| Contig-U10257-1 |
| Contig ID |
Contig-U10257-1 |
| Contig update |
2002. 9.13 |
| Contig sequence |
 |
| Gap |
no gap |
| Contig length |
1350 |
| Chromosome number (1..6, M) |
5 |
| Chromosome length |
5062330 |
| Start point |
1290172 |
| End point |
1288822 |
| Strand (PLUS/MINUS) |
MINUS |
| Number of clones |
2 |
| Number of EST |
3 |
| Link to clone list |
U10257 |
| List of clone(s) |
|
| Translated Amino Acid sequence |
|
| Translated Amino Acid sequence (All Frames) |
|
| own update |
2004. 6.10 |
| Homology vs CSM-cDNA |
|
| dna update |
2008.11.18 |
| Homology vs DNA |
Query= Contig-U10257-1 (Contig-U10257-1Q) /CSM_Contig/Contig-U10257-1Q.Seq.d
(1350 letters)
Database: ddbj_A
92,845,959 sequences; 95,242,211,685 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value N
(BJ432527) Dictyostelium discoideum cDNA clone:ddv18o23, 3' ... 1427 0.0 2
(C83870) Dictyostelium discoideum slug cDNA, clone SSA447. 1053 0.0 1
(BJ414379) Dictyostelium discoideum cDNA clone:ddv18o23, 5' ... 525 0.0 2
(AU072640) Dictyostelium discoideum slug cDNA, clone SSA447. 178 4e-40 1
(EK542784) 1095516069056 Global-Ocean-Sampling_GS-32-01-01-1... 50 7e-07 3
(ER389134) 1094428765451 Global-Ocean-Sampling_GS-34-01-01-1... 62 6e-05 1
(EK217395) 1095460123460 Global-Ocean-Sampling_GS-31-01-01-1... 62 6e-05 1
(EK043460) 1092959535461 Global-Ocean-Sampling_GS-31-01-01-1... 62 6e-05 1
(EK018334) 1092955254894 Global-Ocean-Sampling_GS-31-01-01-1... 62 6e-05 1
(EF089398) Uncultured marine bacterium EB0_39F01 genomic seq... 54 6e-05 2
(EJ753907) 1092963059750 Global-Ocean-Sampling_GS-30-02-01-1... 48 9e-05 3
(EJ676324) 1092955084572 Global-Ocean-Sampling_GS-30-02-01-1... 48 1e-04 2
(EJ747122) 1092963007593 Global-Ocean-Sampling_GS-30-02-01-1... 48 1e-04 3
(EK039598) 1092959502914 Global-Ocean-Sampling_GS-31-01-01-1... 60 2e-04 1
(EJ061881) 1095458001848 Global-Ocean-Sampling_GS-26-01-01-1... 60 2e-04 1
(AE009951) Fusobacterium nucleatum subsp. nucleatum ATCC 255... 46 5e-04 16
(EJ750499) 1092963031867 Global-Ocean-Sampling_GS-30-02-01-1... 42 0.005 3
(EK080373) 1092961100757 Global-Ocean-Sampling_GS-31-01-01-1... 54 0.005 2
(EJ543357) 1092955415657 Global-Ocean-Sampling_GS-29-01-01-1... 44 0.005 2
(EJ564580) 1092959697525 Global-Ocean-Sampling_GS-29-01-01-1... 44 0.006 2
(EU221239) Uncultured marine bacterium EB000_55B11, complete... 54 0.009 4
(EJ145683) 1092343710848 Global-Ocean-Sampling_GS-27-01-01-1... 42 0.017 2
(ER509608) 1093015435993 Global-Ocean-Sampling_GS-35-01-01-1... 50 0.022 2
(AY230007) Spiroplasma citri strain GII-3 PTS enzyme II gluc... 34 0.025 5
(EK971661) 1095521045136 Global-Ocean-Sampling_GS-33-01-01-1... 52 0.056 1
(EK015469) 1092955229469 Global-Ocean-Sampling_GS-31-01-01-1... 52 0.056 1
(EK006071) 1092955094069 Global-Ocean-Sampling_GS-31-01-01-1... 52 0.056 1
(EJ781455) 1093017257473 Global-Ocean-Sampling_GS-30-02-01-1... 40 0.060 3
(EL566075) Physarum07920 Physarum polycephalum starvation st... 50 0.072 2
(CU804197) A BAC library has been constructed from PN40024 g... 32 0.12 3
(AC216765) Populus trichocarpa clone POP021-F16, complete se... 36 0.13 2
(EJ089191) 1095460147979 Global-Ocean-Sampling_GS-26-01-01-1... 36 0.17 2
(AC144859) Mus musculus BAC clone RP24-158C2 from chromosome... 50 0.22 1
(EJ372496) 1092963728990 Global-Ocean-Sampling_GS-28-01-01-1... 50 0.22 1
(FD757397) Afi04_170_C04_C014.g1 Aristolochia fimbriata flow... 50 0.22 1
(EJ939001) 1093018853671 Global-Ocean-Sampling_GS-30-02-01-1... 36 0.23 3
(EX644949) 256665154 Pea aphid whole body normalized full le... 38 0.27 2
(EJ794461) 1093017394484 Global-Ocean-Sampling_GS-30-02-01-1... 36 0.28 3
(EJ742882) 1092962031207 Global-Ocean-Sampling_GS-30-02-01-1... 42 0.30 2
(AC084184) Homo sapiens clone RP11-744B19, *** SEQUENCING IN... 46 0.42 6
(ER359343) 1092385400521 Global-Ocean-Sampling_GS-34-01-01-1... 34 0.62 2
(EH143629) LB01187.CR_C09 GC_BGC-11 Bos taurus cDNA clone IM... 46 0.79 2
(ER602076) 1093016250646 Global-Ocean-Sampling_GS-36-01-01-2... 32 0.80 3
(AL772289) Zebrafish DNA sequence from clone CH211-8A9 in li... 48 0.87 1
(AC186874) Gallus gallus BAC clone TAM31-31H9 from chromosom... 48 0.87 1
(AC132164) Drosophila pseudoobscura FOSMID DPSF1-548A11 (Ch... 48 0.87 1
(CU633322) Pig DNA sequence *** SEQUENCING IN PROGRESS *** f... 48 0.87 1
(CU607094) Pig DNA sequence *** SEQUENCING IN PROGRESS *** f... 48 0.87 1
(EK587347) 1095522120137 Global-Ocean-Sampling_GS-32-01-01-1... 48 0.87 1
(EK579005) 1095521387771 Global-Ocean-Sampling_GS-32-01-01-1... 48 0.87 1
(EJ651408) 1092954002286 Global-Ocean-Sampling_GS-30-02-01-1... 48 0.87 1
(EJ649108) 1092953004398 Global-Ocean-Sampling_GS-30-02-01-1... 48 0.87 1
(CP000524) Bartonella bacilliformis KC583, complete genome. 48 0.87 1
(EJ873597) 1093018357694 Global-Ocean-Sampling_GS-30-02-01-1... 42 1.0 2
(EJ791817) 1093017381080 Global-Ocean-Sampling_GS-30-02-01-1... 42 1.2 2
(CP000016) Candidatus Blochmannia pennsylvanicus str. BPEN, ... 42 1.6 14
(AC167468) Mus musculus BAC clone RP23-163J2 from chromosome... 42 1.6 4
(CU914442) Pig DNA sequence *** SEQUENCING IN PROGRESS *** f... 32 1.8 2
(AC104965) Homo sapiens chromosome 8 clone RP11-1042L13 map ... 32 1.9 2
(ER323028) 1092344190879 Global-Ocean-Sampling_GS-34-01-01-1... 36 2.2 3
(BA000026) Mycoplasma penetrans HF-2 DNA, complete genome. 32 2.2 19
(CP000770) Candidatus Sulcia muelleri GWSS, complete genome. 34 2.5 10
(AP000428) Homo sapiens genomic DNA, chromosome 8q23, clone:... 46 2.6 2
(EK262526) 1095462186072 Global-Ocean-Sampling_GS-31-01-01-1... 34 2.7 3
(AM180355) Clostridium difficile 630 complete genome. 38 2.9 18
(AM656790) Entamoeba moshkovskii FIC GSS, clone mosh046b09.p1k. 34 2.9 3
(AM484883) Vitis vinifera contig VV78X230106.2, whole genome... 38 3.0 2
(AZ468266) 1M0281L11F Mouse 10kb plasmid UUGC1M library Mus ... 44 3.1 2
(AC152983) Mus musculus 10 BAC RP23-17L11 (Roswell Park Canc... 46 3.5 1
(AC129212) Mus musculus BAC clone RP24-373G21 from chromosom... 46 3.5 1
(AC122341) Mus musculus BAC clone RP23-355F8 from chromosome... 46 3.5 1
(AC122185) Mus musculus BAC clone RP23-18J13 from chromosome... 46 3.5 1
(AC099736) Mus musculus chromosome 15, clone RP23-228F5, com... 46 3.5 1
(CS788875) Sequence 131 from Patent WO2005031001. 46 3.5 1
(AC113416) Homo sapiens chromosome 5 clone RP11-560F8, compl... 46 3.5 1
(AC015604) Homo sapiens, clone RP11-45D18, complete sequence. 46 3.5 1
(AC231677) Solanum tuberosum chromosome 11 clone RH089H13, *... 46 3.5 1
(AC220980) Pongo abelii chromosome 1 clone CH276-279C18, WOR... 46 3.5 1
(AC173328) Bos taurus clone CH240-80E10, WORKING DRAFT SEQUE... 46 3.5 1
(AC022271) Homo sapiens chromosome 5 clone RP11-560F8, WORKI... 46 3.5 1
(AK163777) Mus musculus 16 days embryo head cDNA, RIKEN full... 46 3.5 1
(EJ027105) 1095454029753 Global-Ocean-Sampling_GS-26-01-01-1... 46 3.5 1
(CV542630) RTS_123_A05 Phaseolus vulgaris P- root EST librar... 46 3.5 1
(AM055537) Polyplastron multivesiculatum EST, clone Pm07_B07. 46 3.5 1
(CJ061800) Mus musculus 16 days embryo head cDNA, RIKEN full... 46 3.5 1
(CR628337) Legionella pneumophila str. Lens complete genome. 46 3.5 1
(CR628336) Legionella pneumophila str. Paris complete genome. 46 3.5 1
(CP000937) Francisella philomiragia subsp. philomiragia ATCC... 46 3.5 1
(CP000675) Legionella pneumophila str. Corby, complete genome. 46 3.5 1
(AE017354) Legionella pneumophila subsp. pneumophila str. Ph... 46 3.5 1
(AE000783) Borrelia burgdorferi B31, complete genome. 36 3.6 15
(AM613684) Entamoeba invadens IP1 GSS, clone inv038d12.p1k. 36 4.0 2
(CU469464) Candidatus Phytoplasma mali strain AT complete ch... 36 4.4 13
(AC025451) Homo sapiens chromosome 5 clone CTD-2141F16, comp... 40 4.6 6
(DE063658) Oryzias latipes DNA, clone: ola1-109L18.F, genomi... 30 5.4 3
(DI007992) Enterococcus faecalis polynucleotides and polypep... 36 6.2 2
(BD193790) Enterococcus faecialis polynucleotides and polype... 36 6.2 2
(AC168442) Strongylocentrotus purpuratus clone R3-39D21, WOR... 32 6.4 2
(AC232041) Solanum tuberosum strain Diploid genotype RH89-03... 38 6.5 4
(AC151621) Medicago truncatula clone mth2-14p3, complete seq... 32 6.5 2
>(BJ432527) Dictyostelium discoideum cDNA clone:ddv18o23, 3' end,
single read.
