000514|pid:none) Marinobacter aquaeolei VT8, comp... 88 5e-16
(A8MH77) RecName: Full=Diaminopimelate epimerase; Short... 87 9e-16
CP000678_1372(CP000678|pid:none) Methanobrevibacter smithii ATCC... 87 9e-16
CP000721_1584(CP000721|pid:none) Clostridium beijerinckii NCIMB ... 87 9e-16
(A8F1I9) RecName: Full=Diaminopimelate epimerase; Short... 87 1e-15
CP000236_46(CP000236|pid:none) Ehrlichia chaffeensis str. Arkans... 87 1e-15
(O27389) RecName: Full=Diaminopimelate epimerase; Short... 87 1e-15
(A6L7E5) RecName: Full=Diaminopimelate epimerase; Short... 87 1e-15
AE013598_3906(AE013598|pid:none) Xanthomonas oryzae pv. oryzae K... 86 2e-15
(Q2NYV5) RecName: Full=Diaminopimelate epimerase; Short... 86 2e-15
CP000113_4923(CP000113|pid:none) Myxococcus xanthus DK 1622, com... 86 2e-15
(Q12S90) RecName: Full=Diaminopimelate epimerase; Short... 86 2e-15
CR925677_21(CR925677|pid:none) Ehrlichia ruminantium str. Gardel... 86 2e-15
(A6L8U3) RecName: Full=Diaminopimelate epimerase; Short... 86 2e-15
(B3GYL3) RecName: Full=Diaminopimelate epimerase; Short... 86 2e-15
(Q15NG5) RecName: Full=Diaminopimelate epimerase; Short... 86 2e-15
(Q7MQC1) RecName: Full=Diaminopimelate epimerase; Short... 86 3e-15
CP000472_391(CP000472|pid:none) Shewanella piezotolerans WP3, co... 86 3e-15
(B0UWU6) RecName: Full=Diaminopimelate epimerase; Short... 86 3e-15
CT978603_1190(CT978603|pid:none) Synechococcus sp. RCC307 genomi... 86 3e-15
CP000097_1097(CP000097|pid:none) Synechococcus sp. CC9902, compl... 85 3e-15
CP000117_3071(CP000117|pid:none) Anabaena variabilis ATCC 29413,... 85 3e-15
(Q4ULS7) RecName: Full=Diaminopimelate epimerase; Short... 85 3e-15
(A4XNX4) RecName: Full=Diaminopimelate epimerase; Short... 85 3e-15
(A0KFI1) RecName: Full=Diaminopimelate epimerase; Short... 85 5e-15
(A8GND7) RecName: Full=Diaminopimelate epimerase; Short... 85 5e-15
(Q7V7M5) RecName: Full=Diaminopimelate epimerase; Short... 85 5e-15
(Q8R9S4) RecName: Full=Diaminopimelate epimerase; Short... 84 6e-15
(A4ISE8) RecName: Full=Diaminopimelate epimerase; Short... 84 6e-15
AE003852_125(AE003852|pid:none) Vibrio cholerae O1 biovar eltor ... 84 6e-15
FM954972_2859(FM954972|pid:none) Vibrio splendidus LGP32 chromos... 84 8e-15
AM421808_678(AM421808|pid:none) Neisseria meningitidis serogroup... 84 8e-15
(A6VQR8) RecName: Full=Diaminopimelate epimerase; Short... 84 8e-15
(Q7VRM5) RecName: Full=Diaminopimelate epimerase; Short... 84 1e-14
(A6TRX5) RecName: Full=Diaminopimelate epimerase; Short... 84 1e-14
(A4G980) RecName: Full=Diaminopimelate epimerase; Short... 84 1e-14
(Q64SY7) RecName: Full=Diaminopimelate epimerase; Short... 83 1e-14
(Q491Z7) RecName: Full=Diaminopimelate epimerase; Short... 83 1e-14
(Q9K060) RecName: Full=Diaminopimelate epimerase; Short... 83 2e-14
(Q5QUS6) RecName: Full=Diaminopimelate epimerase; Short... 82 2e-14
(Q5WZH5) RecName: Full=Diaminopimelate epimerase; Short... 82 2e-14
(P59582) RecName: Full=Diaminopimelate epimerase; Short... 82 2e-14
AY658756_1(AY658756|pid:none) Synthetic construct Peudomonas aer... 82 3e-14
(Q0ACL9) RecName: Full=Diaminopimelate epimerase; Short... 82 3e-14
(B7V5G9) RecName: Full=Diaminopimelate epimerase; Short... 82 3e-14
CP000923_1726(CP000923|pid:none) Thermoanaerobacter sp. X514, co... 82 3e-14
(A6VE52) RecName: Full=Diaminopimelate epimerase; Short... 82 4e-14
(A7N0W0) RecName: Full=Diaminopimelate epimerase; Short... 82 4e-14