Length = 758
Score = 1427 bits (720), Expect(2) = 0.0
Identities = 720/720 (100%)
Strand = Plus / Minus
Query: 505 gtcatactggtacccaaaaattcattagaaatttaactgcatcagaaatcgtatcacaag 564
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 745 gtcatactggtacccaaaaattcattagaaatttaactgcatcagaaatcgtatcacaag 686
Query: 565 taatagcgacaagacatgttttaaatgattttacagattcctcaataaaaagaactctaa 624
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 685 taatagcgacaagacatgttttaaatgattttacagattcctcaataaaaagaactctaa 626
Query: 625 ctaatatagtgtttatgggtcagggtgaaccattttataattatagaaacgtttcaaagg 684
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 625 ctaatatagtgtttatgggtcagggtgaaccattttataattatagaaacgtttcaaagg 566
Query: 685 caatcaaaatcataactgatccaaatggtttggcaattggtaagagtaaaatcacagttt 744
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 565 caatcaaaatcataactgatccaaatggtttggcaattggtaagagtaaaatcacagttt 506
Query: 745 caacaagtggtgtcgtacctttgatcgatagactgggtagtgatttccctggtattggtt 804
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 505 caacaagtggtgtcgtacctttgatcgatagactgggtagtgatttccctggtattggtt 446
Query: 805 tagcaatttcattacatagtgcaaatgataaaactcgttcagagattgtacctgcaaata 864
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 445 tagcaatttcattacatagtgcaaatgataaaactcgttcagagattgtacctgcaaata 386
Query: 865 gacaatggccaatctctgaattggttgaagcttgtattaaattttcaaaaaattgtaaag 924
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 385 gacaatggccaatctctgaattggttgaagcttgtattaaattttcaaaaaattgtaaag 326
Query: 925 aaagaataacaatcgaatatgtaatgttaaaaggtgtaaatgattcagaacaagatgctt 984
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 325 aaagaataacaatcgaatatgtaatgttaaaaggtgtaaatgattcagaacaagatgctt 266
Query: 985 atgatttagttaaactttcaaaatcttttccatcttttgtaaatttaataccttttaatc 1044
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 265 atgatttagttaaactttcaaaatcttttccatcttttgtaaatttaataccttttaatc 206
Query: 1045 catggcctggatcacaatataaatcttcttcaaaggaaactatttcccaattctctaaaa 1104
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 205 catggcctggatcacaatataaatcttcttcaaaggaaactatttcccaattctctaaaa 146
Query: 1105 ttttagatgataaaggtataaaggttactattagacaaccacgtggtcgtgatatcttgg 1164
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 145 ttttagatgataaaggtataaaggttactattagacaaccacgtggtcgtgatatcttgg 86
Query: 1165 ctgcatgtggccaattaaatacagagtctataaaagaaattaataaaccaatccaaccat 1224
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct: 85 ctgcatgtggccaattaaatacagagtctataaaagaaattaataaaccaatccaaccat 26
Score = 38.2 bits (19), Expect(2) = 0.0
Identities = 19/19 (100%)
Strand = Plus / Minus
Query: 1225 tggaaaatttagattaaat 1243
|||||||||||||||||||
Sbjct: 26 tggaaaatttagattaaat 8
Lambda K H
1.37 0.711 1.31
Matrix: blastn matrix:1 -3
Number of Sequences: 92845959
Number of Hits to DB: 1,383,008,170
Number of extensions: 84389135
Number of successful extensions: 7573406
Number of sequences better than 10.0: 107
Length of query: 1350
Length of database: 95,242,211,685
Length adjustment: 24
Effective length of query: 1326
Effective length of database: 97,308,875,965
Effective search space: 129031569529590
Effective search space used: 129031569529590
X1: 11 (21.8 bits)
S2: 22 (44.1 bits)
|
| protein update |
2009. 6.27 |
| Homology vs Protein |
Query= Contig-U10257-1 (Contig-U10257-1Q) /CSM_Contig/Contig-U10257-1Q.Seq.d
(1350 letters)
Database: nrp_A
3,204,285 sequences; 1,040,966,779 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
(A7HSW7) RecName: Full=Ribosomal RNA large subunit methyltransfe... 338 3e-91
CP000613_2505(CP000613|pid:none) Rhodospirillum centenum SW, com... 337 6e-91
CP001196_295(CP001196|pid:none) Oligotropha carboxidovorans OM5 ... 331 4e-89
(Q5FUA9) RecName: Full=Ribosomal RNA large subunit methyltransfe... 330 7e-89
CP001389_3180(CP001389|pid:none) Rhizobium sp. NGR234, complete ... 327 5e-88
(Q2RP22) RecName: Full=Ribosomal RNA large subunit methyltransfe... 327 8e-88
(Q13D92) RecName: Full=Ribosomal RNA large subunit methyltransfe... 326 1e-87
(A6UE14) RecName: Full=Ribosomal RNA large subunit methyltransfe... 325 2e-87
(A4YJY2) RecName: Full=Ribosomal RNA large subunit methyltransfe... 324 5e-87
(Q92L68) RecName: Full=Ribosomal RNA large subunit methyltransfe... 324 5e-87
(Q7CWI1) RecName: Full=Ribosomal RNA large subunit methyltransfe... 323 7e-87
B97680(B97680)hypothetical protein AGR_C_4846 [imported] - Agrob... 323 7e-87
AE007869_2604(AE007869|pid:none) Agrobacterium tumefaciens str. ... 323 7e-87
CU459003_2147(CU459003|pid:none) Magnetospirillum gryphiswaldens... 323 9e-87
(A5E8P3) RecName: Full=Ribosomal RNA large subunit methyltransfe... 323 1e-86
CP001096_399(CP001096|pid:none) Rhodopseudomonas palustris TIE-1... 322 2e-86
BX572594_76(BX572594|pid:none) Rhodopseudomonas palustris CGA009... 322 3e-86
(Q0BWY9) RecName: Full=Ribosomal RNA large subunit methyltransfe... 321 3e-86
(Q1QHE3) RecName: Full=Ribosomal RNA large subunit methyltransfe... 321 3e-86
(Q98E86) RecName: Full=Ribosomal RNA large subunit methyltransfe... 320 6e-86
(A6WV17) RecName: Full=Ribosomal RNA large subunit methyltransfe... 320 7e-86
(A8IQ73) RecName: Full=Ribosomal RNA large subunit methyltransfe... 320 1e-85
(Q2K3B1) RecName: Full=Ribosomal RNA large subunit methyltransfe... 318 2e-85
AP007255_1124(AP007255|pid:none) Magnetospirillum magneticum AMB... 318 3e-85
(Q2W897) RecName: Full=Ribosomal RNA large subunit methyltransfe... 318 3e-85
CP001280_2892(CP001280|pid:none) Methylocella silvestris BL2, co... 318 4e-85
(B2IGZ5) RecName: Full=Ribosomal RNA large subunit methyltransfe... 318 4e-85
(A5VN22) RecName: Full=Ribosomal RNA large subunit methyltransfe... 317 8e-85
CP001488_72(CP001488|pid:none) Brucella melitensis ATCC 23457 ch... 316 1e-84
CP000115_2791(CP000115|pid:none) Nitrobacter winogradskyi Nb-255... 316 1e-84
(A5G209) RecName: Full=Ribosomal RNA large subunit methyltransfe... 316 1e-84
EF089398_24(EF089398|pid:none) Uncultured marine bacterium EB0_3... 315 2e-84
CP001191_3684(CP001191|pid:none) Rhizobium leguminosarum bv. tri... 314 4e-84
CP001074_4154(CP001074|pid:none) Rhizobium etli CIAT 652, comple... 314 4e-84
(Q8G374) RecName: Full=Ribosomal RNA large subunit methyltransfe... 314 5e-84
(Q0ATR3) RecName: Full=Ribosomal RNA large subunit methyltransfe... 313 7e-84
(Q07VN5) RecName: Full=Ribosomal RNA large subunit methyltransfe... 313 1e-83
(Q6G1C0) RecName: Full=Ribosomal RNA large subunit methyltransfe... 312 2e-83
(A8LNF0) RecName: Full=Ribosomal RNA large subunit methyltransfe... 311 3e-83
CP000830_3295(CP000830|pid:none) Dinoroseobacter shibae DFL 12, ... 311 3e-83
(B1M1U6) RecName: Full=Ribosomal RNA large subunit methyltransfe... 311 4e-83
(B0UQR1) RecName: Full=Ribosomal RNA large subunit methyltransfe... 310 8e-83
CP001349_4304(CP001349|pid:none) Methylobacterium nodulans ORS 2... 310 1e-82
(Q1GV98) RecName: Full=Ribosomal RNA large subunit methyltransfe... 303 7e-81
(Q2N9J2) RecName: Full=Ribosomal RNA large subunit methyltransfe... 300 6e-80
(Q2G8E3) RecName: Full=Ribosomal RNA large subunit methyltransfe... 300 6e-80
CP001102_486(CP001102|pid:none) Candidatus Amoebophilus asiaticu... 299 2e-79
(Q5LN66) RecName: Full=Ribosomal RNA large subunit methyltransfe... 298 3e-79
(Q2SDW1) RecName: Full=Ribosomal RNA large subunit methyltransfe... 293 7e-78
(B2SGH6) RecName: Full=Ribosomal RNA large subunit methyltransfe... 290 6e-77
(A0Q6H0) RecName: Full=Ribosomal RNA large subunit methyltransfe... 289 1e-76
(A0LBZ1) RecName: Full=Ribosomal RNA large subunit methyltransfe... 285 2e-75
(A4IY03) RecName: Full=Ribosomal RNA large subunit methyltransfe... 285 2e-75
(A1TZP7) RecName: Full=Ribosomal RNA large subunit methyltransfe... 280 6e-74
(B0TLI1) RecName: Full=Ribosomal RNA large subunit methyltransfe... 280 1e-73
(A3QCF9) RecName: Full=Ribosomal RNA large subunit methyltransfe... 279 1e-73
(Q0HKW2) RecName: Full=Ribosomal RNA large subunit methyltransfe... 279 2e-73
(A0KUJ2) RecName: Full=Ribosomal RNA large subunit methyltransfe... 279 2e-73
(A6WQQ0) RecName: Full=Ribosomal RNA large subunit methyltransfe... 279 2e-73
(Q8EC29) RecName: Full=Ribosomal RNA large subunit methyltransfe... 278 3e-73
(Q4ZX26) RecName: Full=Ribosomal RNA large subunit methyltransfe... 278 4e-73
(A4Y8U3) RecName: Full=Ribosomal RNA large subunit methyltransfe... 277 7e-73
(A1S866) RecName: Full=Ribosomal RNA large subunit methyltransfe... 276 9e-73
(B0U083) RecName: Full=Ribosomal RNA large subunit methyltransfe... 276 1e-72
(A8FT67) RecName: Full=Ribosomal RNA large subunit methyltransfe... 276 1e-72
(A3D6W2) RecName: Full=Ribosomal RNA large subunit methyltransfe... 276 2e-72
CP000388_3102(CP000388|pid:none) Pseudoalteromonas atlantica T6c... 275 4e-72
(Q3K7B3) RecName: Full=Ribosomal RNA large subunit methyltransfe... 274 5e-72
(A4SP04) RecName: Full=Ribosomal RNA large subunit methyltransfe... 274 5e-72
(Q5QYC0) RecName: Full=Ribosomal RNA large subunit methyltransfe... 274 6e-72
(Q02RW0) RecName: Full=Ribosomal RNA large subunit methyltransfe... 273 1e-71
FM209186_1168(FM209186|pid:none) Pseudomonas aeruginosa LESB58 c... 273 1e-71
CP001103_1362(CP001103|pid:none) Alteromonas macleodii 'Deep eco... 273 1e-71
(Q085U9) RecName: Full=Ribosomal RNA large subunit methyltransfe... 272 2e-71
(A1KUD6) RecName: Full=Ribosomal RNA large subunit methyltransfe... 271 3e-71
(Q4K6U6) RecName: Full=Ribosomal RNA large subunit methyltransfe... 271 4e-71
(A4SYE2) RecName: Full=Ribosomal RNA large subunit methyltransfe... 271 5e-71
(A6V0V7) RecName: Full=Ribosomal RNA large subunit methyltransfe... 270 7e-71
(Q5F911) RecName: Full=Ribosomal RNA large subunit methyltransfe... 270 7e-71
(A9LZN6) RecName: Full=Ribosomal RNA large subunit methyltransfe... 270 7e-71
(Q3ID16) RecName: Full=Ribosomal RNA large subunit methyltransfe... 270 9e-71
(A1ISB3) RecName: Full=Ribosomal RNA large subunit methyltransfe... 269 1e-70
CP001219_1824(CP001219|pid:none) Acidithiobacillus ferrooxidans ... 269 1e-70
CP001132_1562(CP001132|pid:none) Acidithiobacillus ferrooxidans ... 269 1e-70
(A4VNX4) RecName: Full=Ribosomal RNA large subunit methyltransfe... 268 4e-70
CP001157_3900(CP001157|pid:none) Azotobacter vinelandii DJ, comp... 266 1e-69
(Q7NS85) RecName: Full=Ribosomal RNA large subunit methyltransfe... 266 2e-69
AM747720_1881(AM747720|pid:none) Burkholderia cenocepacia J2315 ... 265 2e-69
CP001408_2273(CP001408|pid:none) Burkholderia pseudomallei MSHR3... 265 4e-69
(Q2Y6F3) RecName: Full=Ribosomal RNA large subunit methyltransfe... 265 4e-69
(B1YR46) RecName: Full=Ribosomal RNA large subunit methyltransfe... 264 5e-69
(Q0BEW5) RecName: Full=Ribosomal RNA large subunit methyltransfe... 264 5e-69
(B1JDQ5) RecName: Full=Ribosomal RNA large subunit methyltransfe... 264 5e-69
(A5VYT2) RecName: Full=Ribosomal RNA large subunit methyltransfe... 264 6e-69
(A1SU36) RecName: Full=Ribosomal RNA large subunit methyltransfe... 264 6e-69
(A3M208) RecName: Full=Ribosomal RNA large subunit methyltransfe... 263 8e-69
(Q1H0U6) RecName: Full=Ribosomal RNA large subunit methyltransfe... 263 1e-68
(Q6FEM6) RecName: Full=Ribosomal RNA large subunit methyltransfe... 262 2e-68
(Q5WWH4) RecName: Full=Ribosomal RNA large subunit methyltransfe... 262 2e-68
(Q5X516) RecName: Full=Ribosomal RNA large subunit methyltransfe... 262 2e-68
(Q3BTW5) RecName: Full=Ribosomal RNA large subunit methyltransfe... 261 3e-68
(Q9PG43) RecName: Full=Ribosomal RNA large subunit methyltransfe... 261 3e-68
(Q492D9) RecName: Full=Ribosomal RNA large subunit methyltransfe... 261 3e-68
AM039952_2067(AM039952|pid:none) Xanthomonas campestris pv. vesi... 261 3e-68
(A6VV03) RecName: Full=Ribosomal RNA large subunit methyltransfe... 261 4e-68
(A5IC42) RecName: Full=Ribosomal RNA large subunit methyltransfe... 261 4e-68
FP236842_1043(FP236842|pid:none) Erwinia pyrifoliae strain Ep1/9... 261 4e-68
(B0RT51) RecName: Full=Ribosomal RNA large subunit methyltransfe... 261 5e-68
CP001098_987(CP001098|pid:none) Halothermothrix orenii H 168, co... 261 5e-68
AE008923_1986(AE008923|pid:none) Xanthomonas axonopodis pv. citr... 260 7e-68
(B2SXT2) RecName: Full=Ribosomal RNA large subunit methyltransfe... 260 7e-68
(Q8PKZ1) RecName: Full=Ribosomal RNA large subunit methyltransfe... 260 7e-68
(Q1IEI4) RecName: Full=Ribosomal RNA large subunit methyltransfe... 260 7e-68
(Q46ZI0) RecName: Full=Ribosomal RNA large subunit methyltransfe... 260 7e-68
(A7FFY6) RecName: Full=Ribosomal RNA large subunit methyltransfe... 260 9e-68
(Q47WB7) RecName: Full=Ribosomal RNA large subunit methyltransfe... 260 9e-68
(Q8Y032) RecName: Full=Ribosomal RNA large subunit methyltransfe... 260 9e-68
(Q9CJJ8) RecName: Full=Ribosomal RNA large subunit methyltransfe... 260 9e-68
CU914168_1642(CU914168|pid:none) Ralstonia solanacearum strain I... 259 1e-67
CP000967_2446(CP000967|pid:none) Xanthomonas oryzae pv. oryzae P... 259 1e-67