(Q5X822) RecName: Full=Diaminopimelate epimerase; Short... 82 4e-14
CP000529_3405(CP000529|pid:none) Polaromonas naphthalenivorans C... 81 5e-14
(Q7VPN0) RecName: Full=Diaminopimelate epimerase; Short... 81 5e-14
CP000263_347(CP000263|pid:none) Buchnera aphidicola str. Cc (Cin... 81 5e-14
(B0RNK1) RecName: Full=Diaminopimelate epimerase; Short... 81 7e-14
(A3Q9P7) RecName: Full=Diaminopimelate epimerase; Short... 81 7e-14
AE016795_1057(AE016795|pid:none) Vibrio vulnificus CMCP6 chromos... 80 9e-14
(Q68WW4) RecName: Full=Diaminopimelate epimerase; Short... 80 9e-14
(B7KH06) RecName: Full=Diaminopimelate epimerase; Short... 80 1e-13
AY744381_3(AY744381|pid:none) Buchnera aphidicola (Cinara cedri)... 80 1e-13
AP006627_2925(AP006627|pid:none) Bacillus clausii KSM-K16 DNA, c... 80 1e-13
(Q5E1W7) RecName: Full=Diaminopimelate epimerase; Short... 79 2e-13
CP001157_4607(CP001157|pid:none) Azotobacter vinelandii DJ, comp... 79 2e-13
AP007255_215(AP007255|pid:none) Magnetospirillum magneticum AMB-... 79 3e-13
(B1KQD0) RecName: Full=Diaminopimelate epimerase; Short... 79 3e-13
CP001219_2602(CP001219|pid:none) Acidithiobacillus ferrooxidans ... 79 3e-13
(A8G0W0) RecName: Full=Diaminopimelate epimerase; Short... 79 3e-13
(Q8E9H5) RecName: Full=Diaminopimelate epimerase; Short... 79 3e-13
CR954202_519(CR954202|pid:none) Ostreococcus tauri strain OTTH05... 78 4e-13
AE017282_813(AE017282|pid:none) Methylococcus capsulatus str. Ba... 78 4e-13
CP001230_1007(CP001230|pid:none) Persephonella marina EX-H1, com... 78 4e-13
(Q21P78) RecName: Full=Diaminopimelate epimerase; Short... 78 4e-13
(Q8K901) RecName: Full=Diaminopimelate epimerase; Short... 78 4e-13
CP000647_4252(CP000647|pid:none) Klebsiella pneumoniae subsp. pn... 78 6e-13
AM778953_79(AM778953|pid:none) Microcystis aeruginosa PCC 7806 g... 78 6e-13
BX569692_200(BX569692|pid:none) Synechococcus sp. WH8102 complet... 78 6e-13
AP006840_234(AP006840|pid:none) Symbiobacterium thermophilum IAM... 78 6e-13
AP006725_153(AP006725|pid:none) Klebsiella pneumoniae NTUH-K2044... 78 6e-13
BX640420_130(BX640420|pid:none) Bordetella pertussis strain Toha... 78 6e-13
(B6EP85) RecName: Full=Diaminopimelate epimerase; Short... 77 7e-13
(O29511) RecName: Full=Diaminopimelate epimerase; Short... 77 7e-13
(Q7NV18) RecName: Full=Diaminopimelate epimerase; Short... 77 7e-13
CP001616_3079(CP001616|pid:none) Tolumonas auensis DSM 9187, com... 77 7e-13
DQ295237_43(DQ295237|pid:none) Uncultured marine bacterium Ant4D... 77 7e-13
CP000967_861(CP000967|pid:none) Xanthomonas oryzae pv. oryzae PX... 77 9e-13
EF676723_1(EF676723|pid:none) Picea sitchensis clone WS02749_N08... 77 9e-13
AM167904_155(AM167904|pid:none) Bordetella avium 197N complete g... 77 9e-13
AE008923_631(AE008923|pid:none) Xanthomonas axonopodis pv. citri... 77 9e-13
(Q31LW2) RecName: Full=Diaminopimelate epimerase; Short... 77 9e-13
CP001100_925(CP001100|pid:none) Chloroherpeton thalassium ATCC 3... 76 2e-12
(B4U9P0) RecName: Full=Diaminopimelate epimerase; Short... 76 2e-12
(B2IA16) RecName: Full=Diaminopimelate epimerase; Short... 76 2e-12
(Q2NQF4) RecName: Full=Diaminopimelate epimerase; Short... 76 2e-12
(B4F1X7) RecName: Full=Diaminopimelate epimerase; Short... 76 2e-12
AE009442_661(AE009442|pid:none) Xylella fastidiosa Temecula1, co... 76 2e-12
CT971583_1262(CT971583|pid:none) Synechococcus WH7803 complete g... 76 2e-12