(Q0K959) RecName: Full=Ribosomal RNA large subunit methyltransfe... 259 1e-67
(B2SMB3) RecName: Full=Ribosomal RNA large subunit methyltransfe... 259 1e-67
(A4WD95) RecName: Full=Ribosomal RNA large subunit methyltransfe... 259 2e-67
(A6TCD6) RecName: Full=Ribosomal RNA large subunit methyltransfe... 259 2e-67
(Q6D273) RecName: Full=Ribosomal RNA large subunit methyltransfe... 259 2e-67
CP001154_680(CP001154|pid:none) Laribacter hongkongensis HLHK9, ... 259 2e-67
(A1JKR9) RecName: Full=Ribosomal RNA large subunit methyltransfe... 259 2e-67
(Q74E53) RecName: Full=Ribosomal RNA large subunit methyltransfe... 258 3e-67
(A5GEC2) RecName: Full=Ribosomal RNA large subunit methyltransfe... 258 3e-67
CP001321_1882(CP001321|pid:none) Haemophilus parasuis SH0165, co... 258 3e-67
CP001158_263(CP001158|pid:none) Buchnera aphidicola str. Tuc7 (A... 258 3e-67
CP000964_1247(CP000964|pid:none) Klebsiella pneumoniae 342, comp... 258 3e-67
(Q65R87) RecName: Full=Ribosomal RNA large subunit methyltransfe... 258 3e-67
(Q13X26) RecName: Full=Ribosomal RNA large subunit methyltransfe... 258 3e-67
(B0U494) RecName: Full=Ribosomal RNA large subunit methyltransfe... 258 4e-67
AM942759_1829(AM942759|pid:none) Proteus mirabilis strain HI4320... 258 4e-67
CP001011_1662(CP001011|pid:none) Xylella fastidiosa M23, complet... 257 6e-67
(B2I7V5) RecName: Full=Ribosomal RNA large subunit methyltransfe... 257 6e-67
(Q7N709) RecName: Full=Ribosomal RNA large subunit methyltransfe... 257 8e-67
(A1WXZ3) RecName: Full=Ribosomal RNA large subunit methyltransfe... 257 8e-67
(Q0A989) RecName: Full=Ribosomal RNA large subunit methyltransfe... 257 8e-67
(Q2KY87) RecName: Full=Ribosomal RNA large subunit methyltransfe... 256 1e-66
CP001068_1037(CP001068|pid:none) Ralstonia pickettii 12J chromos... 256 1e-66
(Q21KT6) RecName: Full=Ribosomal RNA large subunit methyltransfe... 256 1e-66
(P44665) RecName: Full=Ribosomal RNA large subunit methyltransfe... 256 1e-66
CU928163_2788(CU928163|pid:none) Escherichia coli UMN026 chromos... 256 2e-66
(A7MGV3) RecName: Full=Ribosomal RNA large subunit methyltransfe... 256 2e-66
(Q12AB5) RecName: Full=Ribosomal RNA large subunit methyltransfe... 256 2e-66
(A1VNF1) RecName: Full=Ribosomal RNA large subunit methyltransfe... 256 2e-66
(Q7W6P5) RecName: Full=Ribosomal RNA large subunit methyltransfe... 255 2e-66
(A5UAC2) RecName: Full=Ribosomal RNA large subunit methyltransfe... 255 2e-66
(Q8FF55) RecName: Full=Ribosomal RNA large subunit methyltransfe... 255 2e-66
CP000934_1441(CP000934|pid:none) Cellvibrio japonicus Ueda107, c... 255 2e-66
(A1AE55) RecName: Full=Ribosomal RNA large subunit methyltransfe... 255 2e-66
CU928158_613(CU928158|pid:none) Escherichia fergusonii ATCC 3546... 255 2e-66
CP001281_3220(CP001281|pid:none) Thauera sp. MZ1T, complete geno... 255 2e-66
(Q7VWK8) RecName: Full=Ribosomal RNA large subunit methyltransfe... 254 4e-66
(A9N1Z8) RecName: Full=Ribosomal RNA large subunit methyltransfe... 254 5e-66
CP001138_2499(CP001138|pid:none) Salmonella enterica subsp. ente... 254 5e-66
(Q8ZN52) RecName: Full=Ribosomal RNA large subunit methyltransfe... 254 5e-66
(A9MHL3) RecName: Full=Ribosomal RNA large subunit methyltransfe... 254 5e-66
(A1TM24) RecName: Full=Ribosomal RNA large subunit methyltransfe... 254 6e-66
(A1AW44) RecName: Full=Ribosomal RNA large subunit methyltransfe... 254 6e-66
(Q31I07) RecName: Full=Ribosomal RNA large subunit methyltransfe... 254 6e-66
(A5CX33) RecName: Full=Ribosomal RNA large subunit methyltransfe... 254 6e-66
(Q9KTX3) RecName: Full=Ribosomal RNA large subunit methyltransfe... 253 8e-66
(A1WE19) RecName: Full=Ribosomal RNA large subunit methyltransfe... 253 8e-66
CP001233_699(CP001233|pid:none) Vibrio cholerae M66-2 chromosome... 253 8e-66
EU897440_1(EU897440|pid:none) Escherichia coli strain 493/89 hyp... 253 1e-65
(Q2NS37) RecName: Full=Ribosomal RNA large subunit methyltransfe... 253 1e-65
(Q7MNF3) RecName: Full=Ribosomal RNA large subunit methyltransfe... 253 1e-65
(A9IK57) RecName: Full=Ribosomal RNA large subunit methyltransfe... 253 1e-65
(Q8DEZ6) RecName: Full=Ribosomal RNA large subunit methyltransfe... 253 1e-65
(A9KFV0) RecName: Full=Ribosomal RNA large subunit methyltransfe... 252 2e-65
CP001020_978(CP001020|pid:none) Coxiella burnetii CbuK_Q154, com... 252 2e-65
(A6Q115) RecName: Full=Ribosomal RNA large subunit methyltransfe... 252 2e-65
(Q7VNZ4) RecName: Full=Ribosomal RNA large subunit methyltransfe... 251 3e-65
(Q4FTX0) RecName: Full=Ribosomal RNA large subunit methyltransfe... 251 4e-65
CP001600_3060(CP001600|pid:none) Edwardsiella ictaluri 93-146, c... 251 5e-65
CP001139_611(CP001139|pid:none) Vibrio fischeri MJ11 chromosome ... 251 5e-65
(A3N1S4) RecName: Full=Ribosomal RNA large subunit methyltransfe... 250 7e-65
(Q6MPV7) RecName: Full=Ribosomal RNA large subunit methyltransfe... 250 9e-65
(Q5E775) RecName: Full=Ribosomal RNA large subunit methyltransfe... 250 9e-65
(A4G4J9) RecName: Full=Ribosomal RNA large subunit methyltransfe... 249 2e-64
CP001279_1717(CP001279|pid:none) Nautilia profundicola AmH, comp... 249 2e-64
(A7HCD6) RecName: Full=Ribosomal RNA large subunit methyltransfe... 248 3e-64
(Q2LUM5) RecName: Full=Ribosomal RNA large subunit methyltransfe... 248 4e-64
(Q87S19) RecName: Full=Ribosomal RNA large subunit methyltransfe... 248 5e-64
AY281352_14(AY281352|pid:none) Uncultured Acidobacteria bacteriu... 247 6e-64
(Q6LU52) RecName: Full=Ribosomal RNA large subunit methyltransfe... 247 8e-64
(Q1MQJ3) RecName: Full=Ribosomal RNA large subunit methyltransfe... 246 1e-63
FM954972_552(FM954972|pid:none) Vibrio splendidus LGP32 chromoso... 246 1e-63
(Q1IRD1) RecName: Full=Ribosomal RNA large subunit methyltransfe... 245 3e-63
(A0LY94) RecName: Full=Ribosomal RNA large subunit methyltransfe... 244 4e-63
(Q1D6I6) RecName: Full=Ribosomal RNA large subunit methyltransfe... 244 5e-63
(Q0AE39) RecName: Full=Ribosomal RNA large subunit methyltransfe... 244 7e-63
(A5EVN1) RecName: Full=Ribosomal RNA large subunit methyltransfe... 242 3e-62
(A7I414) RecName: Full=Ribosomal RNA large subunit methyltransfe... 241 3e-62
CP001229_123(CP001229|pid:none) Sulfurihydrogenibium azorense Az... 241 4e-62
(Q11QF0) RecName: Full=Ribosomal RNA large subunit methyltransfe... 241 6e-62
(Q89AK8) RecName: Full=Ribosomal RNA large subunit methyltransfe... 240 7e-62
CP001359_2294(CP001359|pid:none) Anaeromyxobacter dehalogenans 2... 240 1e-61