(A1WWB3) RecName: Full=Diaminopimelate epimerase; Short... 76 2e-12
CU928162_4373(CU928162|pid:none) Escherichia coli ED1a chromosom... 75 3e-12
(Q0SZ00) RecName: Full=Diaminopimelate epimerase; Short... 75 3e-12
AP009510_642(AP009510|pid:none) Uncultured Termite group 1 bacte... 75 3e-12
CP000582_81(CP000582|pid:none) Ostreococcus lucimarinus CCE9901 ... 75 3e-12
CP000577_2577(CP000577|pid:none) Rhodobacter sphaeroides ATCC 17... 75 3e-12
(Q3IEW3) RecName: Full=Diaminopimelate epimerase; Short... 75 3e-12
AE014075_4632(AE014075|pid:none) Escherichia coli CFT073, comple... 75 5e-12
(Q8FBN6) RecName: Full=Diaminopimelate epimerase; Short... 75 5e-12
(A7ZU14) RecName: Full=Diaminopimelate epimerase; Short... 74 6e-12
AE005174_4768(AE005174|pid:none) Escherichia coli O157:H7 EDL933... 74 6e-12
(B2UD25) RecName: Full=Diaminopimelate epimerase; Short... 74 6e-12
(Q0HN95) RecName: Full=Diaminopimelate epimerase; Short... 74 6e-12
(A4WG08) RecName: Full=Diaminopimelate epimerase; Short... 74 8e-12
CP001251_719(CP001251|pid:none) Dictyoglomus turgidum DSM 6724, ... 74 8e-12
CP001111_3470(CP001111|pid:none) Stenotrophomonas maltophilia R5... 74 8e-12
(Q9PD98) RecName: Full=Diaminopimelate epimerase; Short... 74 1e-11
(Q5NNL4) RecName: Full=Diaminopimelate epimerase; Short... 74 1e-11
(Q476V3) RecName: Full=Diaminopimelate epimerase; Short... 73 1e-11
(A8G852) RecName: Full=Diaminopimelate epimerase; Short... 73 1e-11
(B2VI49) RecName: Full=Diaminopimelate epimerase; Short... 73 2e-11
(A1SAP5) RecName: Full=Diaminopimelate epimerase; Short... 73 2e-11
CP000435_1336(CP000435|pid:none) Synechococcus sp. CC9311, compl... 73 2e-11
CP000688_662(CP000688|pid:none) Dehalococcoides sp. BAV1, comple... 73 2e-11
CP001146_608(CP001146|pid:none) Dictyoglomus thermophilum H-6-12... 73 2e-11
CP001158_539(CP001158|pid:none) Buchnera aphidicola str. Tuc7 (A... 73 2e-11
CP000230_1179(CP000230|pid:none) Rhodospirillum rubrum ATCC 1117... 73 2e-11
EU016673_18(EU016673|pid:none) Uncultured marine bacterium HF400... 72 2e-11
CP001080_164(CP001080|pid:none) Sulfurihydrogenibium sp. YO3AOP1... 72 2e-11
AJ965256_597(AJ965256|pid:none) Dehalococcoides sp. CBDB1 comple... 72 2e-11
FP236842_203(FP236842|pid:none) Erwinia pyrifoliae strain Ep1/96... 72 3e-11
(Q3IZB6) RecName: Full=Diaminopimelate epimerase; Short... 72 4e-11
CP000815_140(CP000815|pid:none) Paulinella chromatophora chromat... 72 4e-11
CP001344_347(CP001344|pid:none) Cyanothece sp. PCC 7425, complet... 71 5e-11
(A1V7L3) RecName: Full=Diaminopimelate epimerase; Short... 71 7e-11
(Q63YH7) RecName: Full=Diaminopimelate epimerase; Short... 71 7e-11
CP000102_1525(CP000102|pid:none) Methanosphaera stadtmanae DSM 3... 70 9e-11
(A0B6C1) RecName: Full=Diaminopimelate epimerase; Short... 70 1e-10
BA000045_815(BA000045|pid:none) Gloeobacter violaceus PCC 7421 D... 70 1e-10
(Q0BAY6) RecName: Full=Diaminopimelate epimerase; Short... 70 2e-10
X12968_1(X12968|pid:none) E. coli dapF gene for diaminopimelate ... 70 2e-10
(A4JIQ6) RecName: Full=Diaminopimelate epimerase; Short... 70 2e-10
(B2AGE5) RecName: Full=Diaminopimelate epimerase; Short... 70 2e-10
(A1JI90) RecName: Full=Diaminopimelate epimerase; Short... 69 2e-10
(Q9A280) RecName: Full=Diaminopimelate epimerase; Short... 69 2e-10
AM747720_512(AM747720|pid:none) Burkholderia cenocepacia J2315 c... 69 2e-10
(Q6AE05) RecName: Full=Diaminopimelate epimerase; Short... 69 2e-10
CP000910_715(CP000910|pid:none) Renibacterium salmoninarum ATCC ... 69 2e-10
AY593479_28(AY593479|pid:none) Collimonas fungivorans fosmid CFU... 69 2e-10
CP000151_3246(CP000151|pid:none) Burkholderia sp. 383 chromosome... 69 3e-10
CP000108_336(CP000108|pid:none) Chlorobium chlorochromatii CaD3,... 69 3e-10
(A1K306) RecName: Full=Diaminopimelate epimerase; Short... 69 3e-10
(B0T542) RecName: Full=Diaminopimelate epimerase; Short... 69 3e-10
(Q2T269) RecName: Full=Diaminopimelate epimerase; Short... 69 3e-10
(A1TKA9) RecName: Full=Diaminopimelate epimerase; Short... 69 3e-10
CP000868_3069(CP000868|pid:none) Burkholderia multivorans ATCC 1... 69 3e-10
CP000378_2454(CP000378|pid:none) Burkholderia cenocepacia AU 105... 69 3e-10
(Q4FP10) RecName: Full=Diaminopimelate epimerase; Short... 69 3e-10
CP000958_3079(CP000958|pid:none) Burkholderia cenocepacia MC0-3 ... 69 3e-10
CP000975_1919(CP000975|pid:none) Methylacidiphilum infernorum V4... 67 8e-10
CP000030_923(CP000030|pid:none) Anaplasma marginale str. St. Mar... 67 1e-09
CP000159_1381(CP000159|pid:none) Salinibacter ruber DSM 13855, c... 67 1e-09
CP001391_1002(CP001391|pid:none) Wolbachia sp. wRi, complete gen... 67 1e-09
CP000885_2307(CP000885|pid:none) Clostridium phytofermentans ISD... 67 1e-09
CP000033_800(CP000033|pid:none) Lactobacillus acidophilus NCFM, ... 67 1e-09
CP000248_1397(CP000248|pid:none) Novosphingobium aromaticivorans... 66 2e-09
(Q82U84) RecName: Full=Diaminopimelate epimerase; Short... 66 2e-09
AE017283_1007(AE017283|pid:none) Propionibacterium acnes KPA1712... 66 2e-09
(B2T1P5) RecName: Full=Diaminopimelate epimerase; Short... 66 2e-09
(Q7MYN5) RecName: Full=Diaminopimelate epimerase; Short... 66 2e-09
(Q5GSB8) RecName: Full=Diaminopimelate epimerase; Short... 65 3e-09
(A2SKV9) RecName: Full=Diaminopimelate epimerase; Short... 65 3e-09
(Q146W2) RecName: Full=Diaminopimelate epimerase; Short... 64 6e-09
CP001229_942(CP001229|pid:none) Sulfurihydrogenibium azorense Az... 64 6e-09
CP000559_556(CP000559|pid:none) Methanocorpusculum labreanum Z, ... 64 8e-09
CU914168_195(CU914168|pid:none) Ralstonia solanacearum strain IP... 64 8e-09
AY765258_4(AY765258|pid:none) Enterobacter asburiae hydroxymethy... 63 2e-08
(Q838I3) RecName: Full=Diaminopimelate epimerase; Short... 62 2e-08
CU207366_611(CU207366|pid:none) Gramella forsetii KT0803 complet... 62 2e-08
(A0LE31) RecName: Full=Diaminopimelate epimerase; Short... 62 2e-08
CP001131_601(CP001131|pid:none) Anaeromyxobacter sp. K, complete... 62 3e-08
CP001025_2967(CP001025|pid:none) Burkholderia ambifaria MC40-6 c... 62 4e-08
(Q6G1L7) RecName: Full=Diaminopimelate epimerase; Short... 61 5e-08
(Q8Y5N9) RecName: Full=Diaminopimelate epimerase; Short... 61 7e-08
(Q1WTU5) RecName: Full=Diaminopimelate epimerase; Short... 60 9e-08
(Q8Y344) RecName: Full=Diaminopimelate epimerase; Short... 60 1e-07
CP000562_2148(CP000562|pid:none) Methanoculleus marisnigri JR1, ... 60 2e-07
CP000252_71(CP000252|pid:none) Syntrophus aciditrophicus SB, com... 59 2e-07
AM889285_2306(AM889285|pid:none) Gluconacetobacter diazotrophicu... 59 2e-07
CP000386_94(CP000386|pid:none) Rubrobacter xylanophilus DSM 9941... 59 2e-07
CP001189_515(CP001189|pid:none) Gluconacetobacter diazotrophicus... 59 2e-07
CP000964_2394(CP000964|pid:none) Klebsiella pneumoniae 342, comp... 59 2e-07
(O25290) RecName: Full=Diaminopimelate epimerase; Short... 59 2e-07