AY281356_18(AY281356|pid:none) Uncultured Acidobacteria bacteriu... 239 2e-61
(Q5P7B0) RecName: Full=Ribosomal RNA large subunit methyltransfe... 239 2e-61
(B0K1Y9) RecName: Full=Ribosomal RNA large subunit methyltransfe... 238 3e-61
(Q2IIC5) RecName: Full=Ribosomal RNA large subunit methyltransfe... 238 3e-61
(A0RRU0) RecName: Full=Ribosomal RNA large subunit methyltransfe... 236 1e-60
(Q3A2Z4) RecName: Full=Ribosomal RNA large subunit methyltransfe... 236 2e-60
CP001275_306(CP001275|pid:none) Thermomicrobium roseum DSM 5159,... 235 2e-60
(A6H1B8) RecName: Full=Ribosomal RNA large subunit methyltransfe... 235 3e-60
(B0TGT1) RecName: Full=Ribosomal RNA large subunit methyltransfe... 235 3e-60
(A3DCX9) RecName: Full=Ribosomal RNA large subunit methyltransfe... 234 4e-60
CP001230_565(CP001230|pid:none) Persephonella marina EX-H1, comp... 234 7e-60
(A7HNQ1) RecName: Full=Ribosomal RNA large subunit methyltransfe... 234 7e-60
(Q8R9T4) RecName: Full=Ribosomal RNA large subunit methyltransfe... 233 9e-60
(Q6XK03) RecName: Full=Ribosomal RNA large subunit methyltransfe... 233 1e-59
(A8F8C2) RecName: Full=Ribosomal RNA large subunit methyltransfe... 233 2e-59
(Q01QF9) RecName: Full=Ribosomal RNA large subunit methyltransfe... 232 3e-59
(A5FJ06) RecName: Full=Ribosomal RNA large subunit methyltransfe... 231 3e-59
AP009153_1717(AP009153|pid:none) Gemmatimonas aurantiaca T-27 DN... 231 4e-59
(Q67PQ7) RecName: Full=Ribosomal RNA large subunit methyltransfe... 231 4e-59
CP001291_1574(CP001291|pid:none) Cyanothece sp. PCC 7424, comple... 230 1e-58
(Q03J17) RecName: Full=Ribosomal RNA large subunit methyltransfe... 230 1e-58
EF085348_1(EF085348|pid:none) Picea sitchensis clone WS0281_H05 ... 230 1e-58
(Q8RFZ9) RecName: Full=Ribosomal RNA large subunit methyltransfe... 229 1e-58
AP008955_3727(AP008955|pid:none) Brevibacillus brevis NBRC 10059... 228 4e-58
(A7H662) RecName: Full=Ribosomal RNA large subunit methyltransfe... 226 1e-57
(B2V4B5) RecName: Full=Ribosomal RNA large subunit methyltransfe... 226 1e-57
CP000916_903(CP000916|pid:none) Thermotoga neapolitana DSM 4359,... 226 1e-57
(Q0P7R8) RecName: Full=Ribosomal RNA large subunit methyltransfe... 226 2e-57
CP001215_550(CP001215|pid:none) Bacillus anthracis str. CDC 684,... 225 3e-57
CP001357_777(CP001357|pid:none) Brachyspira hyodysenteriae WA1, ... 225 3e-57
(Q24U12) RecName: Full=Ribosomal RNA large subunit methyltransfe... 225 3e-57
CP000932_21(CP000932|pid:none) Campylobacter lari RM2100, comple... 224 4e-57
(A6LN47) RecName: Full=Ribosomal RNA large subunit methyltransfe... 224 4e-57
(Q5HS83) RecName: Full=Ribosomal RNA large subunit methyltransfe... 224 4e-57
CT573071_1052(CT573071|pid:none) Kuenenia stuttgartiensis genome... 224 5e-57
(Q89ZK5) RecName: Full=Ribosomal RNA large subunit methyltransfe... 224 7e-57
(A9A3L9) RecName: Full=Ribosomal RNA large subunit methyltransfe... 224 7e-57
(Q2S0P9) RecName: Full=Ribosomal RNA large subunit methyltransfe... 223 9e-57
CP000975_87(CP000975|pid:none) Methylacidiphilum infernorum V4, ... 223 1e-56
(A8EQW8) RecName: Full=Ribosomal RNA large subunit methyltransfe... 223 1e-56
(Q72HC1) RecName: Full=Ribosomal RNA large subunit methyltransfe... 223 1e-56
(Q8Y9P2) RecName: Full=Ribosomal RNA large subunit methyltransfe... 223 1e-56
CP001336_3796(CP001336|pid:none) Desulfitobacterium hafniense DC... 223 1e-56
(Q9X240) RecName: Full=Ribosomal RNA large subunit methyltransfe... 222 2e-56
(Q6G9Z5) RecName: Full=Ribosomal RNA large subunit methyltransfe... 221 4e-56
(Q5SGZ3) RecName: Full=Ribosomal RNA large subunit methyltransfe... 221 4e-56
(Q110I1) RecName: Full=Ribosomal RNA large subunit methyltransfe... 221 4e-56
(B1XQH8) RecName: Full=Ribosomal RNA large subunit methyltransfe... 221 5e-56
(Q727F1) RecName: Full=Ribosomal RNA large subunit methyltransfe... 221 5e-56
(A1VAL8) RecName: Full=Ribosomal RNA large subunit methyltransfe... 221 5e-56
CP001101_1366(CP001101|pid:none) Chlorobium phaeobacteroides BS1... 221 6e-56
(Q8CSW0) RecName: Full=Ribosomal RNA large subunit methyltransfe... 221 6e-56
(Q5LGK5) RecName: Full=Ribosomal RNA large subunit methyltransfe... 221 6e-56
CP001129_561(CP001129|pid:none) Streptococcus equi subsp. zooepi... 221 6e-56
(Q0SS81) RecName: Full=Ribosomal RNA large subunit methyltransfe... 221 6e-56
(Q3K2R2) RecName: Full=Ribosomal RNA large subunit methyltransfe... 220 8e-56
(Q5HPX3) RecName: Full=Ribosomal RNA large subunit methyltransfe... 220 8e-56
CP000922_1765(CP000922|pid:none) Anoxybacillus flavithermus WK1,... 220 8e-56
FM204884_1422(FM204884|pid:none) Streptococcus equi subsp. zooep... 220 8e-56
CP001322_4619(CP001322|pid:none) Desulfatibacillum alkenivorans ... 220 8e-56
(Q0TPL4) RecName: Full=Ribosomal RNA large subunit methyltransfe... 220 1e-55
(Q8E6Q7) RecName: Full=Ribosomal RNA large subunit methyltransfe... 220 1e-55
(Q1JG02) RecName: Full=Ribosomal RNA large subunit methyltransfe... 219 1e-55
(Q057Q1) RecName: Full=Ribosomal RNA large subunit methyltransfe... 219 2e-55
(Q64XE8) RecName: Full=Ribosomal RNA large subunit methyltransfe... 219 2e-55
(A7GG92) RecName: Full=Ribosomal RNA large subunit methyltransfe... 219 2e-55
(Q1J0P9) RecName: Full=Ribosomal RNA large subunit methyltransfe... 218 3e-55
(A7ZGB0) RecName: Full=Ribosomal RNA large subunit methyltransfe... 218 3e-55
(A2RDK1) RecName: Full=Ribosomal RNA large subunit methyltransfe... 218 4e-55
(B1IIL7) RecName: Full=Ribosomal RNA large subunit methyltransfe... 218 4e-55
(Q1J5R7) RecName: Full=Ribosomal RNA large subunit methyltransfe... 218 4e-55
(A2C4M8) RecName: Full=Ribosomal RNA large subunit methyltransfe... 218 4e-55
(Q47S46) RecName: Full=Ribosomal RNA large subunit methyltransfe... 218 4e-55
CP001108_1129(CP001108|pid:none) Prosthecochloris aestuarii DSM ... 218 5e-55
(Q1JAS5) RecName: Full=Ribosomal RNA large subunit methyltransfe... 218 5e-55
(B1KX56) RecName: Full=Ribosomal RNA large subunit methyltransfe... 217 7e-55
(Q5L0S1) RecName: Full=Ribosomal RNA large subunit methyltransfe... 217 9e-55
(A9NEU7) RecName: Full=Ribosomal RNA large subunit methyltransfe... 217 9e-55
CP001358_437(CP001358|pid:none) Desulfovibrio desulfuricans subs... 217 9e-55
(Q6MDD0) RecName: Full=Ribosomal RNA large subunit methyltransfe... 216 1e-54
(Q7VGY9) RecName: Full=Ribosomal RNA large subunit methyltransfe... 216 1e-54
(Q1DCU1) RecName: Full=Ribosomal RNA large subunit methyltransfe... 216 1e-54
(A2RHR3) RecName: Full=Ribosomal RNA large subunit methyltransfe... 216 1e-54
(Q7NIV3) RecName: Full=Ribosomal RNA large subunit methyltransfe... 216 1e-54
(A8FD40) RecName: Full=Ribosomal RNA large subunit methyltransfe... 215 3e-54
(Q97RN5) RecName: Full=Ribosomal RNA large subunit methyltransfe... 214 4e-54
CP001015_693(CP001015|pid:none) Streptococcus pneumoniae G54, co... 214 6e-54
(A1BGN4) RecName: Full=Ribosomal RNA large subunit methyltransfe... 214 7e-54
CP001287_1392(CP001287|pid:none) Cyanothece sp. PCC 8801, comple... 214 7e-54
(B1YG36) RecName: Full=Ribosomal RNA large subunit methyltransfe... 213 1e-53
(A9AY55) RecName: Full=Ribosomal RNA large subunit methyltransfe... 213 1e-53
(Q9CJ27) RecName: Full=Ribosomal RNA large subunit methyltransfe... 213 1e-53
BT003921_1(BT003921|pid:none) Arabidopsis thaliana clone RAFL15-... 213 1e-53
(Q032R6) RecName: Full=Ribosomal RNA large subunit methyltransfe... 213 1e-53
(Q9RVT6) RecName: Full=Ribosomal RNA large subunit methyltransfe... 213 2e-53
CR954212_218(CR954212|pid:none) Ostreococcus tauri strain OTTH05... 213 2e-53
(Q55880) RecName: Full=Ribosomal RNA large subunit methyltransfe... 213 2e-53
(B1HQE6) RecName: Full=Ribosomal RNA large subunit methyltransfe... 212 2e-53
(A4IM49) RecName: Full=Ribosomal RNA large subunit methyltransfe... 212 2e-53
BX908798_695(BX908798|pid:none) Parachlamydia-related symbiont U... 211 4e-53
BT039489_1(BT039489|pid:none) Zea mays full-length cDNA clone ZM... 211 5e-53
(A7Z4J5) RecName: Full=Ribosomal RNA large subunit methyltransfe... 211 6e-53
(B2A2K6) RecName: Full=Ribosomal RNA large subunit methyltransfe... 210 8e-53
CP001114_1548(CP001114|pid:none) Deinococcus deserti VCD115, com... 210 1e-52
(A8AVZ7) RecName: Full=Ribosomal RNA large subunit methyltransfe... 210 1e-52
AP008957_2550(AP008957|pid:none) Rhodococcus erythropolis PR4 DN... 210 1e-52
AP009484_802(AP009484|pid:none) Macrococcus caseolyticus JCSC540... 209 1e-52
(A7GVW3) RecName: Full=Ribosomal RNA large subunit methyltransfe... 209 1e-52
CP001472_56(CP001472|pid:none) Acidobacterium capsulatum ATCC 51... 209 1e-52
(A5D1B6) RecName: Full=Ribosomal RNA large subunit methyltransfe... 209 1e-52
(Q8EVK0) RecName: Full=Ribosomal RNA large subunit methyltransfe... 209 2e-52
CP001055_1155(CP001055|pid:none) Elusimicrobium minutum Pei191, ... 209 2e-52
CP001344_13(CP001344|pid:none) Cyanothece sp. PCC 7425, complete... 208 3e-52
(A8M6B6) RecName: Full=Ribosomal RNA large subunit methyltransfe... 208 4e-52
CP001213_1281(CP001213|pid:none) Bifidobacterium animalis subsp.... 207 5e-52
(B1I501) RecName: Full=Ribosomal RNA large subunit methyltransfe... 207 5e-52
(Q7UHU7) RecName: Full=Ribosomal RNA large subunit methyltransfe... 207 5e-52
(Q0S277) RecName: Full=Ribosomal RNA large subunit methyltransfe... 207 7e-52
(Q5WKB6) RecName: Full=Ribosomal RNA large subunit methyltransfe... 207 9e-52
(Q72NP7) RecName: Full=Ribosomal RNA large subunit methyltransfe... 207 9e-52
CP001107_2265(CP001107|pid:none) Eubacterium rectale ATCC 33656,... 206 1e-51
CP000920_707(CP000920|pid:none) Streptococcus pneumoniae P1031, ... 206 1e-51
(B1IAU3) RecName: Full=Ribosomal RNA large subunit methyltransfe... 206 2e-51
(A6L8G0) RecName: Full=Ribosomal RNA large subunit methyltransfe... 206 2e-51
(Q31MD1) RecName: Full=Ribosomal RNA large subunit methyltransfe... 206 2e-51
CP001615_2848(CP001615|pid:none) Exiguobacterium sp. AT1b, compl... 205 3e-51
(Q7MTB0) RecName: Full=Ribosomal RNA large subunit methyltransfe... 205 3e-51
(Q8F7V1) RecName: Full=Ribosomal RNA large subunit methyltransfe... 205 3e-51
CP001110_1399(CP001110|pid:none) Pelodictyon phaeoclathratiforme... 205 3e-51
CP001104_681(CP001104|pid:none) Eubacterium eligens ATCC 27750, ... 205 3e-51
CP000673_1328(CP000673|pid:none) Clostridium kluyveri DSM 555, c... 204 4e-51
(A1A1I4) RecName: Full=Ribosomal RNA large subunit methyltransfe... 204 4e-51
(Q3ASD4) RecName: Full=Ribosomal RNA large subunit methyltransfe... 204 4e-51
(Q6MED6) RecName: Full=Ribosomal RNA large subunit methyltransfe... 204 6e-51
(Q0I7M1) RecName: Full=Ribosomal RNA large subunit methyltransfe... 204 6e-51
AK060011_1(AK060011|pid:none) Oryza sativa Japonica Group cDNA c... 204 6e-51
(A9WFY6) RecName: Full=Ribosomal RNA large subunit methyltransfe... 204 6e-51
(Q3AZA0) RecName: Full=Ribosomal RNA large subunit methyltransfe... 204 8e-51
(Q8ELW7) RecName: Full=Ribosomal RNA large subunit methyltransfe... 204 8e-51
(A4SEQ5) RecName: Full=Ribosomal RNA large subunit methyltransfe... 204 8e-51
(Q82JY3) RecName: Full=Ribosomal RNA large subunit methyltransfe... 203 1e-50
(Q0RDQ8) RecName: Full=Ribosomal RNA large subunit methyltransfe... 203 1e-50
CU458896_3149(CU458896|pid:none) Mycobacterium abscessus chromos... 203 1e-50
(Q2J713) RecName: Full=Ribosomal RNA large subunit methyltransfe... 203 1e-50
(A2BT57) RecName: Full=Ribosomal RNA large subunit methyltransfe... 203 1e-50
(B2HJP3) RecName: Full=Ribosomal RNA large subunit methyltransfe... 202 2e-50
(Q5MZJ6) RecName: Full=Ribosomal RNA large subunit methyltransfe... 202 2e-50
(Q8G481) RecName: Full=Ribosomal RNA large subunit methyltransfe... 202 2e-50
(Q6NGK9) RecName: Full=Ribosomal RNA large subunit methyltransfe... 202 2e-50
(A0PQ89) RecName: Full=Ribosomal RNA large subunit methyltransfe... 202 3e-50
AB1851(AB1851) hypothetical protein all0355 [imported] - Nostoc ... 202 3e-50
(A0LV48) RecName: Full=Ribosomal RNA large subunit methyltransfe... 202 3e-50
(A1SLQ4) RecName: Full=Ribosomal RNA large subunit methyltransfe... 201 4e-50
CP001097_1366(CP001097|pid:none) Chlorobium limicola DSM 245, co... 201 5e-50
(Q6A7K4) RecName: Full=Ribosomal RNA large subunit methyltransfe... 201 5e-50
(Q73KZ3) RecName: Full=Ribosomal RNA large subunit methyltransfe... 201 5e-50
(Q7VA32) RecName: Full=Ribosomal RNA large subunit methyltransfe... 201 6e-50
EU974479_1(EU974479|pid:none) Zea mays clone 450319 hypothetical... 200 8e-50
(Q318R1) RecName: Full=Ribosomal RNA large subunit methyltransfe... 200 1e-49
(Q17ZF6) RecName: Full=Ribosomal RNA large subunit methyltransfe... 199 1e-49
AP008209_660(AP008209|pid:none) Oryza sativa (japonica cultivar-... 199 1e-49
(Q97IC4) RecName: Full=Ribosomal RNA large subunit methyltransfe... 199 2e-49
(Q2JRQ8) RecName: Full=Ribosomal RNA large subunit methyltransfe... 199 2e-49