CP000510_3150(CP000510|pid:none) Psychromonas ingrahamii 37, com... 59 2e-07
AE017196_1085(AE017196|pid:none) Wolbachia endosymbiont of Droso... 59 3e-07
(Q71Y02) RecName: Full=Diaminopimelate epimerase; Short... 59 3e-07
CP000780_2421(CP000780|pid:none) Candidatus Methanoregula boonei... 59 3e-07
BT051963_1(BT051963|pid:none) Medicago truncatula clone MTYF9_FA... 59 3e-07
(A0AKC4) RecName: Full=Diaminopimelate epimerase; Short... 59 3e-07
FM242711_1999(FM242711|pid:none) Listeria monocytogenes Clip8145... 59 3e-07
(B1Y6S6) RecName: Full=Diaminopimelate epimerase; Short... 59 3e-07
CP000750_1497(CP000750|pid:none) Kineococcus radiotolerans SRS30... 59 3e-07
CP000478_56(CP000478|pid:none) Syntrophobacter fumaroxidans MPOB... 59 3e-07
EF633726_2(EF633726|pid:none) Lactobacillus helveticus CNRZ32 as... 59 3e-07
CP000633_3082(CP000633|pid:none) Agrobacterium vitis S4 chromoso... 58 5e-07
AM743169_3852(AM743169|pid:none) Stenotrophomonas maltophilia K2... 58 5e-07
CP001341_1452(CP001341|pid:none) Arthrobacter chlorophenolicus A... 58 5e-07
(Q0BS04) RecName: Full=Diaminopimelate epimerase; Short... 57 8e-07
(B2UTR2) RecName: Full=Diaminopimelate epimerase; Short... 57 8e-07
CP000830_3212(CP000830|pid:none) Dinoroseobacter shibae DFL 12, ... 57 8e-07
U22968_4(U22968|pid:none) Yersinia pestis porphobilinogen deamin... 57 8e-07
(Q1GPI7) RecName: Full=Diaminopimelate epimerase; Short... 57 1e-06
CP000264_318(CP000264|pid:none) Jannaschia sp. CCS1, complete ge... 57 1e-06
CP000527_1292(CP000527|pid:none) Desulfovibrio vulgaris subsp. v... 57 1e-06
(Q5FQZ4) RecName: Full=Diaminopimelate epimerase; Short... 57 1e-06
CP001071_44(CP001071|pid:none) Akkermansia muciniphila ATCC BAA-... 57 1e-06
AE017285_1859(AE017285|pid:none) Desulfovibrio vulgaris subsp. v... 56 2e-06
CP001099_1861(CP001099|pid:none) Chlorobaculum parvum NCIB 8327,... 56 2e-06
CP000859_3153(CP000859|pid:none) Desulfococcus oleovorans Hxd3, ... 56 2e-06
CP000667_1427(CP000667|pid:none) Salinispora tropica CNB-440, co... 56 2e-06
AP009180_178(AP009180|pid:none) Candidatus Carsonella ruddii PV ... 56 2e-06
(A9W6A5) RecName: Full=Diaminopimelate epimerase; Short... 56 2e-06
(Q1CTW0) RecName: Full=Diaminopimelate epimerase; Short... 55 3e-06
CP001110_2494(CP001110|pid:none) Pelodictyon phaeoclathratiforme... 55 3e-06
CP001108_264(CP001108|pid:none) Prosthecochloris aestuarii DSM 2... 55 5e-06
(B1ZDT1) RecName: Full=Diaminopimelate epimerase; Short... 54 7e-06
CP001095_736(CP001095|pid:none) Bifidobacterium longum subsp. in... 54 7e-06
(A5VSQ7) RecName: Full=Diaminopimelate epimerase; Short... 54 7e-06
CP001001_5255(CP001001|pid:none) Methylobacterium radiotolerans ... 54 7e-06
(A9M8R8) RecName: Full=Diaminopimelate epimerase; Short... 54 7e-06
(A4QEV1) RecName: Full=Diaminopimelate epimerase; Short... 54 9e-06
CP000605_105(CP000605|pid:none) Bifidobacterium longum DJO10A, c... 53 1e-05
(Q8TY71) RecName: Full=Diaminopimelate epimerase; Short... 53 1e-05
EU414989_1(EU414989|pid:none) Flammeovirga yaeyamensis strain MY... 53 1e-05
(A1UQV5) RecName: Full=Diaminopimelate epimerase; Short... 53 1e-05
AM260522_707(AM260522|pid:none) Helicobacter acinonychis str. Sh... 53 2e-05
CP000820_1215(CP000820|pid:none) Frankia sp. EAN1pec, complete g... 52 2e-05
AX063719_1(AX063719|pid:none) Sequence 1 from Patent WO0100843. ... 52 2e-05
(B0RHB0) RecName: Full=Diaminopimelate epimerase; Short... 52 2e-05