(A3PEX0) RecName: Full=Ribosomal RNA large subunit methyltransfe... 199 2e-49
(Q1CRK2) RecName: Full=Ribosomal RNA large subunit methyltransfe... 199 2e-49
(A1T787) RecName: Full=Ribosomal RNA large subunit methyltransfe... 198 3e-49
EU970386_1(EU970386|pid:none) Zea mays clone 344013 hypothetical... 198 4e-49
(Q1AYW0) RecName: Full=Ribosomal RNA large subunit methyltransfe... 197 6e-49
(Q73VR8) RecName: Full=Ribosomal RNA large subunit methyltransfe... 197 6e-49
CP001173_1320(CP001173|pid:none) Helicobacter pylori G27, comple... 196 2e-48
(B2UVG6) RecName: Full=Ribosomal RNA large subunit methyltransfe... 196 2e-48
(A5GNG9) RecName: Full=Ribosomal RNA large subunit methyltransfe... 196 2e-48
(Q2JMN2) RecName: Full=Ribosomal RNA large subunit methyltransfe... 195 4e-48
(Q9ZJI4) RecName: Full=Ribosomal RNA large subunit methyltransfe... 194 5e-48
(A2BYK7) RecName: Full=Ribosomal RNA large subunit methyltransfe... 194 5e-48
CP001217_1389(CP001217|pid:none) Helicobacter pylori P12, comple... 194 5e-48
(A5UT23) RecName: Full=Ribosomal RNA large subunit methyltransfe... 194 6e-48
AM425055_1(AM425055|pid:none) Vitis vinifera contig VV78X086233.... 194 8e-48
(A1UEJ3) RecName: Full=Ribosomal RNA large subunit methyltransfe... 194 8e-48
(A7NPY6) RecName: Full=Ribosomal RNA large subunit methyltransfe... 193 1e-47
(A1KMM4) RecName: Full=Ribosomal RNA large subunit methyltransfe... 193 1e-47
AB109467_5(AB109467|pid:none) Pseudomonas putida genes for heat ... 192 2e-47
(Q7V010) RecName: Full=Ribosomal RNA large subunit methyltransfe... 192 2e-47
AP010656_318(AP010656|pid:none) Candidatus Azobacteroides pseudo... 192 2e-47
CU466930_1184(CU466930|pid:none) Candidatus Cloacamonas acidamin... 192 3e-47
CP001601_1550(CP001601|pid:none) Corynebacterium aurimucosum ATC... 191 4e-47
(A9BCH2) RecName: Full=Ribosomal RNA large subunit methyltransfe... 191 4e-47
AM749838_4(AM749838|pid:none) Clostridium difficile ORF1, ORF2, ... 191 7e-47
(B0SGA8) RecName: Full=Ribosomal RNA large subunit methyltransfe... 190 1e-46
(Q7V5P5) RecName: Full=Ribosomal RNA large subunit methyltransfe... 189 2e-46
(A2C6T3) RecName: Full=Ribosomal RNA large subunit methyltransfe... 189 3e-46
CP001618_2486(CP001618|pid:none) Beutenbergia cavernae DSM 12333... 188 4e-46
CP001330_458(CP001330|pid:none) Micromonas sp. RCC299 chromosome... 187 7e-46
(A5GVE8) RecName: Full=Ribosomal RNA large subunit methyltransfe... 185 3e-45
BT036351_1(BT036351|pid:none) Zea mays full-length cDNA clone ZM... 185 3e-45
(B1KZ37) RecName: Full=Ribosomal RNA large subunit methyltransfe... 184 8e-45
(A5I5U3) RecName: Full=Ribosomal RNA large subunit methyltransfe... 183 1e-44
(A6W7W9) RecName: Full=Ribosomal RNA large subunit methyltransfe... 183 1e-44
CP000472_1385(CP000472|pid:none) Shewanella piezotolerans WP3, c... 182 3e-44
CP001083_2982(CP001083|pid:none) Clostridium botulinum Ba4 str. ... 181 4e-44
CP001326_414(CP001326|pid:none) Micromonas sp. RCC299 chromosome... 181 7e-44
(A7GH77) RecName: Full=Ribosomal RNA large subunit methyltransfe... 180 1e-43
CP001091_1325(CP001091|pid:none) Actinobacillus pleuropneumoniae... 180 1e-43
AP008955_4504(AP008955|pid:none) Brevibacillus brevis NBRC 10059... 171 4e-41
CP000585_353(CP000585|pid:none) Ostreococcus lucimarinus CCE9901... 169 2e-40
CP001130_1385(CP001130|pid:none) Hydrogenobaculum sp. Y04AAS1, c... 169 2e-40
(B2S216) RecName: Full=Ribosomal RNA large subunit methyltransfe... 169 3e-40
AP003855_8(AP003855|pid:none) Oryza sativa Japonica Group genomi... 168 5e-40
CP000592_226(CP000592|pid:none) Ostreococcus lucimarinus CCE9901... 167 6e-40
CP000583_503(CP000583|pid:none) Ostreococcus lucimarinus CCE9901... 166 1e-39
AJ937765_8(AJ937765|pid:none) Uncultured candidate division OP8 ... 161 6e-38
CR940353_729(CR940353|pid:none) Theileria annulata strain Ankara... 160 7e-38
CR954201_143(CR954201|pid:none) Ostreococcus tauri strain OTTH05... 160 7e-38
(Q47GW8) RecName: Full=Ribosomal RNA large subunit methyltransfe... 159 2e-37
CR954205_365(CR954205|pid:none) Ostreococcus tauri strain OTTH05... 158 4e-37
CP001141_96(CP001141|pid:none) Phaeodactylum tricornutum CCAP 10... 155 3e-36
CP000251_4215(CP000251|pid:none) Anaeromyxobacter dehalogenans 2... 154 5e-36
(Q2IHD1) RecName: Full=Ribosomal RNA large subunit methyltransfe... 154 5e-36
CP001324_725(CP001324|pid:none) Micromonas sp. RCC299 chromosome... 154 7e-36
(A4VLN9) RecName: Full=Ribosomal RNA large subunit methyltransfe... 154 9e-36
CP001131_4322(CP001131|pid:none) Anaeromyxobacter sp. K, complet... 153 1e-35
CU695238_42(CU695238|pid:none) Ralstonia solanacearum strain Mol... 153 1e-35
(A1K1N5) RecName: Full=Ribosomal RNA large subunit methyltransfe... 152 2e-35
(A7HIL1) RecName: Full=Ribosomal RNA large subunit methyltransfe... 152 2e-35
(A4XU99) RecName: Full=Ribosomal RNA large subunit methyltransfe... 152 3e-35
CP001359_4341(CP001359|pid:none) Anaeromyxobacter dehalogenans 2... 150 8e-35
CR954203_490(CR954203|pid:none) Ostreococcus tauri strain OTTH05... 149 3e-34
(Q5P119) RecName: Full=Ribosomal RNA large subunit methyltransfe... 147 9e-34
CR555306_2870(CR555306|pid:none) Azoarcus sp. EbN1 complete geno... 147 9e-34
CP001281_1342(CP001281|pid:none) Thauera sp. MZ1T, complete geno... 144 9e-33
(Q3SHI2) RecName: Full=Ribosomal RNA large subunit methyltransfe... 140 1e-31
(A2SLX7) RecName: Full=Ribosomal RNA large subunit methyltransfe... 138 4e-31
AX050493_1(AX050493|pid:none) Sequence 7 from Patent WO0072022. 137 1e-30
(A9EPV3) RecName: Full=Ribosomal RNA large subunit methyltransfe... 134 6e-30
CP001184_199(CP001184|pid:none) Ureaplasma urealyticum serovar 1... 134 1e-29
AE002120_14(AE002120|pid:none) Ureaplasma parvum serovar 3 str. ... 132 4e-29
CP000611_2966(CP000611|pid:none) Mycobacterium tuberculosis H37R... 126 2e-27
BT035810_1(BT035810|pid:none) Zea mays full-length cDNA clone ZM... 123 2e-26
AE000657_1063(AE000657|pid:none) Aquifex aeolicus VF5, complete ... 122 2e-26
AM438765_1(AM438765|pid:none) Vitis vinifera contig VV78X202329.... 119 2e-25
CP001230_275(CP001230|pid:none) Persephonella marina EX-H1, comp... 114 8e-24
CP000407_1669(CP000407|pid:none) Streptococcus suis 05ZYH33, com... 102 3e-20
CP001080_395(CP001080|pid:none) Sulfurihydrogenibium sp. YO3AOP1... 102 4e-20
CP000919_664(CP000919|pid:none) Streptococcus pneumoniae JJA, co... 101 7e-20
Y18639_2(Y18639|pid:none) Staphylococcus aureus ORF1 and ORF2 (p... 99 5e-19
CP000472_1384(CP000472|pid:none) Shewanella piezotolerans WP3, c... 92 6e-17
CP000407_1667(CP000407|pid:none) Streptococcus suis 05ZYH33, com... 88 6e-16
BT053007_1(BT053007|pid:none) Medicago truncatula clone MTYFL_FM... 75 7e-12
BX842581_67(BX842581|pid:none) Mycobacterium tuberculosis H37Rv ... 74 1e-11
(Q5UP06) RecName: Full=Uncharacterized protein R756; &AY653733_... 69 3e-11
CP000812_1848(CP000812|pid:none) Thermotoga lettingae TMO, compl... 64 2e-08
CP000771_473(CP000771|pid:none) Fervidobacterium nodosum Rt17-B1... 61 1e-07
CP000916_554(CP000916|pid:none) Thermotoga neapolitana DSM 4359,... 55 6e-06
AE000512_135(AE000512|pid:none) Thermotoga maritima MSB8, comple... 55 8e-06
CP000879_441(CP000879|pid:none) Petrotoga mobilis SJ95, complete... 52 4e-05
CP000767_1434(CP000767|pid:none) Campylobacter curvus 525.92, co... 47 0.002
CP000561_24(CP000561|pid:none) Pyrobaculum calidifontis JCM 1154... 46 0.003
CP000492_1787(CP000492|pid:none) Chlorobium phaeobacteroides DSM... 44 0.010
EU197055_427(EU197055|pid:none) Pseudomonas phage 201phi2-1, com... 44 0.013
CP001230_1078(CP001230|pid:none) Persephonella marina EX-H1, com... 44 0.017
AY714836_17(AY714836|pid:none) Uncultured archaeon GZfos23H9 clo... 44 0.017
AE017261_1057(AE017261|pid:none) Picrophilus torridus DSM 9790, ... 43 0.030
BT038308_1(BT038308|pid:none) Zea mays full-length cDNA clone ZM... 42 0.050
CP000377_821(CP000377|pid:none) Silicibacter sp. TM1040, complet... 42 0.066
CP000562_1138(CP000562|pid:none) Methanoculleus marisnigri JR1, ... 40 0.19
CP000724_3401(CP000724|pid:none) Alkaliphilus metalliredigens QY... 40 0.19
BX571658_22(BX571658|pid:none) Wolinella succinogenes, complete ... 40 0.19
CP000673_1704(CP000673|pid:none) Clostridium kluyveri DSM 555, c... 40 0.19
CP000108_680(CP000108|pid:none) Chlorobium chlorochromatii CaD3,... 39 0.33
CP001014_55(CP001014|pid:none) Thermoproteus neutrophilus V24Sta... 39 0.33
AE015928_3156(AE015928|pid:none) Bacteroides thetaiotaomicron VP... 39 0.43
AE017125_1831(AE017125|pid:none) Helicobacter hepaticus ATCC 514... 39 0.43
CP000855_503(CP000855|pid:none) Thermococcus onnurineus NA1, com... 39 0.43
CP000721_1985(CP000721|pid:none) Clostridium beijerinckii NCIMB ... 39 0.56
AP006878_704(AP006878|pid:none) Thermococcus kodakarensis KOD1 D... 39 0.56
CP001145_845(CP001145|pid:none) Coprothermobacter proteolyticus ... 38 0.73
AY603957_7(AY603957|pid:none) Clostsridium pasteurianum nitrogen... 38 0.73
CP000096_1427(CP000096|pid:none) Pelodictyon luteolum DSM 273, c... 38 0.95
(Q57567) RecName: Full=Uncharacterized protein MJ0103; &G64312(... 38 0.95
CP001173_102(CP001173|pid:none) Helicobacter pylori G27, complet... 38 0.95
AE006641_867(AE006641|pid:none) Sulfolobus solfataricus P2, comp... 38 0.95
BA000001_1662(BA000001|pid:none) Pyrococcus horikoshii OT3 DNA, ... 38 0.95
CP000743_1437(CP000743|pid:none) Methanococcus aeolicus Nankai-3... 38 0.95
CP001099_1507(CP001099|pid:none) Chlorobaculum parvum NCIB 8327,... 38 0.95
CP000686_779(CP000686|pid:none) Roseiflexus sp. RS-1, complete g... 37 1.2
AP009179_1456(AP009179|pid:none) Sulfurovum sp. NBC37-1 genomic ... 37 1.2
(Q971H1) RecName: Full=Probable molybdenum cofactor biosynthesis... 37 1.2
CP001147_1222(CP001147|pid:none) Thermodesulfovibrio yellowstoni... 37 1.2
CP000504_1088(CP000504|pid:none) Pyrobaculum islandicum DSM 4184... 37 1.6
(Q9ZMV6) RecName: Full=UPF0026 protein jhp_0109; &AE001439_108(... 37 1.6
BX571856_1620(BX571856|pid:none) Staphylococcus aureus subsp. au... 37 1.6
AP009324_1564(AP009324|pid:none) Staphylococcus aureus subsp. au... 37 1.6
CP001108_1511(CP001108|pid:none) Prosthecochloris aestuarii DSM ... 37 2.1
AJ938182_1448(AJ938182|pid:none) Staphylococcus aureus RF122 com... 37 2.1
CP000698_3400(CP000698|pid:none) Geobacter uraniireducens Rf4, c... 37 2.1
CR954210_96(CR954210|pid:none) Ostreococcus tauri strain OTTH059... 37 2.1
AP006878_2297(AP006878|pid:none) Thermococcus kodakarensis KOD1 ... 36 2.8
CP001217_119(CP001217|pid:none) Helicobacter pylori P12, complet... 36 2.8
>(A7HSW7) RecName: Full=Ribosomal RNA large subunit methyltransferase
N; EC=2.1.1.-; AltName: Full=23S rRNA m2A2503
methyltransferase; &CP000774_1377(CP000774|pid:none)
Length = 399
Score = 338 bits (867), Expect = 3e-91
Identities = 176/360 (48%), Positives = 241/360 (66%), Gaps = 15/360 (4%)
Frame = +3
Query: 165 NLIGIQKDELEDKVLKLGYP----KYLSEQIWAFMYNKGIVDINSFERVSKEKREEIKSK 332
+L G+ + L D + G P + + QIW +YN+G D +SKE R ++
Sbjct: 23 HLAGLTRPLLMDALKAFGLPDNQLRMRAGQIWNGLYNRGFTDFERMTTLSKELRGKLADA 82
Query: 333 YEVNIGEITKHQLSVDGTRKLLISFD-------GAEVESVFIPEGKRGTLCVSSQVGCTF 491
++++ EI Q SVDGTRK L+ G EVE+V+IPE RGTLCVSSQVGCT
Sbjct: 83 FDISRLEIVTEQKSVDGTRKWLLRLPSGIPGVPGPEVETVYIPEEGRGTLCVSSQVGCTL 142
Query: 492 ACTFCHTGTQKFIRNLTASEIVSQVIATRHVLNDFTD---SSIKRTLTNIVFMGQGEPFY 662
CTFCHTGTQK +RNLTA EIV Q++ R L ++ D +S R +TNIV MG GEP Y
Sbjct: 143 TCTFCHTGTQKLVRNLTAGEIVGQILLARDALGEWPDGGRNSEDRLITNIVMMGMGEPLY 202
Query: 663 NYRNVSKAIKIITDPNGLAIGKSKITVSTSGVVPLIDRLGSDFPGIGLAISLHSANDKTR 842
N+ NV A+++++D GL++ K +IT+STSGVVP+I+R G + G LAISLH+ +D+TR
Sbjct: 203 NFENVRDALEVVSDGEGLSLSKRRITLSTSGVVPMIERAGEEI-GCMLAISLHAVDDETR 261
Query: 843 SEIVPANRQWPISELVEACIKF-SKNCKERITIEYVMLKGVNDSEQDAYDLVKLSKSFPS 1019
+ +VP N+++PI+EL+EAC + + RIT EYVMLKGVNDS +DA LV+L K P+
Sbjct: 262 NRLVPLNKKYPIAELLEACRNYPGVSNARRITFEYVMLKGVNDSLEDAKALVRLLKHIPA 321
Query: 1020 FVNLIPFNPWPGSQYKSSSKETISQFSKILDDKGIKVTIRQPRGRDILAACGQLNTESIK 1199
+NLIPFNPWPGS Y+ S E I +F+ +++ G +R PRGRDI+AACGQL +E++K
Sbjct: 322 KINLIPFNPWPGSPYECSDWEQIEKFADVVNRAGYASPVRTPRGRDIMAACGQLKSETVK 381
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 3204285
Number of Hits to DB: 1,892,681,115
Number of extensions: 35737300
Number of successful extensions: 102287
Number of sequences better than 10.0: 515
Number of HSP's gapped: 100866
Number of HSP's successfully gapped: 521
Length of query: 450
Length of database: 1,040,966,779
Length adjustment: 132
Effective length of query: 318
Effective length of database: 618,001,159
Effective search space: 196524368562
Effective search space used: 196524368562
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 32 (16.9 bits)
|
| PSORT |
|
| VS (DIR, S) |
0 |
| VH (FL, L) |
0 |
| VF (FL, S) |
1 |
| AH (FL, L) |
0 |
| AF (FL, S) |
0 |
| SL (DIR, L) |
0 |
| SS (DIR, S) |
1 |
| SH (FL, L) |
0 |
| SF (FL, S) |
0 |
| CH (FL, L) |
0 |
| CF (FL, S) |
0 |
| FCL (DIR, L) |
0 |
| FC (DIR, S) |
0 |
| FC-IC (SUB) |
0 |