CP000153_2038(CP000153|pid:none) Sulfurimonas denitrificans DSM ... 52 3e-05
CP000607_1601(CP000607|pid:none) Chlorobium phaeovibrioides DSM ... 52 3e-05
AP007281_590(AP007281|pid:none) Lactobacillus reuteri JCM 1112 D... 52 4e-05
CP000489_392(CP000489|pid:none) Paracoccus denitrificans PD1222 ... 52 4e-05
CP001280_1810(CP001280|pid:none) Methylocella silvestris BL2, co... 51 7e-05
AE015451_3750(AE015451|pid:none) Pseudomonas putida KT2440 compl... 50 9e-05
(A6WXE4) RecName: Full=Diaminopimelate epimerase; Short... 50 1e-04
(Q9ZLR5) RecName: Full=Diaminopimelate epimerase; Short... 50 1e-04
(Q8FPE1) RecName: Full=Diaminopimelate epimerase; Short... 50 2e-04
AP009256_1167(AP009256|pid:none) Bifidobacterium adolescentis AT... 50 2e-04
BA000035_1835(BA000035|pid:none) Corynebacterium efficiens YS-31... 50 2e-04
CP000767_65(CP000767|pid:none) Campylobacter curvus 525.92, comp... 50 2e-04
CP000379_2253(CP000379|pid:none) Burkholderia cenocepacia AU 105... 49 2e-04
(Q8UC03) RecName: Full=Diaminopimelate epimerase; Short... 49 3e-04
(Q1QHJ3) RecName: Full=Diaminopimelate epimerase; Short... 49 4e-04
BA000030_2479(BA000030|pid:none) Streptomyces avermitilis MA-468... 49 4e-04
(Q07UV4) RecName: Full=Diaminopimelate epimerase; Short... 48 5e-04
AE008688_2645(AE008688|pid:none) Agrobacterium tumefaciens str. ... 48 6e-04
CP000115_2761(CP000115|pid:none) Nitrobacter winogradskyi Nb-255... 48 6e-04
CT573213_5573(CT573213|pid:none) Frankia alni str. ACN14A chromo... 48 6e-04
CP000770_210(CP000770|pid:none) Candidatus Sulcia muelleri GWSS,... 47 8e-04
CR931997_1110(CR931997|pid:none) Corynebacterium jeikeium K411 c... 47 8e-04
CP000959_1426(CP000959|pid:none) Burkholderia cenocepacia MC0-3 ... 47 8e-04
CP000850_1368(CP000850|pid:none) Salinispora arenicola CNS-205, ... 47 0.001
CP000252_2123(CP000252|pid:none) Syntrophus aciditrophicus SB, c... 47 0.001
CP001338_247(CP001338|pid:none) Candidatus Methanosphaerula palu... 47 0.001
(O69969) RecName: Full=Diaminopimelate epimerase; Short... 47 0.001
CP000384_2149(CP000384|pid:none) Mycobacterium sp. MCS, complete... 47 0.001
(Q89X45) RecName: Full=Diaminopimelate epimerase; Short... 46 0.002
CP000249_3472(CP000249|pid:none) Frankia sp. CcI3, complete geno... 46 0.002
CP000117_2108(CP000117|pid:none) Anabaena variabilis ATCC 29413,... 46 0.002
AP009153_1611(AP009153|pid:none) Gemmatimonas aurantiaca T-27 DN... 46 0.002
EU016629_30(EU016629|pid:none) Uncultured marine microorganism H... 46 0.002
AP008937_852(AP008937|pid:none) Lactobacillus fermentum IFO 3956... 46 0.002
AP006618_3844(AP006618|pid:none) Nocardia farcinica IFM 10152 DN... 46 0.002
AP009493_1727(AP009493|pid:none) Streptomyces griseus subsp. gri... 45 0.003
(A1UEZ9) RecName: Full=Diaminopimelate epimerase; Short... 45 0.003
CP001618_2422(CP001618|pid:none) Beutenbergia cavernae DSM 12333... 45 0.003
CP001101_284(CP001101|pid:none) Chlorobium phaeobacteroides BS1,... 45 0.003
(B6JAP3) RecName: Full=Diaminopimelate epimerase; Short... 45 0.004
(A4YKA5) RecName: Full=Diaminopimelate epimerase; Short... 45 0.004
BX842646_43(BX842646|pid:none) Bdellovibrio bacteriovorus comple... 45 0.004
CP001032_3862(CP001032|pid:none) Opitutus terrae PB90-1, complet... 44 0.007
CP001076_63(CP001076|pid:none) Rhizobium etli CIAT 652 plasmid p... 44 0.009
(B0UCI8) RecName: Full=Diaminopimelate epimerase; Short... 44 0.009
(A1KM64) RecName: Full=Diaminopimelate epimerase; Short... 44 0.009
AP009179_2410(AP009179|pid:none) Sulfurovum sp. NBC37-1 genomic ... 44 0.012
(P54897) RecName: Full=Diaminopimelate epimerase 1; Sho... 44 0.012
(B1MD00) RecName: Full=Diaminopimelate epimerase; Short... 43 0.015
CP000776_458(CP000776|pid:none) Campylobacter hominis ATCC BAA-3... 43 0.015
AE017125_1701(AE017125|pid:none) Helicobacter hepaticus ATCC 514... 43 0.015
AM420293_1716(AM420293|pid:none) Saccharopolyspora erythraea NRR... 43 0.015
(A6Q160) RecName: Full=Diaminopimelate epimerase; Short... 43 0.020
CP000155_3461(CP000155|pid:none) Hahella chejuensis KCTC 2396, c... 42 0.026
CP000792_13(CP000792|pid:none) Campylobacter concisus 13826, com... 42 0.034
(Q21CU6) RecName: Full=Diaminopimelate epimerase; Short... 42 0.034
(B2HL16) RecName: Full=Diaminopimelate epimerase; Short... 42 0.034
S52295(S52295) diaminopimelate epimerase (EC 5.1.1.7) - Anabaena... 42 0.044
AP008957_2765(AP008957|pid:none) Rhodococcus erythropolis PR4 DN... 41 0.075
(Q2K386) RecName: Full=Diaminopimelate epimerase; Short... 41 0.075
(Q47RR3) RecName: Full=Diaminopimelate epimerase; Short... 41 0.075
AP006861_780(AP006861|pid:none) Chlamydophila felis Fe/C-56 DNA,... 41 0.075
(A8FNJ1) RecName: Full=Diaminopimelate epimerase; Short... 41 0.075
CP000716_1826(CP000716|pid:none) Thermosipho melanesiensis BI429... 41 0.075
CP000382_646(CP000382|pid:none) Clostridium novyi NT, complete g... 40 0.098
CP000076_2494(CP000076|pid:none) Pseudomonas fluorescens Pf-5, c... 39 0.22
DQ011584_1(DQ011584|pid:none) Plasmodium cynomolgi Mulligan reti... 39 0.22
(A4TCN3) RecName: Full=Diaminopimelate epimerase; Short... 39 0.22
(A1W1D0) RecName: Full=Diaminopimelate epimerase; Short... 39 0.22
(A7H5P5) RecName: Full=Diaminopimelate epimerase; Short... 39 0.29
(Q5HSQ5) RecName: Full=Diaminopimelate epimerase; Short... 39 0.29
(A0LUZ5) RecName: Full=Diaminopimelate epimerase; Short... 39 0.29
(Q13DT7) RecName: Full=Diaminopimelate epimerase; Short... 39 0.37
CP000449_19(CP000449|pid:none) Maricaulis maris MCS10, complete ... 39 0.37
CP000360_2618(CP000360|pid:none) Acidobacteria bacterium Ellin34... 39 0.37
CP000896_1226(CP000896|pid:none) Acholeplasma laidlawii PG-8A, c... 39 0.37
(Q2J390) RecName: Full=Diaminopimelate epimerase; Short... 38 0.49
AE005176_1286(AE005176|pid:none) Lactococcus lactis subsp. lacti... 38 0.64
CP000781_410(CP000781|pid:none) Xanthobacter autotrophicus Py2, ... 38 0.64
(Q0S1N7) RecName: Full=Diaminopimelate epimerase; Short... 37 0.83
AY962392_188(AY962392|pid:none) Aeromonas phage 31, complete gen... 37 1.1
AL591688_3258(AL591688|pid:none) Sinorhizobium meliloti 1021 com... 36 1.9
AP009384_3710(AP009384|pid:none) Azorhizobium caulinodans ORS 57... 36 1.9
AE014187_324(AE014187|pid:none) Plasmodium falciparum 3D7 chromo... 36 2.4
(Q928S6) RecName: Full=UPF0249 protein lin2456; &AC1739(AC1739)... 36 2.4
AE002124_2(AE002124|pid:none) Ureaplasma parvum serovar 3 str. A... 36 2.4
CP000728_3020(CP000728|pid:none) Clostridium botulinum F str. La... 36 2.4
CP000942_274(CP000942|pid:none) Ureaplasma parvum serovar 3 str.... 36 2.4
CP001083_3248(CP001083|pid:none) Clostridium botulinum Ba4 str. ... 35 3.2
BX571662_283(BX571662|pid:none) Wolinella succinogenes, complete... 35 3.2
(A0QIQ8) RecName: Full=Diaminopimelate epimerase; Short... 35 3.2
CP000702_1255(CP000702|pid:none) Thermotoga petrophila RKU-1, co... 35 3.2
AL844509_608(AL844509|pid:none) Plasmodium falciparum 3D7 chromo... 35 4.1
CP000628_3331(CP000628|pid:none) Agrobacterium radiobacter K84 c... 35 4.1
AL034556_10(AL034556|pid:none) Plasmodium falciparum MAL3P5, com... 35 4.1
AC149204_11(AC149204|pid:none) Medicago truncatula chromosome 7 ... 35 4.1
AL732351_6(AL732351|pid:none) Oryza sativa genomic DNA, chromoso... 35 5.4
CP001581_3402(CP001581|pid:none) Clostridium botulinum A2 str. K... 35 5.4
AE014186_199(AE014186|pid:none) Plasmodium falciparum 3D7 chromo... 35 5.4
AE014188_377(AE014188|pid:none) Plasmodium falciparum 3D7 chromo... 35 5.4
AM494475_314(AM494475|pid:none) Orientia tsutsugamushi Boryong c... 35 5.4
AL606457_18(AL606457|pid:none) Oryza sativa genomic DNA, chromos... 35 5.4
CP000962_3181(CP000962|pid:none) Clostridium botulinum A3 str. L... 34 7.0
AM412317_3203(AM412317|pid:none) Clostridium botulinum A str. AT... 34 7.0
AM180355_1065(AM180355|pid:none) Clostridium difficile 630 compl... 34 7.0
CP000726_3025(CP000726|pid:none) Clostridium botulinum A str. AT... 34 9.2
CP000939_1296(CP000939|pid:none) Clostridium botulinum B1 str. O... 34 9.2
AB218280_1(AB218280|pid:none) Watermelon mosaic virus genomic RN... 34 9.2
>CP000786_576(CP000786|pid:none) Leptospira biflexa serovar Patoc
strain 'Patoc 1 (Paris)' chromosome I, complete sequence.
Length = 286
Score = 111 bits (277), Expect = 5e-23
Identities = 103/310 (33%), Positives = 141/310 (45%), Gaps = 1/310 (0%)
Frame = +1
Query: 82 RINFTKMQGAGNDFVVFEKNKVE-RLNGDQSIMTYEEISGFTKKLSHRKLGIGCDQLIII 258
+INFTKM+G GND+V + K + RL+ +Q +KLS R GIG D +I I
Sbjct: 8 KINFTKMEGIGNDYVYIDATKNDIRLSPEQ-----------IQKLSDRNFGIGGDGVIFI 56
Query: 259 DDNPNDKNAAYGMGVINCDGNIENMCGNGVRCFTKYIIDNKVLSKNLKEQLNFDGDDKIE 438
N + + M + N DG+ MCGNGVRC K++ D+ L+KN K
Sbjct: 57 R---NSNSGEFQMDMYNSDGSSSEMCGNGVRCVGKFVYDHG-LTKNQKPT---------- 102
Query: 439 QIIETKSGIVKTYPLLKHHLNNKEKDVIMVKVNMGTSKISRLINEIDYNIPKTLSKQSPL 618
IET G++ LK N K V MV V+MG + + +P P+
Sbjct: 103 --IETGKGVLTLD--LKTGTNGK---VEMVTVDMGEPILKPSL------VPIVWKGDEPV 149
Query: 619 ESYMYTIDIGLPYCSKLECVYVTVGGNQCVVFIDRNIELGYLDSSYGDHTKFSTIDFKEI 798
+ + + G Y V++G CV+++D D F +EI
Sbjct: 150 INQVIEVQ-GKQY----HFTAVSMGNPHCVIYVD-------------DADDFPV---REI 188
Query: 799 SDIIQSNVNGFDDIPNVEFVIQSPQDKLENKVISRVVERGNGETLACGTGACGVAISSIL 978
II+ N F NVEFV +D L R ERG GETLACGTGAC V ++SIL
Sbjct: 189 GPIIE-NHPFFPRRVNVEFVSIKGKDHL----YQRTWERGTGETLACGTGACAVTVASIL 243
Query: 979 KGYCNENTEI 1008
G + I
Sbjct: 244 NGKTGRSVRI 253
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3204285
Number of Hits to DB: 1,459,142,713
Number of extensions: 28580507
Number of successful extensions: 79617
Number of sequences better than 10.0: 424
Number of HSP's gapped: 78924
Number of HSP's successfully gapped: 613
Length of query: 338
Length of database: 1,040,966,779
Length adjustment: 129
Effective length of query: 209
Effective length of database: 627,614,014
Effective search space: 131171328926
Effective search space used: 131171328926
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 32 (16.9 bits)
|
| PSORT |
|
| VS (DIR, S) |
0 |
| VH (FL, L) |
0 |
| VF (FL, S) |
2 |
| AH (FL, L) |
0 |
| AF (FL, S) |
0 |
| SL (DIR, L) |
0 |
| SS (DIR, S) |
0 |
| SH (FL, L) |
0 |
| SF (FL, S) |
0 |
| CH (FL, L) |
0 |
| CF (FL, S) |
0 |
| FCL (DIR, L) |
0 |
| FC (DIR, S) |
0 |
| FC-IC (SUB) |
0 |